F475124

General Info

Members Datasets Scaffolds Average Seq Length
685 237 680 262

Family's Representative Sequence

Representative Sequence 3300009553|Ga0105249_10156887|Ga0105249_101568871
Length 287
Sequence VSSLIEAGARRWDTARGCVVESATVPALFEARGVTKRFGGLTALHGVDFAVDRGISSIIGPNGAGKTTLFNIFTGLYAADEGSVTFRDQPLLGLRPDQITALGICRTFQNIRLFANMTAIENVLVGMNSRISLRLWDVLSRSPSFRRTESELAARAVALLNRVGLQVSANVVARNLPYGDRRRLELARALASEPALLLLDEPTAGMTQGEAGALMHLLRGLVADLGIAIILIEHNMRVVMEVSDRVTVLDHGEKIAEGPPRAVQSDARVIEAYLGKRGAGPRAKPRA

Samples

Sample ID Description Type Environment
1 2738541299 Paenisporosarcina sp. OV554 Isolate Unclassified
2 2881644220 Siminovitchia terrae LMG 29736 Isolate Rhizosphere
3 2928510474 Sporosarcina psychrophila 1288 Isolate Rhizosphere
4 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
61 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
64 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
151 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
154 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
155 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
156 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
157 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
158 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
159 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
160 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
161 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
162 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
163 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
164 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
165 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
166 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
167 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
168 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
169 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
170 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
171 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
172 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
173 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
174 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
175 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
176 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
177 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
178 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
179 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
180 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
181 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
182 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
183 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
184 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
185 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
186 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
187 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
188 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
189 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
190 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
191 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
192 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
193 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
194 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
195 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
196 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
197 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
198 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
199 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
200 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
201 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
213 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
214 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
215 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
216 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
217 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
218 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
219 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
220 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
221 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
222 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
223 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
224 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
225 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
226 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
227 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
228 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
229 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
230 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
231 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
232 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
233 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
234 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
235 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
236 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
237 8057632132 Cytobacillus kochii RZ2 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.27
Metatranscriptomes 0
Isolates 0.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.46
Rhizosphere 97.81
Stem 0
Stem Tuber 0
Unclassified 0.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10002900 3300005293 Bacteria 5788
2 Ga0065707_10009170 3300005295 Bacteria 3117
3 Ga0065707_10131770 3300005295 Bacteria 1906
4 Ga0070676_10008865 3300005328 Bacteria 5433
5 Ga0070683_100280376 3300005329 Bacteria 1585
6 Ga0070670_100001289 3300005331 Bacteria 20007
7 Ga0068869_100003857 3300005334 Bacteria 9251
8 Ga0068869_100022065 3300005334 Bacteria 4384
9 Ga0070680_100001395 3300005336 Bacteria 17457
10 Ga0070680_100024956 3300005336 Bacteria 4778
11 Ga0070680_100285915 3300005336 Bacteria 1397
12 Ga0070680_100374962 3300005336 Bacteria 1211
13 Ga0070682_100008694 3300005337 Bacteria 5727
14 Ga0070660_100031972 3300005339 Bacteria 3957
15 Ga0070689_100006470 3300005340 Bacteria 8110
16 Ga0070689_100080147 3300005340 Bacteria 2562
17 Ga0070691_10040782 3300005341 Bacteria 2194
18 Ga0070661_100009543 3300005344 Bacteria 6722
19 Ga0070692_10001432 3300005345 Bacteria 8653
20 Ga0070669_100077215 3300005353 Bacteria 2474
21 Ga0070669_100227063 3300005353 Bacteria 1478
22 Ga0070659_100012916 3300005366 Bacteria 6207
23 Ga0070667_100272041 3300005367 Bacteria 1519
24 Ga0070703_10012278 3300005406 Bacteria 2426
25 Ga0070701_10028578 3300005438 Bacteria 2742
26 Ga0070711_100019200 3300005439 Bacteria 4382
27 Ga0070705_100002695 3300005440 Bacteria 8875
28 Ga0070705_100005606 3300005440 Bacteria 6127
29 Ga0070705_100041715 3300005440 Bacteria 2618
30 Ga0070705_100053588 3300005440 Bacteria 2362
31 Ga0070705_100079216 3300005440 Bacteria 2012
32 Ga0070700_100235499 3300005441 Bacteria 1305
33 Ga0070694_100019497 3300005444 Bacteria 4313
34 Ga0070694_100022829 3300005444 Bacteria 4015
35 Ga0070694_100081098 3300005444 Bacteria 2256
36 Ga0070708_100000456 3300005445 Bacteria 30655
37 Ga0070708_100046888 3300005445 Bacteria 3815
38 Ga0070708_100311392 3300005445 Bacteria 1483
39 Ga0070708_100369811 3300005445 Bacteria 1351
40 Ga0070663_100029655 3300005455 Bacteria 3740
41 Ga0070662_100018535 3300005457 Bacteria 4710
42 Ga0070662_100093695 3300005457 Bacteria 2260
43 Ga0070662_100158271 3300005457 Bacteria 1770
44 Ga0070681_10047982 3300005458 Bacteria 4268
45 Ga0068867_100011008 3300005459 Bacteria 6377
46 Ga0070706_100007217 3300005467 Bacteria 10443
47 Ga0070706_100019138 3300005467 Bacteria 6317
48 Ga0070706_100020684 3300005467 Bacteria 6063
49 Ga0070706_100099375 3300005467 Bacteria 2704
50 Ga0070706_100234221 3300005467 Bacteria 1714
51 Ga0070706_100308252 3300005467 Bacteria 1477
52 Ga0070706_100346544 3300005467 Bacteria 1385
53 Ga0070706_100674187 3300005467 Bacteria 959
54 Ga0070706_100713894 3300005467 Bacteria 929
55 Ga0070707_100000758 3300005468 Bacteria 31816
56 Ga0070707_100243682 3300005468 Bacteria 1749
57 Ga0070707_100501525 3300005468 Bacteria 1175
58 Ga0070698_100002218 3300005471 Bacteria 21496
59 Ga0070698_100002999 3300005471 Bacteria 18592
60 Ga0070698_100037580 3300005471 Bacteria 4991
61 Ga0070698_100201844 3300005471 Bacteria 1924
62 Ga0070698_100266376 3300005471 Bacteria 1645
63 Ga0070698_100366210 3300005471 Bacteria 1373
64 Ga0070699_100000498 3300005518 Bacteria 37320
65 Ga0070699_100003559 3300005518 Bacteria 13768
66 Ga0070699_100005500 3300005518 Bacteria 11111
67 Ga0070699_100007084 3300005518 Bacteria 9737
68 Ga0070699_100023293 3300005518 Bacteria 5334
69 Ga0070699_100218108 3300005518 Bacteria 1700
70 Ga0070699_100229278 3300005518 Bacteria 1656
71 Ga0070699_100428126 3300005518 Bacteria 1198
72 Ga0070679_100020201 3300005530 Bacteria 6493
73 Ga0070684_100119521 3300005535 Bacteria 2370
74 Ga0070697_100001129 3300005536 Bacteria 20201
75 Ga0070697_100001193 3300005536 Bacteria 19656
76 Ga0070697_100008100 3300005536 Bacteria 8198
77 Ga0070697_100008303 3300005536 Bacteria 8103
78 Ga0070697_100008725 3300005536 Bacteria 7916
79 Ga0070697_100331227 3300005536 Bacteria 1312
80 Ga0070697_100523804 3300005536 Bacteria 1038
81 Ga0070697_100576563 3300005536 Bacteria 988
82 Ga0068853_100010688 3300005539 Bacteria 7432
83 Ga0070672_100006940 3300005543 Bacteria 7657
84 Ga0070672_100383599 3300005543 Bacteria 1202
85 Ga0070695_100168622 3300005545 Bacteria 1543
86 Ga0070695_100208577 3300005545 Bacteria 1401
87 Ga0070695_100260420 3300005545 Bacteria 1266
88 Ga0070695_100280136 3300005545 Bacteria 1225
89 Ga0070696_100013950 3300005546 Bacteria 5395
90 Ga0070696_100023128 3300005546 Bacteria 4224
91 Ga0070696_100046533 3300005546 Bacteria 3008
92 Ga0070696_100080594 3300005546 Bacteria 2305
93 Ga0070696_100125252 3300005546 Bacteria 1864
94 Ga0070693_100000159 3300005547 Bacteria 30940
95 Ga0070693_100068201 3300005547 Bacteria 2087
96 Ga0070704_100000116 3300005549 Bacteria 28451
97 Ga0070704_100065389 3300005549 Bacteria 2618
98 Ga0070704_100070547 3300005549 Bacteria 2535
99 Ga0070704_100098284 3300005549 Bacteria 2199
100 Ga0070704_100154623 3300005549 Bacteria 1807
101 Ga0070704_100434745 3300005549 Bacteria 1127
102 Ga0068855_100001156 3300005563 Bacteria 32706
103 Ga0070664_100023826 3300005564 Bacteria 5056
104 Ga0068857_100031045 3300005577 Bacteria 4722
105 Ga0068854_100025822 3300005578 Bacteria 4031
106 Ga0068854_100189533 3300005578 Bacteria 1610
107 Ga0068854_100247048 3300005578 Bacteria 1423
108 Ga0068856_100001122 3300005614 Bacteria 28279
109 Ga0070702_100169717 3300005615 Bacteria 1418
110 Ga0068852_100115829 3300005616 Bacteria 2444
111 Ga0068859_100009149 3300005617 Bacteria 10004
112 Ga0068859_100037546 3300005617 Bacteria 4861
113 Ga0068859_100092975 3300005617 Bacteria 3067
114 Ga0068859_100238933 3300005617 Bacteria 1905
115 Ga0068861_100025732 3300005719 Bacteria 4272
116 Ga0068861_100143155 3300005719 Bacteria 1954
117 Ga0068861_100661408 3300005719 Bacteria 966
118 Ga0068870_10002227 3300005840 Bacteria 8046
119 Ga0068863_100019061 3300005841 Bacteria 6568
120 Ga0068863_100036484 3300005841 Bacteria 4683
121 Ga0068858_100121976 3300005842 Bacteria 2438
122 Ga0068858_100157666 3300005842 Bacteria 2136
123 Ga0068858_100366708 3300005842 Bacteria 1381
124 Ga0068858_100503895 3300005842 Bacteria 1170
125 Ga0068860_100054902 3300005843 Bacteria 3786
126 Ga0068860_100088348 3300005843 Bacteria 2950
127 Ga0068862_100002282 3300005844 Bacteria 17155
128 Ga0068862_100035154 3300005844 Bacteria 4241
129 Ga0068862_100197200 3300005844 Bacteria 1814
130 Ga0081455_10000042 3300005937 Bacteria 133329
131 Ga0081455_10006197 3300005937 Bacteria 12894
132 Ga0081538_10002059 3300005981 Bacteria 20076
133 Ga0081540_1000024 3300005983 Bacteria 158868
134 Ga0081539_10001809 3300005985 Bacteria 33796
135 Ga0075432_10050156 3300006058 Bacteria 1471
136 Ga0070715_10020458 3300006163 Bacteria 2553
137 Ga0070715_10046461 3300006163 Bacteria 1846
138 Ga0070716_100301479 3300006173 Bacteria 1115
139 Ga0070712_100015268 3300006175 Bacteria 4941
140 Ga0075428_100004435 3300006844 Bacteria 15500
141 Ga0075428_100005773 3300006844 Bacteria 13743
142 Ga0075428_100011091 3300006844 Bacteria 10027
143 Ga0075428_100062929 3300006844 Bacteria 4062
144 Ga0075428_100091205 3300006844 Bacteria 3324
145 Ga0075428_100119457 3300006844 Bacteria 2870
146 Ga0075428_100135896 3300006844 Bacteria 2673
147 Ga0075428_100230494 3300006844 Bacteria 1999
148 Ga0075428_100397114 3300006844 Bacteria 1478
149 Ga0075428_100775138 3300006844 Bacteria 1020
150 Ga0075430_100000473 3300006846 Bacteria 30094
151 Ga0075430_100003267 3300006846 Bacteria 13589
152 Ga0075430_100040096 3300006846 Bacteria 3964
153 Ga0075430_100059903 3300006846 Bacteria 3200
154 Ga0075430_100072256 3300006846 Bacteria 2893
155 Ga0075431_100000162 3300006847 Bacteria 46892
156 Ga0075431_100000280 3300006847 Bacteria 39760
157 Ga0075431_100000480 3300006847 Bacteria 33148
158 Ga0075431_100002035 3300006847 Bacteria 19311
159 Ga0075431_100006625 3300006847 Bacteria 11508
160 Ga0075431_100009915 3300006847 Bacteria 9568
161 Ga0075431_100052073 3300006847 Bacteria 4221
162 Ga0075431_100084722 3300006847 Bacteria 3272
163 Ga0075431_100086676 3300006847 Bacteria 3231
164 Ga0075431_100251500 3300006847 Bacteria 1796
165 Ga0075431_100312272 3300006847 Bacteria 1587
166 Ga0075433_10000094 3300006852 Bacteria 41881
167 Ga0075433_10000147 3300006852 Bacteria 37403
168 Ga0075433_10000340 3300006852 Bacteria 29026
169 Ga0075433_10001383 3300006852 Bacteria 17853
170 Ga0075433_10001866 3300006852 Bacteria 15837
171 Ga0075433_10014443 3300006852 Bacteria 6452
172 Ga0075433_10015815 3300006852 Bacteria 6203
173 Ga0075433_10018839 3300006852 Bacteria 5744
174 Ga0075433_10052072 3300006852 Bacteria 3566
175 Ga0075433_10058139 3300006852 Bacteria 3381
176 Ga0075433_10068561 3300006852 Bacteria 3114
177 Ga0075433_10084395 3300006852 Bacteria 2803
178 Ga0075433_10102890 3300006852 Bacteria 2530
179 Ga0075433_10489621 3300006852 Bacteria 1083
180 Ga0075433_10503734 3300006852 Bacteria 1066
181 Ga0075434_100000039 3300006871 Bacteria 59823
182 Ga0075434_100000207 3300006871 Bacteria 39963
183 Ga0075434_100003606 3300006871 Bacteria 13818
184 Ga0075434_100009129 3300006871 Bacteria 9237
185 Ga0075434_100015392 3300006871 Bacteria 7330
186 Ga0075434_100023007 3300006871 Bacteria 6067
187 Ga0075434_100025372 3300006871 Bacteria 5798
188 Ga0075434_100026328 3300006871 Bacteria 5696
189 Ga0075434_100042940 3300006871 Bacteria 4483
190 Ga0075434_100062936 3300006871 Bacteria 3693
191 Ga0075434_100186438 3300006871 Bacteria 2095
192 Ga0075434_100190457 3300006871 Bacteria 2071
193 Ga0075434_100231929 3300006871 Bacteria 1865
194 Ga0075434_100244576 3300006871 Bacteria 1814
195 Ga0075434_100440032 3300006871 Bacteria 1325
196 Ga0075429_100000042 3300006880 Bacteria 57742
197 Ga0075429_100001320 3300006880 Bacteria 20236
198 Ga0075429_100002766 3300006880 Bacteria 14832
199 Ga0075429_100029357 3300006880 Bacteria 4777
200 Ga0075429_100039909 3300006880 Bacteria 4085
201 Ga0075429_100060368 3300006880 Bacteria 3303
202 Ga0075429_100201750 3300006880 Bacteria 1743
203 Ga0075436_100000316 3300006914 Bacteria 30801
204 Ga0075436_100007152 3300006914 Bacteria 7638
205 Ga0075436_100017003 3300006914 Bacteria 4978
206 Ga0075436_100045813 3300006914 Bacteria 3016
207 Ga0075436_100053934 3300006914 Bacteria 2775
208 Ga0097620_100009149 3300006931 Bacteria 10004
209 Ga0097620_100037548 3300006931 Bacteria 4861
210 Ga0097620_100092980 3300006931 Bacteria 3067
211 Ga0097620_100238932 3300006931 Bacteria 1905
212 Ga0075435_100001253 3300007076 Bacteria 16255
213 Ga0075435_100009114 3300007076 Bacteria 7163
214 Ga0075435_100011360 3300007076 Bacteria 6546
215 Ga0075435_100013131 3300007076 Bacteria 6152
216 Ga0075435_100022457 3300007076 Bacteria 4869
217 Ga0075435_100039081 3300007076 Bacteria 3786
218 Ga0075435_100066101 3300007076 Bacteria 2941
219 Ga0075435_100080814 3300007076 Bacteria 2669
220 Ga0075435_100081781 3300007076 Bacteria 2653
221 Ga0075435_100082224 3300007076 Bacteria 2647
222 Ga0075435_100090970 3300007076 Bacteria 2518
223 Ga0075435_100098072 3300007076 Bacteria 2426
224 Ga0075435_100106131 3300007076 Bacteria 2332
225 Ga0075435_100125147 3300007076 Bacteria 2148
226 Ga0075435_100154223 3300007076 Bacteria 1932
227 Ga0075435_100289853 3300007076 Bacteria 1398
228 Ga0099794_10010736 3300007265 Bacteria 3897
229 Ga0099794_10017071 3300007265 Bacteria 3230
230 Ga0099794_10064234 3300007265 Bacteria 1788
231 Ga0105240_10352616 3300009093 Bacteria 1669
232 Ga0111539_10000304 3300009094 Bacteria 59789
233 Ga0111539_10002279 3300009094 Bacteria 25538
234 Ga0111539_10004936 3300009094 Bacteria 17349
235 Ga0111539_10007623 3300009094 Bacteria 13830
236 Ga0111539_10046000 3300009094 Bacteria 5222
237 Ga0111539_10165002 3300009094 Bacteria 2590
238 Ga0111539_10257782 3300009094 Bacteria 2031
239 Ga0114129_10000331 3300009147 Bacteria 55274
240 Ga0114129_10000431 3300009147 Bacteria 49869
241 Ga0114129_10001127 3300009147 Bacteria 35311
242 Ga0114129_10001268 3300009147 Bacteria 33724
243 Ga0114129_10002159 3300009147 Bacteria 27115
244 Ga0114129_10006269 3300009147 Bacteria 16857
245 Ga0114129_10008504 3300009147 Bacteria 14629
246 Ga0114129_10011558 3300009147 Bacteria 12573
247 Ga0114129_10012518 3300009147 Bacteria 12080
248 Ga0114129_10016004 3300009147 Bacteria 10667
249 Ga0114129_10026673 3300009147 Bacteria 8183
250 Ga0114129_10038736 3300009147 Bacteria 6721
251 Ga0114129_10041662 3300009147 Bacteria 6468
252 Ga0114129_10140074 3300009147 Bacteria 3317
253 Ga0114129_10193943 3300009147 Bacteria 2756
254 Ga0114129_10313978 3300009147 Bacteria 2086
255 Ga0114129_10314835 3300009147 Bacteria 2082
256 Ga0114129_10330851 3300009147 Bacteria 2023
257 Ga0114129_10351971 3300009147 Bacteria 1951
258 Ga0114129_10413710 3300009147 Bacteria 1775
259 Ga0114129_10550387 3300009147 Bacteria 1500
260 Ga0114129_10593604 3300009147 Bacteria 1436
261 Ga0114129_10681618 3300009147 Bacteria 1323
262 Ga0114129_10772312 3300009147 Bacteria 1228
263 Ga0114129_10796654 3300009147 Bacteria 1206
264 Ga0114129_11302335 3300009147 Bacteria 900
265 Ga0105241_10004152 3300009174 Bacteria 10696
266 Ga0105241_10009815 3300009174 Bacteria 7035
267 Ga0105248_10059040 3300009177 Bacteria 4308
268 Ga0105248_10331233 3300009177 Bacteria 1715
269 Ga0105238_10736371 3300009551 Bacteria 999
270 Ga0105249_10009084 3300009553 Bacteria 8691
271 Ga0105249_10028827 3300009553 Bacteria 5011
272 Ga0105249_10156887 3300009553 Bacteria 2195
273 Ga0105249_10189572 3300009553 Bacteria 2006
274 Ga0105249_10553555 3300009553 Bacteria 1201
275 Ga0105249_10802852 3300009553 Bacteria 1005
276 Ga0105239_10209445 3300010375 Bacteria 2185
277 Ga0105246_10018430 3300011119 Bacteria 4449
278 Ga0157373_10001579 3300013100 Bacteria 17390
279 Ga0157371_10013604 3300013102 Bacteria 6175
280 Ga0157370_10189797 3300013104 Bacteria 1908
281 Ga0157369_10061287 3300013105 Bacteria 4056
282 Ga0157369_10175220 3300013105 Bacteria 2258
283 Ga0157378_10167010 3300013297 Bacteria 2062
284 Ga0163162_10172046 3300013306 Bacteria 2291
285 Ga0163162_10239614 3300013306 Bacteria 1945
286 Ga0157372_10009351 3300013307 Bacteria 10432
287 Ga0157372_10231680 3300013307 Bacteria 2141
288 Ga0157375_10089666 3300013308 Bacteria 3132
289 Ga0157380_10132769 3300014326 Bacteria 2127
290 Ga0157380_10220005 3300014326 Bacteria 1698
291 Ga0157380_10396717 3300014326 Bacteria 1307
292 Ga0207653_10003577 3300025885 Bacteria 4895
293 Ga0207642_10091834 3300025899 Bacteria 1501
294 Ga0207688_10023960 3300025901 Bacteria 3346
295 Ga0207647_10036087 3300025904 Bacteria 3144
296 Ga0207685_10012226 3300025905 Bacteria 2612
297 Ga0207685_10082856 3300025905 Bacteria 1332
298 Ga0207645_10000497 3300025907 Bacteria 32462
299 Ga0207643_10000696 3300025908 Bacteria 20944
300 Ga0207684_10000456 3300025910 Bacteria 53373
301 Ga0207684_10001190 3300025910 Bacteria 29079
302 Ga0207684_10009571 3300025910 Bacteria 8548
303 Ga0207684_10012547 3300025910 Bacteria 7364
304 Ga0207684_10025324 3300025910 Bacteria 5055
305 Ga0207684_10029937 3300025910 Bacteria 4635
306 Ga0207684_10048072 3300025910 Bacteria 3618
307 Ga0207684_10085635 3300025910 Bacteria 2684
308 Ga0207684_10151008 3300025910 Bacteria 1999
309 Ga0207684_10411557 3300025910 Bacteria 1162
310 Ga0207654_10013178 3300025911 Bacteria 4248
311 Ga0207707_10001074 3300025912 Bacteria 26185
312 Ga0207693_10028454 3300025915 Bacteria 4416
313 Ga0207660_10003270 3300025917 Bacteria 10602
314 Ga0207660_10295340 3300025917 Bacteria 1289
315 Ga0207657_10000681 3300025919 Bacteria 36192
316 Ga0207649_10051148 3300025920 Bacteria 2558
317 Ga0207652_10006888 3300025921 Bacteria 9158
318 Ga0207646_10000483 3300025922 Bacteria 53346
319 Ga0207646_10001440 3300025922 Bacteria 29536
320 Ga0207646_10006141 3300025922 Bacteria 12496
321 Ga0207646_10013235 3300025922 Bacteria 7893
322 Ga0207646_10042198 3300025922 Bacteria 4099
323 Ga0207646_10114468 3300025922 Bacteria 2422
324 Ga0207646_10125642 3300025922 Bacteria 2306
325 Ga0207646_10164421 3300025922 Bacteria 2003
326 Ga0207646_10444218 3300025922 Bacteria 1170
327 Ga0207681_10142327 3300025923 Bacteria 1787
328 Ga0207681_10181702 3300025923 Bacteria 1603
329 Ga0207650_10072109 3300025925 Bacteria 2599
330 Ga0207690_10031710 3300025932 Bacteria 3385
331 Ga0207706_10018406 3300025933 Bacteria 6285
332 Ga0207706_10150271 3300025933 Bacteria 2048
333 Ga0207706_10529873 3300025933 Bacteria 1015
334 Ga0207670_10043384 3300025936 Bacteria 2970
335 Ga0207670_10140682 3300025936 Bacteria 1779
336 Ga0207704_10261152 3300025938 Bacteria 1306
337 Ga0207665_10062253 3300025939 Bacteria 2531
338 Ga0207691_10021739 3300025940 Bacteria 6057
339 Ga0207691_10096310 3300025940 Bacteria 2646
340 Ga0207691_10378295 3300025940 Bacteria 1209
341 Ga0207711_10036379 3300025941 Bacteria 4178
342 Ga0207711_10173837 3300025941 Bacteria 1956
343 Ga0207711_10504863 3300025941 Bacteria 1127
344 Ga0207689_10000721 3300025942 Bacteria 31658
345 Ga0207689_10021817 3300025942 Bacteria 5384
346 Ga0207689_10145104 3300025942 Bacteria 1955
347 Ga0207661_10096228 3300025944 Bacteria 2477
348 Ga0207679_10045791 3300025945 Bacteria 3166
349 Ga0207667_10016784 3300025949 Bacteria 8259
350 Ga0207651_10132973 3300025960 Bacteria 1908
351 Ga0207712_10075852 3300025961 Bacteria 2432
352 Ga0207712_10093296 3300025961 Bacteria 2221
353 Ga0207712_10189206 3300025961 Bacteria 1623
354 Ga0207668_10144076 3300025972 Bacteria 1836
355 Ga0207640_10061340 3300025981 Bacteria 2490
356 Ga0207640_10211773 3300025981 Bacteria 1477
357 Ga0207658_10197985 3300025986 Bacteria 1675
358 Ga0207703_10079800 3300026035 Bacteria 2724
359 Ga0207639_10017336 3300026041 Bacteria 5105
360 Ga0207678_10013487 3300026067 Bacteria 7174
361 Ga0207641_10109696 3300026088 Bacteria 2444
362 Ga0207648_10003940 3300026089 Bacteria 15444
363 Ga0207648_10167626 3300026089 Bacteria 1941
364 Ga0207648_10227762 3300026089 Bacteria 1658
365 Ga0207676_10024205 3300026095 Bacteria 4490
366 Ga0207674_10000181 3300026116 Bacteria 77248
367 Ga0207674_10705349 3300026116 Bacteria 974
368 Ga0207675_100028813 3300026118 Bacteria 5173
369 Ga0207675_100085265 3300026118 Bacteria 2964
370 Ga0207698_10589183 3300026142 Bacteria 1095
371 Ga0209996_1001132 3300027395 Bacteria 3188
372 Ga0209984_1007834 3300027424 Bacteria 1333
373 Ga0210000_1008595 3300027462 Bacteria 1498
374 Ga0209968_1010650 3300027526 Bacteria 1416
375 Ga0209999_1002987 3300027543 Bacteria 3006
376 Ga0209982_1000520 3300027552 Bacteria 4801
377 Ga0209970_1001453 3300027614 Bacteria 4142
378 Ga0209588_1039660 3300027671 Bacteria 1519
379 Ga0209588_1045719 3300027671 Bacteria 1416
380 Ga0209588_1076535 3300027671 Bacteria 1081
381 Ga0209971_1000068 3300027682 Bacteria 32081
382 Ga0209966_1000188 3300027695 Bacteria 25569
383 Ga0209998_10000118 3300027717 Bacteria 31322
384 Ga0209974_10000096 3300027876 Bacteria 24685
385 Ga0207428_10000009 3300027907 Bacteria 410565
386 Ga0207428_10000095 3300027907 Bacteria 123199
387 Ga0207428_10001314 3300027907 Bacteria 26458
388 Ga0207428_10020675 3300027907 Bacteria 5586
389 Ga0207428_10050329 3300027907 Bacteria 3334
390 Ga0207428_10064345 3300027907 Bacteria 2895
391 Ga0268265_10005207 3300028380 Bacteria 8909
392 Ga0268265_10073071 3300028380 Bacteria 2677
393 Ga0268265_10080922 3300028380 Bacteria 2563
394 Ga0268264_10047051 3300028381 Bacteria 3585
395 Ga0268264_10078097 3300028381 Bacteria 2821
396 Ga0268264_10142515 3300028381 Bacteria 2139
397 Ga0307408_100020563 3300031548 Bacteria 4458
398 Ga0307408_100075983 3300031548 Bacteria 2497
399 Ga0307410_10018441 3300031852 Bacteria 4218
400 Ga0307409_100132199 3300031995 Bacteria 2135
401 Ga0307416_100184818 3300032002 Bacteria 1958
402 Ga0307416_100548934 3300032002 Bacteria 1228
403 Ga0307414_10193405 3300032004 Bacteria 1648
404 Ga0373948_0010017 3300034817 Bacteria 1646
405 Ga0373959_0003986 3300034820 Bacteria 2365
406 Ga0373949_0051052 3300035090 Bacteria 1042
407 Ga0373932_0081390 3300035112 Bacteria 1023
408 Ga0373939_0068609 3300035114 Bacteria 1148
409 Ga0373941_0046991 3300035115 Bacteria 1358
410 Ga0373941_0066062 3300035115 Bacteria 1189
411 Ga0373960_0048188 3300035121 Bacteria 1256
412 Ga0373942_0020763 3300035207 Bacteria 1652
413 Ga0373931_0028858 3300035691 Bacteria 2844
414 Ga0373931_0032912 3300035691 Bacteria 2685
415 Ga0395899_0041080 3300037312 Bacteria 3457
416 Ga0395900_0040407 3300037418 Bacteria 4807
417 Ga0395900_0442911 3300037418 Bacteria 1256
418 Ga0395898_0008002 3300037466 Bacteria 11217
419 Ga0395905_0094425 3300037471 Bacteria 2806
420 Ga0395905_0096025 3300037471 Bacteria 2783
421 Ga0395901_0003953 3300038443 Bacteria 14912
422 Ga0242420_008318 3300038996 Bacteria 1680
423 Ga0242420_020054 3300038996 Bacteria 1187
424 Ga0436365_0651255 3300039437 Bacteria 1495
425 Ga0436363_1314268 3300039450 Bacteria 1407
426 Ga0439455_0003312 3300042012 Bacteria 3060
427 Ga0450889_005262 3300042144 Bacteria 1285
428 Ga0439459_0000856 3300042438 Bacteria 4247
429 Ga0439464_0000432 3300042439 Bacteria 8263
430 Ga0439460_0000793 3300042461 Bacteria 7156
431 Ga0451577_0034285 3300042876 Bacteria 4576
432 Ga0451577_0039120 3300042876 Bacteria 4262
433 Ga0451577_0093018 3300042876 Bacteria 2692
434 Ga0451577_0147421 3300042876 Bacteria 2117
435 Ga0451577_0340020 3300042876 Bacteria 1361
436 Ga0451577_0402199 3300042876 Bacteria 1243
437 Ga0451577_0487566 3300042876 Bacteria 1119
438 Ga0439440_0068592 3300042993 Bacteria 919
439 Ga0453683_0000412 3300044673 Bacteria 49894
440 Ga0453683_0022929 3300044673 Bacteria 3979
441 Ga0453683_0059181 3300044673 Bacteria 2396
442 Ga0453684_0044386 3300044712 Bacteria 5949
443 Ga0453684_0080736 3300044712 Bacteria 4059
444 Ga0453684_0152043 3300044712 Bacteria 2749
445 Ga0453684_0386028 3300044712 Bacteria 1571
446 Ga0453684_0582413 3300044712 Bacteria 1229
447 Ga0451576_0001286 3300045051 Bacteria 43648
448 Ga0451576_0012493 3300045051 Bacteria 9535
449 Ga0451576_0034619 3300045051 Bacteria 5363
450 Ga0451576_0082572 3300045051 Bacteria 3342
451 Ga0451576_0099125 3300045051 Bacteria 3031
452 Ga0451576_0137182 3300045051 Bacteria 2551
453 Ga0451576_0141100 3300045051 Bacteria 2512
454 Ga0451576_0171678 3300045051 Bacteria 2263
455 Ga0451576_0187376 3300045051 Bacteria 2160
456 Ga0451576_0446621 3300045051 Bacteria 1357
457 Ga0495580_0000020 3300046472 Bacteria 91314
458 Ga0495580_0000190 3300046472 Bacteria 46579
459 Ga0495580_0001497 3300046472 Bacteria 20532
460 Ga0495580_0067738 3300046472 Bacteria 2497
461 Ga0495642_0008677 3300046528 Bacteria 3884
462 Ga0495642_0076073 3300046528 Bacteria 1409
463 Ga0495598_0043509 3300046537 Bacteria 1323
464 Ga0495659_0112923 3300046664 Bacteria 1063
465 Ga0495669_0002437 3300046684 Bacteria 7603
466 Ga0495670_0086831 3300046691 Bacteria 1598
467 Ga0495636_0071228 3300047318 Bacteria 1484
468 Ga0495684_0109414 3300047471 Bacteria 2087
469 Ga0496102_0055268 3300048905 Bacteria 3620
470 Ga0496102_0077008 3300048905 Bacteria 3069
471 Ga0496103_0171725 3300048906 Bacteria 1392
472 Ga0496104_0453303 3300048907 Bacteria 1194
473 Ga0496106_0047076 3300048909 Bacteria 3244
474 Ga0496112_0063673 3300048915 Bacteria 3638
475 Ga0496113_0383237 3300048916 Bacteria 1128
476 Ga0496114_0090153 3300048917 Bacteria 2603
477 Ga0496114_0429799 3300048917 Bacteria 1170
478 Ga0496114_0545316 3300048917 Bacteria 1025
479 Ga0496117_0273377 3300048920 Bacteria 909
480 Ga0501033_0106617 3300049570 Bacteria 2041
481 Ga0501036_0031692 3300049572 Bacteria 4468
482 Ga0501036_0309461 3300049572 Bacteria 1321
483 Ga0501036_0322324 3300049572 Bacteria 1291
484 Ga0501036_0392474 3300049572 Bacteria 1158
485 Ga0501037_0470040 3300049573 Bacteria 856
486 Ga0501038_0080483 3300049574 Bacteria 2746
487 Ga0501038_0241369 3300049574 Bacteria 1434
488 Ga0501039_0012303 3300049575 Bacteria 6526
489 Ga0501039_0023127 3300049575 Bacteria 4768
490 Ga0501040_0010060 3300049576 Bacteria 6178
491 Ga0501040_0012854 3300049576 Bacteria 5499
492 Ga0501040_0023593 3300049576 Bacteria 4125
493 Ga0501040_0034025 3300049576 Bacteria 3453
494 Ga0501040_0089699 3300049576 Bacteria 2136
495 Ga0501040_0243073 3300049576 Bacteria 1283
496 Ga0501041_0006032 3300049577 Bacteria 7089
497 Ga0501041_0008758 3300049577 Bacteria 5954
498 Ga0501041_0329413 3300049577 Bacteria 964
499 Ga0501042_0012286 3300049578 Bacteria 5796
500 Ga0501042_0512684 3300049578 Bacteria 871
501 Ga0501043_0062008 3300049579 Bacteria 2936
502 Ga0501046_0003128 3300049580 Bacteria 15281
503 Ga0501048_0018656 3300049582 Bacteria 5100
504 Ga0501068_0017568 3300049584 Bacteria 4139
505 Ga0501068_0113961 3300049584 Bacteria 1683
506 Ga0501068_0300575 3300049584 Bacteria 1027
507 Ga0501071_0048418 3300049587 Bacteria 3057
508 Ga0501071_0104664 3300049587 Bacteria 2089
509 Ga0501071_0118019 3300049587 Bacteria 1965
510 Ga0501072_0024749 3300049588 Bacteria 4672
511 Ga0501072_0047183 3300049588 Bacteria 3392
512 Ga0501072_0116504 3300049588 Bacteria 2128
513 Ga0501072_0165475 3300049588 Bacteria 1764
514 Ga0501073_0169411 3300049589 Bacteria 1512
515 Ga0501074_0003740 3300049590 Bacteria 10808
516 Ga0501074_0030926 3300049590 Bacteria 3879
517 Ga0501074_0094086 3300049590 Bacteria 2146
518 Ga0501075_0001883 3300049591 Bacteria 13847
519 Ga0501075_0002282 3300049591 Bacteria 12721
520 Ga0501075_0002974 3300049591 Bacteria 11336
521 Ga0501075_0013652 3300049591 Bacteria 5802
522 Ga0501075_0013875 3300049591 Bacteria 5763
523 Ga0501075_0175199 3300049591 Bacteria 1637
524 Ga0501076_0019026 3300049592 Bacteria 5240
525 Ga0501076_0051530 3300049592 Bacteria 3258
526 Ga0501076_0099799 3300049592 Bacteria 2339
527 Ga0501076_0374379 3300049592 Bacteria 1170
528 Ga0501077_0003322 3300049593 Bacteria 9682
529 Ga0501077_0019213 3300049593 Bacteria 4321
530 Ga0501077_0028513 3300049593 Bacteria 3548
531 Ga0501077_0129265 3300049593 Bacteria 1601
532 Ga0501077_0202288 3300049593 Bacteria 1262
533 Ga0501079_0001669 3300049741 Bacteria 15776
534 Ga0501079_0002057 3300049741 Bacteria 14424
535 Ga0501079_0015545 3300049741 Bacteria 5811
536 Ga0501079_0059406 3300049741 Bacteria 2949
537 Ga0501080_0049885 3300049742 Bacteria 3896
538 Ga0501080_0071496 3300049742 Bacteria 3227
539 Ga0501080_0279220 3300049742 Bacteria 1519
540 Ga0501081_0002245 3300049743 Bacteria 12149
541 Ga0501081_0004585 3300049743 Bacteria 8875
542 Ga0501081_0010456 3300049743 Bacteria 6054
543 Ga0501081_0015789 3300049743 Bacteria 4985
544 Ga0501081_0151289 3300049743 Bacteria 1667
545 Ga0501081_0361177 3300049743 Bacteria 1071
546 Ga0501083_0106692 3300049744 Bacteria 1844
547 Ga0501083_0148805 3300049744 Bacteria 1533
548 Ga0501045_0000941 3300049824 Bacteria 19037
549 Ga0501045_0021825 3300049824 Bacteria 4582
550 Ga0501045_0038621 3300049824 Bacteria 3473
551 Ga0501045_0045736 3300049824 Bacteria 3187
552 Ga0501045_0089283 3300049824 Bacteria 2277
553 Ga0501045_0206149 3300049824 Bacteria 1465
554 nmdc:mga05p37_1053_c1 3300050507 Bacteria 31461
555 nmdc:mga05p37_11660_c1 3300050507 Bacteria 10476
556 nmdc:mga05p37_143040_c1 3300050507 Bacteria 2930
557 nmdc:mga05p37_144482_c1 3300050507 Bacteria 2914
558 nmdc:mga05p37_155405_c1 3300050507 Bacteria 2796
559 nmdc:mga05p37_244960_c1 3300050507 Bacteria 2153
560 nmdc:mga05p37_245723_c1 3300050507 Bacteria 2149
561 nmdc:mga05p37_255349_c1 3300050507 Bacteria 2101
562 nmdc:mga05p37_25926_c1 3300050507 Bacteria 7127
563 nmdc:mga05p37_27569_c1 3300050507 Bacteria 6916
564 nmdc:mga05p37_30382_c1 3300050507 Bacteria 6592
565 nmdc:mga05p37_333712_c1 3300050507 Bacteria 1790
566 nmdc:mga05p37_340_c1 3300050507 Bacteria 50074
567 nmdc:mga05p37_347854_c1 3300050507 Bacteria 1746
568 nmdc:mga05p37_4531_c1 3300050507 Bacteria 16240
569 nmdc:mga05p37_463226_c1 3300050507 Bacteria 1464
570 nmdc:mga05p37_54314_c1 3300050507 Bacteria 4928
571 nmdc:mga05p37_54527_c1 3300050507 Bacteria 4918
572 nmdc:mga05p37_578638_c1 3300050507 Bacteria 1272
573 nmdc:mga05p37_690594_c1 3300050507 Bacteria 1136
574 nmdc:mga05p37_74151_c1 3300050507 Bacteria 4189
575 nmdc:mga05p37_89499_c1 3300050507 Bacteria 3793
576 nmdc:mga09592_162342_c1 3300050508 Bacteria 1930
577 nmdc:mga09592_176508_c1 3300050508 Bacteria 1848
578 nmdc:mga09592_25027_c1 3300050508 Bacteria 4938
579 nmdc:mga09592_2666_c1 3300050508 Bacteria 14433
580 nmdc:mga09592_3851_c1 3300050508 Bacteria 12075
581 nmdc:mga09592_50961_c1 3300050508 Bacteria 3492
582 nmdc:mga09592_749_c1 3300050508 Bacteria 24971
583 nmdc:mga09592_810_c1 3300050508 Bacteria 8764
584 nmdc:mga09592_8986_c1 3300050508 Bacteria 8126
585 nmdc:mga09592_9005_c1 3300050508 Bacteria 8116
586 nmdc:mga0qj67_15692_c1 3300050509 Bacteria 5738
587 nmdc:mga0qj67_2519_c1 3300050509 Bacteria 13089
588 nmdc:mga0qj67_29253_c1 3300050509 Bacteria 4279
589 nmdc:mga0qj67_586_c1 3300050509 Bacteria 24826
590 nmdc:mga06r32_142078_c1 3300050510 Bacteria 2377
591 nmdc:mga06r32_175315_c1 3300050510 Bacteria 2128
592 nmdc:mga06r32_208_c1 3300050510 Bacteria 47351
593 nmdc:mga06r32_2871_c1 3300050510 Bacteria 15460
594 nmdc:mga06r32_29605_c1 3300050510 Bacteria 5134
595 nmdc:mga06r32_313641_c1 3300050510 Bacteria 1554
596 nmdc:mga06r32_35833_c1 3300050510 Bacteria 4682
597 nmdc:mga06r32_39673_c1 3300050510 Bacteria 4469
598 nmdc:mga06r32_40504_c1 3300050510 Bacteria 4423
599 nmdc:mga06r32_4899_c1 3300050510 Bacteria 12058
600 nmdc:mga06r32_52292_c1 3300050510 Bacteria 3912
601 nmdc:mga06r32_527222_c1 3300050510 Bacteria 1156
602 nmdc:mga06r32_892_c1 3300050510 Bacteria 26556
603 nmdc:mga06r32_91341_c1 3300050510 Bacteria 2975
604 nmdc:mga08y16_18006_c1 3300050511 Bacteria 7441
605 nmdc:mga08y16_20783_c1 3300050511 Bacteria 6929
606 nmdc:mga08y16_302395_c1 3300050511 Bacteria 1649
607 nmdc:mga08y16_731_c1 3300050511 Bacteria 31175
608 nmdc:mga08y16_7813_c1 3300050511 Bacteria 11205
609 nmdc:mga08y16_82129_c1 3300050511 Bacteria 3360
610 nmdc:mga08y16_85811_c1 3300050511 Bacteria 3281
611 nmdc:mga0n895_122801_c1 3300050512 Bacteria 2619
612 nmdc:mga0n895_14205_c1 3300050512 Bacteria 7222
613 nmdc:mga0n895_170008_c1 3300050512 Bacteria 2212
614 nmdc:mga0n895_195196_c1 3300050512 Bacteria 2055
615 nmdc:mga0n895_213372_c1 3300050512 Bacteria 1960
616 nmdc:mga0n895_25344_c1 3300050512 Bacteria 5602
617 nmdc:mga0n895_263032_c1 3300050512 Bacteria 1751
618 nmdc:mga0n895_404371_c1 3300050512 Bacteria 1381
619 nmdc:mga0n895_4327_c1 3300050512 Bacteria 11642
620 nmdc:mga0n895_5058_c1 3300050512 Bacteria 10949
621 nmdc:mga0n895_57864_c1 3300050512 Bacteria 3822
622 nmdc:mga0n895_67581_c1 3300050512 Bacteria 3540
623 nmdc:mga0n895_75601_c1 3300050512 Bacteria 3348
624 nmdc:mga0n895_80542_c1 3300050512 Bacteria 3245
625 nmdc:mga0n895_9369_c1 3300050512 Bacteria 8563
626 nmdc:mga0n895_98_c1 3300050512 Bacteria 51629
627 nmdc:mga0rr50_119037_c1 3300050513 Bacteria 2099
628 nmdc:mga0rr50_1348_c1 3300050513 Bacteria 13404
629 nmdc:mga0rr50_221688_c1 3300050513 Bacteria 1562
630 nmdc:mga0rr50_232817_c1 3300050513 Bacteria 1525
631 nmdc:mga0rr50_250910_c1 3300050513 Bacteria 1470
632 nmdc:mga0rr50_34766_c1 3300050513 Bacteria 3612
633 nmdc:mga0rr50_39817_c1 3300050513 Bacteria 3412
634 nmdc:mga0rr50_43504_c1 3300050513 Bacteria 3287
635 nmdc:mga0rr50_47271_c1 3300050513 Bacteria 3173
636 nmdc:mga0rr50_5359_c1 3300050513 Bacteria 7643
637 nmdc:mga0rr50_55177_c1 3300050513 Bacteria 2964
638 nmdc:mga0rr50_554692_c1 3300050513 Bacteria 978
639 nmdc:mga0rr50_62267_c1 3300050513 Bacteria 2814
640 nmdc:mga0rr50_81748_c1 3300050513 Bacteria 2494
641 nmdc:mga08x19_111814_c1 3300050514 Bacteria 1823
642 nmdc:mga08x19_13944_c1 3300050514 Bacteria 4869
643 nmdc:mga08x19_190307_c1 3300050514 Bacteria 1404
644 nmdc:mga08x19_200010_c1 3300050514 Bacteria 1369
645 nmdc:mga08x19_2367_c1 3300050514 Bacteria 11427
646 nmdc:mga08x19_70143_c1 3300050514 Bacteria 2283
647 nmdc:mga08x19_991_c1 3300050514 Bacteria 17725
648 nmdc:mga0a205_1206_c1 3300050515 Bacteria 21636
649 nmdc:mga0a205_1282_c1 3300050515 Bacteria 21168
650 nmdc:mga0a205_133390_c1 3300050515 Bacteria 2384
651 nmdc:mga0a205_13659_c2 3300050515 Bacteria 7087
652 nmdc:mga0a205_13787_c1 3300050515 Bacteria 7536
653 nmdc:mga0a205_149348_c1 3300050515 Bacteria 2237
654 nmdc:mga0a205_154804_c1 3300050515 Bacteria 2191
655 nmdc:mga0a205_15597_c1 3300050515 Bacteria 7101
656 nmdc:mga0a205_18865_c1 3300050515 Bacteria 3942
657 nmdc:mga0a205_215802_c1 3300050515 Bacteria 1457
658 nmdc:mga0a205_241_c1 3300050515 Bacteria 38813
659 nmdc:mga0a205_302509_c1 3300050515 Bacteria 1472
660 nmdc:mga0a205_4320_c1 3300050515 Bacteria 12739
661 nmdc:mga0a205_6542_c1 3300050515 Bacteria 10539
662 nmdc:mga0a205_84594_c1 3300050515 Bacteria 3064
663 nmdc:mga0a205_8667_c1 3300050515 Bacteria 9258
664 nmdc:mga0a205_93818_c1 3300050515 Bacteria 2900
665 nmdc:mga0a205_959_c1 3300050515 Bacteria 23835
666 Ga0501084_0003152 3300054114 Bacteria 13336
667 Ga0501084_0022611 3300054114 Bacteria 5247
668 Ga0501084_0036569 3300054114 Bacteria 4101
669 Ga0501084_0130990 3300054114 Bacteria 2111
670 Ga0501082_0003056 3300060353 Bacteria 14607
671 Ga0501082_0039476 3300060353 Bacteria 4072
672 Ga0501082_0063900 3300060353 Bacteria 3169
673 Ga0501082_0118647 3300060353 Bacteria 2292
674 Ga0530510_0000625 3300061734 Bacteria 22816
675 Ga0530510_0017931 3300061734 Bacteria 5019
676 Ga0530510_0041106 3300061734 Bacteria 3338
677 Ga0530510_0054448 3300061734 Bacteria 2891
678 Ga0530510_0148141 3300061734 Bacteria 1732
679 Ga0530510_0168093 3300061734 Bacteria 1624
680 Ga0530510_0322419 3300061734 Bacteria 1158

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048917 Ga0496114_0429799 Ga0496114_0429799_41_691 214
2 3300049588 Ga0501072_0165475 Ga0501072_0165475_986_1747 231
3 3300005578 Ga0068854_100247048 Ga0068854_1002470482 232
4 3300009551 Ga0105238_10736371 Ga0105238_107363712 232
5 3300013105 Ga0157369_10175220 Ga0157369_101752202 232
6 3300026089 Ga0207648_10167626 Ga0207648_101676263 237
7 3300049572 Ga0501036_0309461 Ga0501036_0309461_287_1069 238
8 3300054114 Ga0501084_0130990 Ga0501084_0130990_443_1225 238
9 3300049589 Ga0501073_0169411 Ga0501073_0169411_16_741 239
10 3300006844 Ga0075428_100062929 Ga0075428_1000629295 241
11 3300006846 Ga0075430_100040096 Ga0075430_1000400963 241
12 3300006847 Ga0075431_100009915 Ga0075431_1000099156 241
13 3300009147 Ga0114129_10016004 Ga0114129_1001600410 241
14 3300039437 Ga0436365_0651255 Ga0436365_0651255_536_1267 241
15 3300039450 Ga0436363_1314268 Ga0436363_1314268_432_1163 241
16 3300047471 Ga0495684_0109414 Ga0495684_0109414_55_831 241
17 3300049577 Ga0501041_0329413 Ga0501041_0329413_65_799 241
18 3300050507 nmdc:mga05p37_54314_c1 nmdc:mga05p37_54314_c1_2250_3032 241
19 3300050508 nmdc:mga09592_162342_c1 nmdc:mga09592_162342_c1_24_806 241
20 3300050509 nmdc:mga0qj67_29253_c1 nmdc:mga0qj67_29253_c1_1316_2098 241
21 3300050510 nmdc:mga06r32_35833_c1 nmdc:mga06r32_35833_c1_2313_3095 241
22 3300050510 nmdc:mga06r32_175315_c1 nmdc:mga06r32_175315_c1_713_1507 242
23 3300050507 nmdc:mga05p37_89499_c1 nmdc:mga05p37_89499_c1_351_1088 243
24 3300005441 Ga0070700_100235499 Ga0070700_1002354992 244
25 3300005937 Ga0081455_10000042 Ga0081455_1000004263 244
26 3300005983 Ga0081540_1000024 Ga0081540_100002465 244
27 3300006163 Ga0070715_10020458 Ga0070715_100204582 244
28 3300009094 Ga0111539_10257782 Ga0111539_102577822 244
29 3300025905 Ga0207685_10012226 Ga0207685_100122263 244
30 3300032004 Ga0307414_10193405 Ga0307414_101934052 245
31 3300005471 Ga0070698_100201844 Ga0070698_1002018442 247
32 3300005842 Ga0068858_100503895 Ga0068858_1005038951 247
33 3300044673 Ga0453683_0059181 Ga0453683_0059181_1348_2145 247
34 3300026116 Ga0207674_10705349 Ga0207674_107053492 248
35 3300034820 Ga0373959_0003986 Ga0373959_0003986_417_1166 249
36 iso_pu_bacteria 2881644220 2881645381 249
37 3300006844 Ga0075428_100135896 Ga0075428_1001358962 250
38 3300006852 Ga0075433_10084395 Ga0075433_100843953 250
39 3300007076 Ga0075435_100082224 Ga0075435_1000822243 250
40 3300009147 Ga0114129_10193943 Ga0114129_101939433 250
41 3300009147 Ga0114129_10772312 Ga0114129_107723122 250
42 3300009147 Ga0114129_10796654 Ga0114129_107966542 250
43 3300027907 Ga0207428_10050329 Ga0207428_100503294 250
44 3300046691 Ga0495670_0086831 Ga0495670_0086831_359_1120 250
45 3300047318 Ga0495636_0071228 Ga0495636_0071228_701_1462 250
46 3300049592 Ga0501076_0374379 Ga0501076_0374379_128_910 250
47 3300050507 nmdc:mga05p37_143040_c1 nmdc:mga05p37_143040_c1_1261_2022 250
48 3300050508 nmdc:mga09592_50961_c1 nmdc:mga09592_50961_c1_1960_2721 250
49 3300050511 nmdc:mga08y16_302395_c1 nmdc:mga08y16_302395_c1_620_1381 250
50 3300050512 nmdc:mga0n895_170008_c1 nmdc:mga0n895_170008_c1_253_1014 250
51 3300050512 nmdc:mga0n895_213372_c1 nmdc:mga0n895_213372_c1_1097_1858 250
52 3300050512 nmdc:mga0n895_404371_c1 nmdc:mga0n895_404371_c1_253_1014 250
53 3300050513 nmdc:mga0rr50_39817_c1 nmdc:mga0rr50_39817_c1_1352_2113 250
54 3300050515 nmdc:mga0a205_154804_c1 nmdc:mga0a205_154804_c1_1192_1953 250
55 3300050515 nmdc:mga0a205_93818_c1 nmdc:mga0a205_93818_c1_1411_2172 250
56 3300061734 Ga0530510_0322419 Ga0530510_0322419_65_847 250
57 iso_pu_bacteria 2738541299 2738839642 250
58 iso_pu_bacteria 2928510474 2928510554 250
59 iso_pu_bacteria 2990275345 2990276347 250
60 iso_pu_bacteria 8057632132 8057633602 250
61 3300027671 Ga0209588_1045719 Ga0209588_10457192 251
62 3300048920 Ga0496117_0273377 Ga0496117_0273377_64_831 251
63 3300005336 Ga0070680_100285915 Ga0070680_1002859151 252
64 3300005353 Ga0070669_100227063 Ga0070669_1002270631 252
65 3300005440 Ga0070705_100002695 Ga0070705_1000026954 252
66 3300005467 Ga0070706_100713894 Ga0070706_1007138942 252
67 3300005471 Ga0070698_100366210 Ga0070698_1003662101 252
68 3300005549 Ga0070704_100065389 Ga0070704_1000653892 252
69 3300005719 Ga0068861_100661408 Ga0068861_1006614082 252
70 3300006847 Ga0075431_100052073 Ga0075431_1000520734 252
71 3300006847 Ga0075431_100084722 Ga0075431_1000847223 252
72 3300006847 Ga0075431_100251500 Ga0075431_1002515002 252
73 3300006852 Ga0075433_10000340 Ga0075433_100003401 252
74 3300006852 Ga0075433_10489621 Ga0075433_104896211 252
75 3300006871 Ga0075434_100000039 Ga0075434_10000003954 252
76 3300006871 Ga0075434_100190457 Ga0075434_1001904571 252
77 3300006871 Ga0075434_100231929 Ga0075434_1002319293 252
78 3300007076 Ga0075435_100013131 Ga0075435_1000131314 252
79 3300007076 Ga0075435_100080814 Ga0075435_1000808141 252
80 3300007076 Ga0075435_100125147 Ga0075435_1001251471 252
81 3300007076 Ga0075435_100154223 Ga0075435_1001542231 252
82 3300009094 Ga0111539_10000304 Ga0111539_1000030420 252
83 3300009147 Ga0114129_10026673 Ga0114129_100266732 252
84 3300009147 Ga0114129_11302335 Ga0114129_113023351 252
85 3300013297 Ga0157378_10167010 Ga0157378_101670102 252
86 3300014326 Ga0157380_10220005 Ga0157380_102200052 252
87 3300025899 Ga0207642_10091834 Ga0207642_100918341 252
88 3300025910 Ga0207684_10012547 Ga0207684_100125474 252
89 3300025917 Ga0207660_10295340 Ga0207660_102953401 252
90 3300025922 Ga0207646_10444218 Ga0207646_104442181 252
91 3300025942 Ga0207689_10145104 Ga0207689_101451043 252
92 3300027907 Ga0207428_10000009 Ga0207428_10000009296 252
93 3300035112 Ga0373932_0081390 Ga0373932_0081390_46_813 252
94 3300035114 Ga0373939_0068609 Ga0373939_0068609_56_823 252
95 3300045051 Ga0451576_0082572 Ga0451576_0082572_134_901 252
96 3300045051 Ga0451576_0141100 Ga0451576_0141100_232_999 252
97 3300046472 Ga0495580_0001497 Ga0495580_0001497_17430_18197 252
98 3300049741 Ga0501079_0059406 Ga0501079_0059406_23_784 252
99 3300050507 nmdc:mga05p37_4531_c1 nmdc:mga05p37_4531_c1_4322_5089 252
100 3300050508 nmdc:mga09592_25027_c1 nmdc:mga09592_25027_c1_3858_4625 252
101 3300050508 nmdc:mga09592_9005_c1 nmdc:mga09592_9005_c1_5916_6683 252
102 3300050509 nmdc:mga0qj67_2519_c1 nmdc:mga0qj67_2519_c1_4980_5747 252
103 3300050510 nmdc:mga06r32_142078_c1 nmdc:mga06r32_142078_c1_1050_1817 252
104 3300050510 nmdc:mga06r32_29605_c1 nmdc:mga06r32_29605_c1_2843_3610 252
105 3300050510 nmdc:mga06r32_91341_c1 nmdc:mga06r32_91341_c1_1424_2191 252
106 3300050511 nmdc:mga08y16_18006_c1 nmdc:mga08y16_18006_c1_4235_5002 252
107 3300050512 nmdc:mga0n895_122801_c1 nmdc:mga0n895_122801_c1_919_1686 252
108 3300050512 nmdc:mga0n895_25344_c1 nmdc:mga0n895_25344_c1_4669_5436 252
109 3300050513 nmdc:mga0rr50_47271_c1 nmdc:mga0rr50_47271_c1_1389_2156 252
110 3300050513 nmdc:mga0rr50_62267_c1 nmdc:mga0rr50_62267_c1_1348_2115 252
111 3300050513 nmdc:mga0rr50_81748_c1 nmdc:mga0rr50_81748_c1_144_911 252
112 3300050515 nmdc:mga0a205_241_c1 nmdc:mga0a205_241_c1_10582_11349 252
113 3300050515 nmdc:mga0a205_8667_c1 nmdc:mga0a205_8667_c1_1700_2467 252
114 3300013102 Ga0157371_10013604 Ga0157371_100136043 254
115 3300037471 Ga0395905_0094425 Ga0395905_0094425_55_831 255
116 3300005518 Ga0070699_100023293 Ga0070699_1000232932 256
117 3300025933 Ga0207706_10529873 Ga0207706_105298732 256
118 3300005549 Ga0070704_100154623 Ga0070704_1001546231 257
119 3300006844 Ga0075428_100775138 Ga0075428_1007751382 257
120 3300006846 Ga0075430_100072256 Ga0075430_1000722565 257
121 3300006847 Ga0075431_100000480 Ga0075431_10000048010 257
122 3300006880 Ga0075429_100002766 Ga0075429_10000276612 257
123 3300007265 Ga0099794_10010736 Ga0099794_100107364 257
124 3300009147 Ga0114129_10006269 Ga0114129_1000626913 257
125 3300009147 Ga0114129_10313978 Ga0114129_103139782 257
126 3300009147 Ga0114129_10550387 Ga0114129_105503872 257
127 3300027671 Ga0209588_1076535 Ga0209588_10765352 257
128 3300031548 Ga0307408_100020563 Ga0307408_1000205632 257
129 3300031852 Ga0307410_10018441 Ga0307410_100184412 257
130 3300031995 Ga0307409_100132199 Ga0307409_1001321992 257
131 3300032002 Ga0307416_100184818 Ga0307416_1001848182 257
132 3300032002 Ga0307416_100548934 Ga0307416_1005489342 257
133 3300037418 Ga0395900_0442911 Ga0395900_0442911_369_1151 257
134 3300038996 Ga0242420_008318 Ga0242420_008318_334_1116 257
135 3300044673 Ga0453683_0000412 Ga0453683_0000412_40968_41747 257
136 3300046472 Ga0495580_0000190 Ga0495580_0000190_27547_28329 257
137 3300046537 Ga0495598_0043509 Ga0495598_0043509_474_1256 257
138 3300049572 Ga0501036_0322324 Ga0501036_0322324_213_995 257
139 3300049575 Ga0501039_0023127 Ga0501039_0023127_1783_2565 257
140 3300049576 Ga0501040_0034025 Ga0501040_0034025_2222_3004 257
141 3300049584 Ga0501068_0017568 Ga0501068_0017568_855_1637 257
142 3300049584 Ga0501068_0113961 Ga0501068_0113961_131_913 257
143 3300049587 Ga0501071_0104664 Ga0501071_0104664_1193_1975 257
144 3300049587 Ga0501071_0118019 Ga0501071_0118019_404_1186 257
145 3300049588 Ga0501072_0024749 Ga0501072_0024749_2703_3485 257
146 3300049590 Ga0501074_0030926 Ga0501074_0030926_933_1715 257
147 3300049590 Ga0501074_0094086 Ga0501074_0094086_216_998 257
148 3300049591 Ga0501075_0001883 Ga0501075_0001883_10453_11235 257
149 3300049591 Ga0501075_0013652 Ga0501075_0013652_1831_2613 257
150 3300049591 Ga0501075_0013875 Ga0501075_0013875_2194_2976 257
151 3300049592 Ga0501076_0051530 Ga0501076_0051530_2201_2983 257
152 3300049593 Ga0501077_0019213 Ga0501077_0019213_1375_2157 257
153 3300049741 Ga0501079_0002057 Ga0501079_0002057_762_1544 257
154 3300049742 Ga0501080_0279220 Ga0501080_0279220_632_1414 257
155 3300049743 Ga0501081_0004585 Ga0501081_0004585_2185_2967 257
156 3300049743 Ga0501081_0151289 Ga0501081_0151289_473_1255 257
157 3300049824 Ga0501045_0038621 Ga0501045_0038621_1653_2435 257
158 3300050507 nmdc:mga05p37_30382_c1 nmdc:mga05p37_30382_c1_5456_6238 257
159 3300050507 nmdc:mga05p37_333712_c1 nmdc:mga05p37_333712_c1_936_1715 257
160 3300050507 nmdc:mga05p37_54527_c1 nmdc:mga05p37_54527_c1_1595_2377 257
161 3300050508 nmdc:mga09592_749_c1 nmdc:mga09592_749_c1_11470_12252 257
162 3300050509 nmdc:mga0qj67_15692_c1 nmdc:mga0qj67_15692_c1_4706_5488 257
163 3300050510 nmdc:mga06r32_2871_c1 nmdc:mga06r32_2871_c1_12221_13003 257
164 3300050510 nmdc:mga06r32_313641_c1 nmdc:mga06r32_313641_c1_107_886 257
165 3300050515 nmdc:mga0a205_149348_c1 nmdc:mga0a205_149348_c1_1174_1956 257
166 3300054114 Ga0501084_0036569 Ga0501084_0036569_697_1479 257
167 3300061734 Ga0530510_0054448 Ga0530510_0054448_628_1410 257
168 3300005440 Ga0070705_100053588 Ga0070705_1000535882 258
169 3300005445 Ga0070708_100000456 Ga0070708_10000045612 258
170 3300005457 Ga0070662_100158271 Ga0070662_1001582712 258
171 3300005467 Ga0070706_100007217 Ga0070706_1000072178 258
172 3300005468 Ga0070707_100000758 Ga0070707_10000075812 258
173 3300005471 Ga0070698_100002218 Ga0070698_10000221812 258
174 3300005518 Ga0070699_100000498 Ga0070699_10000049817 258
175 3300005536 Ga0070697_100001129 Ga0070697_10000112917 258
176 3300005536 Ga0070697_100331227 Ga0070697_1003312272 258
177 3300005543 Ga0070672_100006940 Ga0070672_1000069402 258
178 3300005547 Ga0070693_100068201 Ga0070693_1000682012 258
179 3300005985 Ga0081539_10001809 Ga0081539_1000180949 258
180 3300006844 Ga0075428_100005773 Ga0075428_10000577311 258
181 3300006844 Ga0075428_100011091 Ga0075428_1000110913 258
182 3300006844 Ga0075428_100397114 Ga0075428_1003971142 258
183 3300006847 Ga0075431_100000280 Ga0075431_10000028016 258
184 3300006852 Ga0075433_10000147 Ga0075433_1000014714 258
185 3300006852 Ga0075433_10015815 Ga0075433_100158153 258
186 3300006852 Ga0075433_10052072 Ga0075433_100520722 258
187 3300006852 Ga0075433_10102890 Ga0075433_101028902 258
188 3300006871 Ga0075434_100015392 Ga0075434_1000153926 258
189 3300006871 Ga0075434_100023007 Ga0075434_1000230072 258
190 3300006871 Ga0075434_100042940 Ga0075434_1000429403 258
191 3300006871 Ga0075434_100186438 Ga0075434_1001864382 258
192 3300006880 Ga0075429_100039909 Ga0075429_1000399091 258
193 3300006880 Ga0075429_100060368 Ga0075429_1000603685 258
194 3300006914 Ga0075436_100000316 Ga0075436_10000031611 258
195 3300006914 Ga0075436_100007152 Ga0075436_1000071522 258
196 3300007076 Ga0075435_100106131 Ga0075435_1001061312 258
197 3300009094 Ga0111539_10004936 Ga0111539_1000493612 258
198 3300009147 Ga0114129_10000331 Ga0114129_1000033134 258
199 3300009147 Ga0114129_10001127 Ga0114129_1000112714 258
200 3300009147 Ga0114129_10001268 Ga0114129_1000126823 258
201 3300009147 Ga0114129_10041662 Ga0114129_100416622 258
202 3300009147 Ga0114129_10593604 Ga0114129_105936042 258
203 3300009174 Ga0105241_10009815 Ga0105241_100098154 258
204 3300009553 Ga0105249_10802852 Ga0105249_108028522 258
205 3300013306 Ga0163162_10239614 Ga0163162_102396143 258
206 3300013308 Ga0157375_10089666 Ga0157375_100896663 258
207 3300014326 Ga0157380_10396717 Ga0157380_103967172 258
208 3300025910 Ga0207684_10000456 Ga0207684_1000045649 258
209 3300025922 Ga0207646_10000483 Ga0207646_100004838 258
210 3300025923 Ga0207681_10142327 Ga0207681_101423272 258
211 3300025933 Ga0207706_10150271 Ga0207706_101502712 258
212 3300025938 Ga0207704_10261152 Ga0207704_102611522 258
213 3300025940 Ga0207691_10021739 Ga0207691_100217392 258
214 3300025972 Ga0207668_10144076 Ga0207668_101440762 258
215 3300026089 Ga0207648_10227762 Ga0207648_102277622 258
216 3300027907 Ga0207428_10020675 Ga0207428_100206751 258
217 3300028381 Ga0268264_10078097 Ga0268264_100780972 258
218 3300037312 Ga0395899_0041080 Ga0395899_0041080_547_1335 258
219 3300037418 Ga0395900_0040407 Ga0395900_0040407_2765_3553 258
220 3300037466 Ga0395898_0008002 Ga0395898_0008002_2866_3654 258
221 3300037471 Ga0395905_0096025 Ga0395905_0096025_908_1696 258
222 3300038443 Ga0395901_0003953 Ga0395901_0003953_4008_4796 258
223 3300046528 Ga0495642_0008677 Ga0495642_0008677_1547_2335 258
224 3300046684 Ga0495669_0002437 Ga0495669_0002437_2187_2975 258
225 3300048915 Ga0496112_0063673 Ga0496112_0063673_1715_2503 258
226 3300048917 Ga0496114_0090153 Ga0496114_0090153_1376_2164 258
227 3300048917 Ga0496114_0545316 Ga0496114_0545316_157_945 258
228 3300050507 nmdc:mga05p37_245723_c1 nmdc:mga05p37_245723_c1_1174_1962 258
229 3300050507 nmdc:mga05p37_340_c1 nmdc:mga05p37_340_c1_31676_32461 258
230 3300050507 nmdc:mga05p37_578638_c1 nmdc:mga05p37_578638_c1_119_904 258
231 3300050508 nmdc:mga09592_810_c1 nmdc:mga09592_810_c1_4168_4953 258
232 3300050510 nmdc:mga06r32_4899_c1 nmdc:mga06r32_4899_c1_3095_3880 258
233 3300050510 nmdc:mga06r32_527222_c1 nmdc:mga06r32_527222_c1_289_1077 258
234 3300050511 nmdc:mga08y16_7813_c1 nmdc:mga08y16_7813_c1_4460_5248 258
235 3300050512 nmdc:mga0n895_195196_c1 nmdc:mga0n895_195196_c1_375_1163 258
236 3300050512 nmdc:mga0n895_9369_c1 nmdc:mga0n895_9369_c1_2953_3738 258
237 3300050512 nmdc:mga0n895_98_c1 nmdc:mga0n895_98_c1_28912_29697 258
238 3300050513 nmdc:mga0rr50_1348_c1 nmdc:mga0rr50_1348_c1_2983_3768 258
239 3300050513 nmdc:mga0rr50_554692_c1 nmdc:mga0rr50_554692_c1_108_893 258
240 3300050514 nmdc:mga08x19_13944_c1 nmdc:mga08x19_13944_c1_1164_1949 258
241 3300050514 nmdc:mga08x19_991_c1 nmdc:mga08x19_991_c1_9367_10152 258
242 3300050515 nmdc:mga0a205_1206_c1 nmdc:mga0a205_1206_c1_9998_10783 258
243 3300050515 nmdc:mga0a205_13659_c2 nmdc:mga0a205_13659_c2_4973_5761 258
244 3300050515 nmdc:mga0a205_6542_c1 nmdc:mga0a205_6542_c1_9086_9871 258
245 3300050515 nmdc:mga0a205_84594_c1 nmdc:mga0a205_84594_c1_1055_1840 258
246 3300005336 Ga0070680_100024956 Ga0070680_1000249563 259
247 3300005340 Ga0070689_100080147 Ga0070689_1000801472 259
248 3300005467 Ga0070706_100099375 Ga0070706_1000993752 259
249 3300005467 Ga0070706_100308252 Ga0070706_1003082522 259
250 3300005468 Ga0070707_100243682 Ga0070707_1002436822 259
251 3300005518 Ga0070699_100428126 Ga0070699_1004281262 259
252 3300005536 Ga0070697_100523804 Ga0070697_1005238041 259
253 3300005545 Ga0070695_100280136 Ga0070695_1002801362 259
254 3300005546 Ga0070696_100080594 Ga0070696_1000805942 259
255 3300005549 Ga0070704_100098284 Ga0070704_1000982842 259
256 3300006844 Ga0075428_100004435 Ga0075428_10000443512 259
257 3300006844 Ga0075428_100230494 Ga0075428_1002304943 259
258 3300006846 Ga0075430_100000473 Ga0075430_10000047330 259
259 3300006847 Ga0075431_100006625 Ga0075431_1000066256 259
260 3300006880 Ga0075429_100000042 Ga0075429_1000000426 259
261 3300007076 Ga0075435_100090970 Ga0075435_1000909702 259
262 3300009147 Ga0114129_10008504 Ga0114129_100085046 259
263 3300025910 Ga0207684_10009571 Ga0207684_100095717 259
264 3300025910 Ga0207684_10411557 Ga0207684_104115571 259
265 3300025922 Ga0207646_10042198 Ga0207646_100421982 259
266 3300025922 Ga0207646_10125642 Ga0207646_101256422 259
267 3300025936 Ga0207670_10140682 Ga0207670_101406822 259
268 3300031548 Ga0307408_100075983 Ga0307408_1000759832 259
269 3300035207 Ga0373942_0020763 Ga0373942_0020763_589_1380 259
270 3300042876 Ga0451577_0487566 Ga0451577_0487566_219_1010 259
271 3300044712 Ga0453684_0582413 Ga0453684_0582413_89_880 259
272 3300048905 Ga0496102_0055268 Ga0496102_0055268_2058_2849 259
273 3300048906 Ga0496103_0171725 Ga0496103_0171725_315_1106 259
274 3300048909 Ga0496106_0047076 Ga0496106_0047076_1610_2401 259
275 3300049572 Ga0501036_0392474 Ga0501036_0392474_315_1106 259
276 3300049576 Ga0501040_0023593 Ga0501040_0023593_3252_4037 259
277 3300049578 Ga0501042_0512684 Ga0501042_0512684_46_840 259
278 3300049588 Ga0501072_0047183 Ga0501072_0047183_1820_2614 259
279 3300049591 Ga0501075_0175199 Ga0501075_0175199_534_1325 259
280 3300049743 Ga0501081_0361177 Ga0501081_0361177_93_878 259
281 3300049824 Ga0501045_0089283 Ga0501045_0089283_722_1516 259
282 3300049824 Ga0501045_0206149 Ga0501045_0206149_92_883 259
283 3300050507 nmdc:mga05p37_25926_c1 nmdc:mga05p37_25926_c1_3106_3897 259
284 3300050508 nmdc:mga09592_2666_c1 nmdc:mga09592_2666_c1_7660_8451 259
285 3300050509 nmdc:mga0qj67_586_c1 nmdc:mga0qj67_586_c1_3088_3879 259
286 3300050510 nmdc:mga06r32_39673_c1 nmdc:mga06r32_39673_c1_1793_2584 259
287 3300050515 nmdc:mga0a205_302509_c1 nmdc:mga0a205_302509_c1_535_1320 259
288 3300060353 Ga0501082_0118647 Ga0501082_0118647_136_930 259
289 3300061734 Ga0530510_0148141 Ga0530510_0148141_764_1555 259
290 3300061734 Ga0530510_0168093 Ga0530510_0168093_812_1606 259
291 3300005295 Ga0065707_10009170 Ga0065707_100091703 260
292 3300005353 Ga0070669_100077215 Ga0070669_1000772153 260
293 3300005457 Ga0070662_100093695 Ga0070662_1000936952 260
294 3300005468 Ga0070707_100501525 Ga0070707_1005015252 260
295 3300005518 Ga0070699_100229278 Ga0070699_1002292782 260
296 3300005536 Ga0070697_100008100 Ga0070697_1000081003 260
297 3300005536 Ga0070697_100008725 Ga0070697_1000087257 260
298 3300005543 Ga0070672_100383599 Ga0070672_1003835992 260
299 3300005545 Ga0070695_100208577 Ga0070695_1002085772 260
300 3300005844 Ga0068862_100197200 Ga0068862_1001972003 260
301 3300006058 Ga0075432_10050156 Ga0075432_100501562 260
302 3300006844 Ga0075428_100091205 Ga0075428_1000912053 260
303 3300006844 Ga0075428_100119457 Ga0075428_1001194572 260
304 3300006846 Ga0075430_100003267 Ga0075430_10000326713 260
305 3300006846 Ga0075430_100059903 Ga0075430_1000599031 260
306 3300006847 Ga0075431_100002035 Ga0075431_1000020356 260
307 3300006847 Ga0075431_100086676 Ga0075431_1000866763 260
308 3300006847 Ga0075431_100312272 Ga0075431_1003122722 260
309 3300006852 Ga0075433_10000094 Ga0075433_1000009426 260
310 3300006852 Ga0075433_10014443 Ga0075433_100144436 260
311 3300006852 Ga0075433_10018839 Ga0075433_100188395 260
312 3300006852 Ga0075433_10058139 Ga0075433_100581393 260
313 3300006852 Ga0075433_10068561 Ga0075433_100685612 260
314 3300006852 Ga0075433_10503734 Ga0075433_105037342 260
315 3300006871 Ga0075434_100000207 Ga0075434_10000020728 260
316 3300006871 Ga0075434_100003606 Ga0075434_1000036064 260
317 3300006871 Ga0075434_100025372 Ga0075434_1000253726 260
318 3300006871 Ga0075434_100062936 Ga0075434_1000629362 260
319 3300006871 Ga0075434_100244576 Ga0075434_1002445762 260
320 3300006880 Ga0075429_100001320 Ga0075429_10000132018 260
321 3300006880 Ga0075429_100029357 Ga0075429_1000293572 260
322 3300006880 Ga0075429_100201750 Ga0075429_1002017502 260
323 3300007076 Ga0075435_100009114 Ga0075435_1000091143 260
324 3300007076 Ga0075435_100022457 Ga0075435_1000224572 260
325 3300007076 Ga0075435_100066101 Ga0075435_1000661014 260
326 3300007076 Ga0075435_100098072 Ga0075435_1000980722 260
327 3300007076 Ga0075435_100289853 Ga0075435_1002898532 260
328 3300007265 Ga0099794_10017071 Ga0099794_100170713 260
329 3300009094 Ga0111539_10002279 Ga0111539_1000227918 260
330 3300009094 Ga0111539_10007623 Ga0111539_1000762310 260
331 3300009094 Ga0111539_10046000 Ga0111539_100460002 260
332 3300009094 Ga0111539_10165002 Ga0111539_101650023 260
333 3300009147 Ga0114129_10000431 Ga0114129_1000043123 260
334 3300009147 Ga0114129_10002159 Ga0114129_1000215925 260
335 3300009147 Ga0114129_10011558 Ga0114129_100115589 260
336 3300009147 Ga0114129_10314835 Ga0114129_103148351 260
337 3300009147 Ga0114129_10330851 Ga0114129_103308512 260
338 3300009147 Ga0114129_10351971 Ga0114129_103519713 260
339 3300009147 Ga0114129_10681618 Ga0114129_106816182 260
340 3300009553 Ga0105249_10156887 Ga0105249_101568871 260
341 3300014326 Ga0157380_10132769 Ga0157380_101327692 260
342 3300025910 Ga0207684_10085635 Ga0207684_100856353 260
343 3300025923 Ga0207681_10181702 Ga0207681_101817022 260
344 3300025940 Ga0207691_10378295 Ga0207691_103782951 260
345 3300027907 Ga0207428_10000095 Ga0207428_1000009564 260
346 3300027907 Ga0207428_10001314 Ga0207428_100013149 260
347 3300027907 Ga0207428_10064345 Ga0207428_100643452 260
348 3300035090 Ga0373949_0051052 Ga0373949_0051052_95_886 260
349 3300035115 Ga0373941_0046991 Ga0373941_0046991_271_1062 260
350 3300035691 Ga0373931_0028858 Ga0373931_0028858_1364_2155 260
351 3300042876 Ga0451577_0034285 Ga0451577_0034285_1000_1791 260
352 3300042876 Ga0451577_0147421 Ga0451577_0147421_755_1546 260
353 3300044673 Ga0453683_0022929 Ga0453683_0022929_2955_3746 260
354 3300044712 Ga0453684_0044386 Ga0453684_0044386_3372_4163 260
355 3300045051 Ga0451576_0099125 Ga0451576_0099125_678_1469 260
356 3300045051 Ga0451576_0187376 Ga0451576_0187376_316_1107 260
357 3300046472 Ga0495580_0000020 Ga0495580_0000020_37642_38433 260
358 3300046528 Ga0495642_0076073 Ga0495642_0076073_594_1385 260
359 3300046664 Ga0495659_0112923 Ga0495659_0112923_248_1039 260
360 3300050507 nmdc:mga05p37_1053_c1 nmdc:mga05p37_1053_c1_10506_11306 260
361 3300050507 nmdc:mga05p37_11660_c1 nmdc:mga05p37_11660_c1_8999_9790 260
362 3300050507 nmdc:mga05p37_144482_c1 nmdc:mga05p37_144482_c1_2025_2813 260
363 3300050507 nmdc:mga05p37_244960_c1 nmdc:mga05p37_244960_c1_365_1159 260
364 3300050507 nmdc:mga05p37_255349_c1 nmdc:mga05p37_255349_c1_735_1523 260
365 3300050507 nmdc:mga05p37_347854_c1 nmdc:mga05p37_347854_c1_820_1614 260
366 3300050507 nmdc:mga05p37_690594_c1 nmdc:mga05p37_690594_c1_140_934 260
367 3300050507 nmdc:mga05p37_74151_c1 nmdc:mga05p37_74151_c1_629_1420 260
368 3300050508 nmdc:mga09592_176508_c1 nmdc:mga09592_176508_c1_911_1699 260
369 3300050508 nmdc:mga09592_3851_c1 nmdc:mga09592_3851_c1_5359_6159 260
370 3300050508 nmdc:mga09592_8986_c1 nmdc:mga09592_8986_c1_4922_5713 260
371 3300050510 nmdc:mga06r32_40504_c1 nmdc:mga06r32_40504_c1_1596_2390 260
372 3300050510 nmdc:mga06r32_52292_c1 nmdc:mga06r32_52292_c1_3002_3793 260
373 3300050510 nmdc:mga06r32_892_c1 nmdc:mga06r32_892_c1_5671_6471 260
374 3300050511 nmdc:mga08y16_20783_c1 nmdc:mga08y16_20783_c1_2538_3329 260
375 3300050511 nmdc:mga08y16_731_c1 nmdc:mga08y16_731_c1_4261_5052 260
376 3300050511 nmdc:mga08y16_82129_c1 nmdc:mga08y16_82129_c1_1820_2608 260
377 3300050511 nmdc:mga08y16_85811_c1 nmdc:mga08y16_85811_c1_1811_2602 260
378 3300050512 nmdc:mga0n895_14205_c1 nmdc:mga0n895_14205_c1_4657_5451 260
379 3300050512 nmdc:mga0n895_263032_c1 nmdc:mga0n895_263032_c1_268_1056 260
380 3300050512 nmdc:mga0n895_5058_c1 nmdc:mga0n895_5058_c1_7660_8451 260
381 3300050512 nmdc:mga0n895_67581_c1 nmdc:mga0n895_67581_c1_2304_3095 260
382 3300050512 nmdc:mga0n895_80542_c1 nmdc:mga0n895_80542_c1_575_1366 260
383 3300050513 nmdc:mga0rr50_119037_c1 nmdc:mga0rr50_119037_c1_997_1791 260
384 3300050513 nmdc:mga0rr50_221688_c1 nmdc:mga0rr50_221688_c1_596_1387 260
385 3300050513 nmdc:mga0rr50_232817_c1 nmdc:mga0rr50_232817_c1_633_1424 260
386 3300050513 nmdc:mga0rr50_34766_c1 nmdc:mga0rr50_34766_c1_2773_3564 260
387 3300050513 nmdc:mga0rr50_43504_c1 nmdc:mga0rr50_43504_c1_1143_1934 260
388 3300050513 nmdc:mga0rr50_55177_c1 nmdc:mga0rr50_55177_c1_1958_2746 260
389 3300050514 nmdc:mga08x19_190307_c1 nmdc:mga08x19_190307_c1_511_1299 260
390 3300050514 nmdc:mga08x19_200010_c1 nmdc:mga08x19_200010_c1_222_1013 260
391 3300050515 nmdc:mga0a205_133390_c1 nmdc:mga0a205_133390_c1_1520_2311 260
392 3300050515 nmdc:mga0a205_15597_c1 nmdc:mga0a205_15597_c1_4129_4920 260
393 3300050515 nmdc:mga0a205_18865_c1 nmdc:mga0a205_18865_c1_883_1674 260
394 3300050515 nmdc:mga0a205_215802_c1 nmdc:mga0a205_215802_c1_215_1003 260
395 3300050515 nmdc:mga0a205_4320_c1 nmdc:mga0a205_4320_c1_9717_10508 260
396 3300050515 nmdc:mga0a205_959_c1 nmdc:mga0a205_959_c1_3832_4623 260
397 3300005336 Ga0070680_100374962 Ga0070680_1003749621 261
398 3300005981 Ga0081538_10002059 Ga0081538_1000205913 261
399 3300006847 Ga0075431_100000162 Ga0075431_10000016236 261
400 3300049574 Ga0501038_0241369 Ga0501038_0241369_83_880 261
401 3300049576 Ga0501040_0089699 Ga0501040_0089699_11_808 261
402 3300049577 Ga0501041_0008758 Ga0501041_0008758_1763_2560 261
403 3300049579 Ga0501043_0062008 Ga0501043_0062008_1748_2533 261
404 3300049584 Ga0501068_0300575 Ga0501068_0300575_152_949 261
405 3300049593 Ga0501077_0003322 Ga0501077_0003322_7973_8770 261
406 3300049593 Ga0501077_0129265 Ga0501077_0129265_296_1093 261
407 3300049741 Ga0501079_0015545 Ga0501079_0015545_1780_2577 261
408 3300049743 Ga0501081_0015789 Ga0501081_0015789_219_1016 261
409 3300049744 Ga0501083_0148805 Ga0501083_0148805_277_1074 261
410 3300049824 Ga0501045_0045736 Ga0501045_0045736_1315_2112 261
411 3300050510 nmdc:mga06r32_208_c1 nmdc:mga06r32_208_c1_29963_30757 261
412 3300060353 Ga0501082_0063900 Ga0501082_0063900_219_1016 261
413 3300061734 Ga0530510_0000625 Ga0530510_0000625_11186_11983 261
414 3300061734 Ga0530510_0017931 Ga0530510_0017931_4205_5002 261
415 3300005439 Ga0070711_100019200 Ga0070711_1000192004 262
416 3300005445 Ga0070708_100046888 Ga0070708_1000468882 262
417 3300005445 Ga0070708_100369811 Ga0070708_1003698112 262
418 3300005467 Ga0070706_100234221 Ga0070706_1002342212 262
419 3300005471 Ga0070698_100266376 Ga0070698_1002663762 262
420 3300005518 Ga0070699_100005500 Ga0070699_1000055002 262
421 3300005536 Ga0070697_100576563 Ga0070697_1005765631 262
422 3300005549 Ga0070704_100434745 Ga0070704_1004347452 262
423 3300005841 Ga0068863_100019061 Ga0068863_1000190614 262
424 3300005842 Ga0068858_100157666 Ga0068858_1001576662 262
425 3300006163 Ga0070715_10046461 Ga0070715_100464612 262
426 3300006175 Ga0070712_100015268 Ga0070712_1000152683 262
427 3300006871 Ga0075434_100026328 Ga0075434_1000263284 262
428 3300007076 Ga0075435_100001253 Ga0075435_1000012532 262
429 3300009147 Ga0114129_10413710 Ga0114129_104137102 262
430 3300009177 Ga0105248_10331233 Ga0105248_103312332 262
431 3300025905 Ga0207685_10082856 Ga0207685_100828561 262
432 3300025910 Ga0207684_10048072 Ga0207684_100480723 262
433 3300025910 Ga0207684_10151008 Ga0207684_101510082 262
434 3300025915 Ga0207693_10028454 Ga0207693_100284542 262
435 3300025922 Ga0207646_10114468 Ga0207646_101144682 262
436 3300025922 Ga0207646_10164421 Ga0207646_101644211 262
437 3300025941 Ga0207711_10504863 Ga0207711_105048632 262
438 3300026088 Ga0207641_10109696 Ga0207641_101096962 262
439 3300038996 Ga0242420_020054 Ga0242420_020054_47_844 262
440 3300042876 Ga0451577_0402199 Ga0451577_0402199_151_954 262
441 3300042993 Ga0439440_0068592 Ga0439440_0068592_63_857 262
442 3300045051 Ga0451576_0446621 Ga0451576_0446621_477_1271 262
443 3300050507 nmdc:mga05p37_463226_c1 nmdc:mga05p37_463226_c1_197_994 262
444 3300005295 Ga0065707_10131770 Ga0065707_101317702 263
445 3300005438 Ga0070701_10028578 Ga0070701_100285782 263
446 3300005440 Ga0070705_100041715 Ga0070705_1000417153 263
447 3300005518 Ga0070699_100218108 Ga0070699_1002181082 263
448 3300005545 Ga0070695_100168622 Ga0070695_1001686221 263
449 3300005546 Ga0070696_100046533 Ga0070696_1000465332 263
450 3300005549 Ga0070704_100070547 Ga0070704_1000705472 263
451 3300005578 Ga0068854_100189533 Ga0068854_1001895332 263
452 3300005617 Ga0068859_100009149 Ga0068859_1000091493 263
453 3300005617 Ga0068859_100092975 Ga0068859_1000929752 263
454 3300005617 Ga0068859_100238933 Ga0068859_1002389332 263
455 3300005719 Ga0068861_100143155 Ga0068861_1001431552 263
456 3300005842 Ga0068858_100366708 Ga0068858_1003667081 263
457 3300005843 Ga0068860_100088348 Ga0068860_1000883483 263
458 3300005844 Ga0068862_100002282 Ga0068862_1000022823 263
459 3300006931 Ga0097620_100009149 Ga0097620_1000091498 263
460 3300006931 Ga0097620_100092980 Ga0097620_1000929803 263
461 3300006931 Ga0097620_100238932 Ga0097620_1002389322 263
462 3300009177 Ga0105248_10059040 Ga0105248_100590403 263
463 3300009553 Ga0105249_10009084 Ga0105249_100090842 263
464 3300009553 Ga0105249_10028827 Ga0105249_100288274 263
465 3300013306 Ga0163162_10172046 Ga0163162_101720462 263
466 3300025941 Ga0207711_10036379 Ga0207711_100363792 263
467 3300025941 Ga0207711_10173837 Ga0207711_101738372 263
468 3300025961 Ga0207712_10075852 Ga0207712_100758522 263
469 3300025961 Ga0207712_10093296 Ga0207712_100932963 263
470 3300026118 Ga0207675_100085265 Ga0207675_1000852652 263
471 3300028380 Ga0268265_10005207 Ga0268265_100052072 263
472 3300028381 Ga0268264_10047051 Ga0268264_100470513 263
473 3300042876 Ga0451577_0340020 Ga0451577_0340020_115_912 264
474 3300044712 Ga0453684_0386028 Ga0453684_0386028_311_1108 264
475 3300005334 Ga0068869_100022065 Ga0068869_1000220653 266
476 3300005467 Ga0070706_100020684 Ga0070706_1000206846 266
477 3300005467 Ga0070706_100346544 Ga0070706_1003465442 266
478 3300005546 Ga0070696_100023128 Ga0070696_1000231284 266
479 3300009553 Ga0105249_10553555 Ga0105249_105535551 266
480 3300025910 Ga0207684_10025324 Ga0207684_100253245 266
481 3300025922 Ga0207646_10006141 Ga0207646_100061413 266
482 3300025942 Ga0207689_10021817 Ga0207689_100218174 266
483 3300025981 Ga0207640_10211773 Ga0207640_102117732 266
484 3300028380 Ga0268265_10080922 Ga0268265_100809222 266
485 3300005293 Ga0065715_10002900 Ga0065715_100029005 267
486 3300005328 Ga0070676_10008865 Ga0070676_100088654 267
487 3300005329 Ga0070683_100280376 Ga0070683_1002803762 267
488 3300005331 Ga0070670_100001289 Ga0070670_10000128918 267
489 3300005334 Ga0068869_100003857 Ga0068869_1000038573 267
490 3300005336 Ga0070680_100001395 Ga0070680_10000139518 267
491 3300005337 Ga0070682_100008694 Ga0070682_1000086945 267
492 3300005339 Ga0070660_100031972 Ga0070660_1000319723 267
493 3300005340 Ga0070689_100006470 Ga0070689_1000064703 267
494 3300005341 Ga0070691_10040782 Ga0070691_100407823 267
495 3300005344 Ga0070661_100009543 Ga0070661_1000095432 267
496 3300005345 Ga0070692_10001432 Ga0070692_100014324 267
497 3300005366 Ga0070659_100012916 Ga0070659_1000129163 267
498 3300005367 Ga0070667_100272041 Ga0070667_1002720411 267
499 3300005406 Ga0070703_10012278 Ga0070703_100122782 267
500 3300005440 Ga0070705_100005606 Ga0070705_1000056064 267
501 3300005440 Ga0070705_100079216 Ga0070705_1000792162 267
502 3300005444 Ga0070694_100019497 Ga0070694_1000194975 267
503 3300005444 Ga0070694_100022829 Ga0070694_1000228294 267
504 3300005444 Ga0070694_100081098 Ga0070694_1000810982 267
505 3300005445 Ga0070708_100311392 Ga0070708_1003113922 267
506 3300005455 Ga0070663_100029655 Ga0070663_1000296552 267
507 3300005457 Ga0070662_100018535 Ga0070662_1000185356 267
508 3300005458 Ga0070681_10047982 Ga0070681_100479824 267
509 3300005459 Ga0068867_100011008 Ga0068867_1000110086 267
510 3300005467 Ga0070706_100019138 Ga0070706_1000191384 267
511 3300005467 Ga0070706_100674187 Ga0070706_1006741871 267
512 3300005471 Ga0070698_100002999 Ga0070698_10000299913 267
513 3300005471 Ga0070698_100037580 Ga0070698_1000375805 267
514 3300005518 Ga0070699_100003559 Ga0070699_1000035595 267
515 3300005518 Ga0070699_100007084 Ga0070699_1000070849 267
516 3300005530 Ga0070679_100020201 Ga0070679_1000202013 267
517 3300005535 Ga0070684_100119521 Ga0070684_1001195214 267
518 3300005536 Ga0070697_100001193 Ga0070697_10000119313 267
519 3300005536 Ga0070697_100008303 Ga0070697_1000083034 267
520 3300005539 Ga0068853_100010688 Ga0068853_1000106886 267
521 3300005545 Ga0070695_100260420 Ga0070695_1002604202 267
522 3300005546 Ga0070696_100013950 Ga0070696_1000139503 267
523 3300005546 Ga0070696_100125252 Ga0070696_1001252522 267
524 3300005547 Ga0070693_100000159 Ga0070693_10000015924 267
525 3300005549 Ga0070704_100000116 Ga0070704_10000011623 267
526 3300005563 Ga0068855_100001156 Ga0068855_10000115627 267
527 3300005564 Ga0070664_100023826 Ga0070664_1000238265 267
528 3300005577 Ga0068857_100031045 Ga0068857_1000310453 267
529 3300005578 Ga0068854_100025822 Ga0068854_1000258223 267
530 3300005614 Ga0068856_100001122 Ga0068856_10000112225 267
531 3300005615 Ga0070702_100169717 Ga0070702_1001697172 267
532 3300005616 Ga0068852_100115829 Ga0068852_1001158291 267
533 3300005617 Ga0068859_100037546 Ga0068859_1000375464 267
534 3300005719 Ga0068861_100025732 Ga0068861_1000257325 267
535 3300005840 Ga0068870_10002227 Ga0068870_100022276 267
536 3300005841 Ga0068863_100036484 Ga0068863_1000364843 267
537 3300005842 Ga0068858_100121976 Ga0068858_1001219764 267
538 3300005843 Ga0068860_100054902 Ga0068860_1000549022 267
539 3300005844 Ga0068862_100035154 Ga0068862_1000351543 267
540 3300005937 Ga0081455_10006197 Ga0081455_100061973 267
541 3300006173 Ga0070716_100301479 Ga0070716_1003014792 267
542 3300006852 Ga0075433_10001383 Ga0075433_1000138319 267
543 3300006852 Ga0075433_10001866 Ga0075433_100018667 267
544 3300006871 Ga0075434_100009129 Ga0075434_1000091294 267
545 3300006871 Ga0075434_100440032 Ga0075434_1004400322 267
546 3300006914 Ga0075436_100017003 Ga0075436_1000170034 267
547 3300006914 Ga0075436_100045813 Ga0075436_1000458132 267
548 3300006914 Ga0075436_100053934 Ga0075436_1000539342 267
549 3300006931 Ga0097620_100037548 Ga0097620_1000375484 267
550 3300007076 Ga0075435_100011360 Ga0075435_1000113606 267
551 3300007076 Ga0075435_100039081 Ga0075435_1000390814 267
552 3300007076 Ga0075435_100081781 Ga0075435_1000817812 267
553 3300007265 Ga0099794_10064234 Ga0099794_100642342 267
554 3300009093 Ga0105240_10352616 Ga0105240_103526162 267
555 3300009147 Ga0114129_10012518 Ga0114129_100125184 267
556 3300009147 Ga0114129_10038736 Ga0114129_100387366 267
557 3300009147 Ga0114129_10140074 Ga0114129_101400743 267
558 3300009174 Ga0105241_10004152 Ga0105241_1000415211 267
559 3300009553 Ga0105249_10189572 Ga0105249_101895722 267
560 3300010375 Ga0105239_10209445 Ga0105239_102094452 267
561 3300011119 Ga0105246_10018430 Ga0105246_100184303 267
562 3300013100 Ga0157373_10001579 Ga0157373_1000157920 267
563 3300013104 Ga0157370_10189797 Ga0157370_101897972 267
564 3300013105 Ga0157369_10061287 Ga0157369_100612872 267
565 3300013307 Ga0157372_10009351 Ga0157372_100093514 267
566 3300013307 Ga0157372_10231680 Ga0157372_102316802 267
567 3300025885 Ga0207653_10003577 Ga0207653_100035773 267
568 3300025901 Ga0207688_10023960 Ga0207688_100239603 267
569 3300025904 Ga0207647_10036087 Ga0207647_100360875 267
570 3300025907 Ga0207645_10000497 Ga0207645_1000049726 267
571 3300025908 Ga0207643_10000696 Ga0207643_100006967 267
572 3300025910 Ga0207684_10001190 Ga0207684_100011906 267
573 3300025910 Ga0207684_10029937 Ga0207684_100299372 267
574 3300025911 Ga0207654_10013178 Ga0207654_100131785 267
575 3300025912 Ga0207707_10001074 Ga0207707_1000107413 267
576 3300025917 Ga0207660_10003270 Ga0207660_100032704 267
577 3300025919 Ga0207657_10000681 Ga0207657_1000068112 267
578 3300025920 Ga0207649_10051148 Ga0207649_100511482 267
579 3300025921 Ga0207652_10006888 Ga0207652_100068885 267
580 3300025922 Ga0207646_10001440 Ga0207646_1000144024 267
581 3300025922 Ga0207646_10013235 Ga0207646_100132354 267
582 3300025925 Ga0207650_10072109 Ga0207650_100721093 267
583 3300025932 Ga0207690_10031710 Ga0207690_100317103 267
584 3300025933 Ga0207706_10018406 Ga0207706_100184066 267
585 3300025936 Ga0207670_10043384 Ga0207670_100433843 267
586 3300025939 Ga0207665_10062253 Ga0207665_100622533 267
587 3300025940 Ga0207691_10096310 Ga0207691_100963102 267
588 3300025942 Ga0207689_10000721 Ga0207689_1000072125 267
589 3300025944 Ga0207661_10096228 Ga0207661_100962283 267
590 3300025945 Ga0207679_10045791 Ga0207679_100457912 267
591 3300025949 Ga0207667_10016784 Ga0207667_100167843 267
592 3300025960 Ga0207651_10132973 Ga0207651_101329732 267
593 3300025961 Ga0207712_10189206 Ga0207712_101892062 267
594 3300025981 Ga0207640_10061340 Ga0207640_100613402 267
595 3300025986 Ga0207658_10197985 Ga0207658_101979852 267
596 3300026035 Ga0207703_10079800 Ga0207703_100798002 267
597 3300026041 Ga0207639_10017336 Ga0207639_100173366 267
598 3300026067 Ga0207678_10013487 Ga0207678_100134872 267
599 3300026089 Ga0207648_10003940 Ga0207648_100039404 267
600 3300026095 Ga0207676_10024205 Ga0207676_100242053 267
601 3300026116 Ga0207674_10000181 Ga0207674_100001813 267
602 3300026118 Ga0207675_100028813 Ga0207675_1000288132 267
603 3300026142 Ga0207698_10589183 Ga0207698_105891832 267
604 3300027395 Ga0209996_1001132 Ga0209996_10011322 267
605 3300027424 Ga0209984_1007834 Ga0209984_10078341 267
606 3300027462 Ga0210000_1008595 Ga0210000_10085952 267
607 3300027526 Ga0209968_1010650 Ga0209968_10106502 267
608 3300027543 Ga0209999_1002987 Ga0209999_10029874 267
609 3300027552 Ga0209982_1000520 Ga0209982_10005204 267
610 3300027614 Ga0209970_1001453 Ga0209970_10014535 267
611 3300027671 Ga0209588_1039660 Ga0209588_10396602 267
612 3300027682 Ga0209971_1000068 Ga0209971_100006823 267
613 3300027695 Ga0209966_1000188 Ga0209966_100018819 267
614 3300027717 Ga0209998_10000118 Ga0209998_100001188 267
615 3300027876 Ga0209974_10000096 Ga0209974_1000009623 267
616 3300028380 Ga0268265_10073071 Ga0268265_100730713 267
617 3300028381 Ga0268264_10142515 Ga0268264_101425152 267
618 3300034817 Ga0373948_0010017 Ga0373948_0010017_800_1603 267
619 3300035115 Ga0373941_0066062 Ga0373941_0066062_97_900 267
620 3300035121 Ga0373960_0048188 Ga0373960_0048188_407_1210 267
621 3300035691 Ga0373931_0032912 Ga0373931_0032912_895_1698 267
622 3300042012 Ga0439455_0003312 Ga0439455_0003312_170_973 267
623 3300042144 Ga0450889_005262 Ga0450889_005262_334_1137 267
624 3300042438 Ga0439459_0000856 Ga0439459_0000856_2637_3440 267
625 3300042439 Ga0439464_0000432 Ga0439464_0000432_1835_2638 267
626 3300042461 Ga0439460_0000793 Ga0439460_0000793_4471_5274 267
627 3300042876 Ga0451577_0039120 Ga0451577_0039120_2038_2844 267
628 3300042876 Ga0451577_0093018 Ga0451577_0093018_808_1611 267
629 3300044712 Ga0453684_0080736 Ga0453684_0080736_1421_2227 267
630 3300044712 Ga0453684_0152043 Ga0453684_0152043_268_1071 267
631 3300045051 Ga0451576_0001286 Ga0451576_0001286_37269_38072 267
632 3300045051 Ga0451576_0012493 Ga0451576_0012493_3032_3835 267
633 3300045051 Ga0451576_0034619 Ga0451576_0034619_2613_3416 267
634 3300045051 Ga0451576_0137182 Ga0451576_0137182_323_1126 267
635 3300045051 Ga0451576_0171678 Ga0451576_0171678_820_1626 267
636 3300046472 Ga0495580_0067738 Ga0495580_0067738_1570_2373 267
637 3300048905 Ga0496102_0077008 Ga0496102_0077008_619_1422 267
638 3300048907 Ga0496104_0453303 Ga0496104_0453303_165_968 267
639 3300048916 Ga0496113_0383237 Ga0496113_0383237_35_838 267
640 3300049570 Ga0501033_0106617 Ga0501033_0106617_1150_1953 267
641 3300049572 Ga0501036_0031692 Ga0501036_0031692_1018_1821 267
642 3300049573 Ga0501037_0470040 Ga0501037_0470040_27_830 267
643 3300049574 Ga0501038_0080483 Ga0501038_0080483_130_933 267
644 3300049575 Ga0501039_0012303 Ga0501039_0012303_2305_3108 267
645 3300049576 Ga0501040_0010060 Ga0501040_0010060_3450_4256 267
646 3300049576 Ga0501040_0012854 Ga0501040_0012854_87_890 267
647 3300049576 Ga0501040_0243073 Ga0501040_0243073_292_1095 267
648 3300049577 Ga0501041_0006032 Ga0501041_0006032_336_1139 267
649 3300049578 Ga0501042_0012286 Ga0501042_0012286_208_1011 267
650 3300049580 Ga0501046_0003128 Ga0501046_0003128_1639_2442 267
651 3300049582 Ga0501048_0018656 Ga0501048_0018656_1952_2755 267
652 3300049587 Ga0501071_0048418 Ga0501071_0048418_1265_2068 267
653 3300049588 Ga0501072_0116504 Ga0501072_0116504_1003_1806 267
654 3300049590 Ga0501074_0003740 Ga0501074_0003740_2599_3402 267
655 3300049591 Ga0501075_0002282 Ga0501075_0002282_1372_2178 267
656 3300049591 Ga0501075_0002974 Ga0501075_0002974_3783_4586 267
657 3300049592 Ga0501076_0019026 Ga0501076_0019026_403_1206 267
658 3300049592 Ga0501076_0099799 Ga0501076_0099799_745_1551 267
659 3300049593 Ga0501077_0028513 Ga0501077_0028513_2144_2950 267
660 3300049593 Ga0501077_0202288 Ga0501077_0202288_151_954 267
661 3300049741 Ga0501079_0001669 Ga0501079_0001669_12726_13529 267
662 3300049742 Ga0501080_0049885 Ga0501080_0049885_2730_3533 267
663 3300049742 Ga0501080_0071496 Ga0501080_0071496_1770_2576 267
664 3300049743 Ga0501081_0002245 Ga0501081_0002245_2078_2884 267
665 3300049743 Ga0501081_0010456 Ga0501081_0010456_4834_5637 267
666 3300049744 Ga0501083_0106692 Ga0501083_0106692_774_1580 267
667 3300049824 Ga0501045_0000941 Ga0501045_0000941_18162_18965 267
668 3300049824 Ga0501045_0021825 Ga0501045_0021825_1440_2246 267
669 3300050507 nmdc:mga05p37_155405_c1 nmdc:mga05p37_155405_c1_798_1601 267
670 3300050507 nmdc:mga05p37_27569_c1 nmdc:mga05p37_27569_c1_4063_4869 267
671 3300050512 nmdc:mga0n895_4327_c1 nmdc:mga0n895_4327_c1_2080_2883 267
672 3300050512 nmdc:mga0n895_57864_c1 nmdc:mga0n895_57864_c1_55_858 267
673 3300050512 nmdc:mga0n895_75601_c1 nmdc:mga0n895_75601_c1_494_1297 267
674 3300050513 nmdc:mga0rr50_250910_c1 nmdc:mga0rr50_250910_c1_32_835 267
675 3300050513 nmdc:mga0rr50_5359_c1 nmdc:mga0rr50_5359_c1_2720_3523 267
676 3300050514 nmdc:mga08x19_111814_c1 nmdc:mga08x19_111814_c1_329_1132 267
677 3300050514 nmdc:mga08x19_2367_c1 nmdc:mga08x19_2367_c1_5748_6551 267
678 3300050514 nmdc:mga08x19_70143_c1 nmdc:mga08x19_70143_c1_151_954 267
679 3300050515 nmdc:mga0a205_1282_c1 nmdc:mga0a205_1282_c1_4877_5680 267
680 3300050515 nmdc:mga0a205_13787_c1 nmdc:mga0a205_13787_c1_3603_4406 267
681 3300054114 Ga0501084_0003152 Ga0501084_0003152_8860_9663 267
682 3300054114 Ga0501084_0022611 Ga0501084_0022611_2105_2911 267
683 3300060353 Ga0501082_0003056 Ga0501082_0003056_7131_7934 267
684 3300060353 Ga0501082_0039476 Ga0501082_0039476_1973_2779 267
685 3300061734 Ga0530510_0041106 Ga0530510_0041106_524_1327 267

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

44

204

0.94

PF12399

BCA_ABC_TP_C

Branched-chain amino acid ATP-binding cassette transporter

253

279

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2awo-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) 0.9548 4 239
7caf-assembly1.cif.gz_C mycobacterium smegmatis lpqy-sugabc complex in the pre-translocation state 0.9415 4 239
6mit-assembly2.cif.gz_E lptbfgc from enterobacter cloacae 0.9395 1 251
6b89-assembly1.cif.gz_A e. coli lptb in complex with adp and novobiocin 0.9389 1 250
6mjp-assembly1.cif.gz_B lptb(e163q)fgc from vibrio cholerae 0.9372 3 253
ID Description Score Start End Superfamily
af_P0A9S7_4_254_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9848 3 251 3.40.50.300
af_P0A9S7_4_254_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9732 3 251 3.40.50.300
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9549 4 234 3.40.50.300
af_A0A1D6Q2V7_231_304_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9438 2 66 3.40.50.300
af_Q9XW49_1237_1482_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9396 2 242 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A1I6ERF8-F1-model_v4 Amino acid/amide ABC transporter ATP-binding protein 1, HAAT family 0.9771 2 252 GO:0005304
GO:0005524
GO:0005886
GO:0015188
GO:0015192
GO:0015808
GO:0016887
GO:0042941
GO:1903805
GO:1903806
AF-A0A0F2NA46-F1-model_v4 ABC transporter 0.9714 1 252 GO:0005524
GO:0005886
GO:0016887
AF-A0A512DTK1-F1-model_v4 ABC transporter ATP-binding protein 0.9706 2 251 GO:0005304
GO:0005524
GO:0005886
GO:0015188
GO:0015192
GO:0015808
GO:0016887
GO:0042941
GO:1903805
GO:1903806
AF-A0A0F2NA46-F1-model_v4 ABC transporter 0.9639 1 252 GO:0005524
GO:0005886
GO:0016887
AF-A0A7W0M2T4-F1-model_v4 ABC transporter ATP-binding protein 0.9614 2 251 GO:0005524
GO:0005886
GO:0016887

Feature Viewer

pLDDT pTM Quality
90.13 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map