F475104
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 685 | 294 | 681 | 146 |
Family's Representative Sequence
| Representative Sequence | 3300005290|Ga0065712_10256583|Ga0065712_102565832 |
| Length | 166 |
| Sequence | MAERGQSRVKRDWLKQLTMDIILIQDVDNLGGKNELVKVKNGYARNFLIPRGLAVEANPSNRKQLDERMKVAKKKEDQMLAQINNVIAKLQEGPVKVGAKTGTSGKIFGSVTALQISRAIRDQKGYEIDRKKIHITDDVKELGTYKASIDFGNGHHADVEFEVVAE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 2883068021 | Chitinophaga rhizosphaerae T16R-86 | Isolate | Rhizosphere |
| 3 | 2896085136 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 4 | 2896109856 | Chitinophaga sp. SYP-B3965 | Isolate | Rhizosphere |
| 5 | 2929154850 | Filimonas sp. R-72421 Hybrid assembly | Isolate | Unclassified |
| 6 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 7 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 8 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 9 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 10 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 11 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 12 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 13 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 14 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 15 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 16 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 17 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 18 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 21 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 29 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 33 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 45 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 53 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 57 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 62 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 64 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 65 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 66 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 68 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 69 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 70 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 71 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 72 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 73 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 74 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 75 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 76 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 77 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 78 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 82 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 83 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 84 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 85 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 113 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 114 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 170 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 173 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 174 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 175 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 176 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 177 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 178 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 179 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 180 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 181 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 182 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 183 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 184 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 185 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 186 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 187 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 188 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 189 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 190 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 191 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 192 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 193 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 194 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 195 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 196 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 197 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 198 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 199 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 200 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 201 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 202 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 203 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 204 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 205 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 206 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 207 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 208 | 3300042132 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 | Metagenome | Rhizosphere |
| 209 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 210 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 211 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 212 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 213 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 214 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 215 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 216 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 217 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 218 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 232 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 233 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 234 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 235 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 236 | 3300049163 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 237 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 238 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 239 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 240 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 241 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 242 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 243 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 244 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 245 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 246 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 247 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 248 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 249 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 250 | 3300049546 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 251 | 3300049549 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 252 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 253 | 3300049552 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 254 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 261 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 262 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 263 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 264 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 265 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 266 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 267 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 268 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 269 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 270 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 271 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 272 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 273 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 274 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 275 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 276 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 277 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 278 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 279 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 280 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 281 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 282 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 283 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 284 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 287 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 290 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 291 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 292 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 293 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 294 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.14 |
| Metatranscriptomes | 6.28 |
| Isolates | 0.58 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.46 |
| Nodule | 0 |
| Rhizoplane | 0.29 |
| Rhizosphere | 95.91 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.34 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS1b_contig_3199889 | 2162886011 | Bacteria | 842 |
| 2 | JGI24736J21556_1008031 | 3300001904 | Bacteria | 1760 |
| 3 | JGI24740J21852_10005418 | 3300001979 | Bacteria | 5398 |
| 4 | JGI24744J21845_10007602 | 3300002077 | Bacteria | 2239 |
| 5 | JGI24751J29686_10000815 | 3300002459 | Bacteria | 7260 |
| 6 | JGI25154J39366_1000020 | 3300002738 | Bacteria | 233181 |
| 7 | JGI25157J39369_1007886 | 3300002741 | Bacteria | 1511 |
| 8 | JGI25153J46596_10000449 | 3300003215 | Bacteria | 26469 |
| 9 | rootH2_10078683 | 3300003320 | Bacteria | 1653 |
| 10 | rootH1_10083371 | 3300003323 | Bacteria | 1582 |
| 11 | JGI25160J50197_1010153 | 3300003354 | Bacteria | 3426 |
| 12 | JGI25160J50197_1016700 | 3300003354 | Bacteria | 2355 |
| 13 | Ga0058860_11988454 | 3300004801 | Bacteria | 1560 |
| 14 | Ga0058862_12224181 | 3300004803 | Bacteria | 761 |
| 15 | Ga0065714_10134545 | 3300005288 | Bacteria | 1211 |
| 16 | Ga0065704_10084334 | 3300005289 | Bacteria | 3346 |
| 17 | Ga0065704_10488012 | 3300005289 | Bacteria | 670 |
| 18 | Ga0065712_10022972 | 3300005290 | Bacteria | 1468 |
| 19 | Ga0065712_10034732 | 3300005290 | Bacteria | 747 |
| 20 | Ga0065712_10099081 | 3300005290 | Bacteria | 2101 |
| 21 | Ga0065712_10256583 | 3300005290 | Bacteria | 924 |
| 22 | Ga0065715_10151075 | 3300005293 | Bacteria | 1728 |
| 23 | Ga0065715_10727538 | 3300005293 | Bacteria | 590 |
| 24 | Ga0070658_10004004 | 3300005327 | Bacteria | 12069 |
| 25 | Ga0070658_10126296 | 3300005327 | Bacteria | 2129 |
| 26 | Ga0070658_10965419 | 3300005327 | Bacteria | 741 |
| 27 | Ga0070658_11784040 | 3300005327 | Unclassified | 532 |
| 28 | Ga0070676_10225049 | 3300005328 | Bacteria | 1241 |
| 29 | Ga0070676_10922198 | 3300005328 | Bacteria | 652 |
| 30 | Ga0070683_100014181 | 3300005329 | Bacteria | 6962 |
| 31 | Ga0070683_100163407 | 3300005329 | Bacteria | 2112 |
| 32 | Ga0070690_100147837 | 3300005330 | Bacteria | 1600 |
| 33 | Ga0070690_100228537 | 3300005330 | Bacteria | 1307 |
| 34 | Ga0070670_100008929 | 3300005331 | Bacteria | 8561 |
| 35 | Ga0070670_100050094 | 3300005331 | Bacteria | 3589 |
| 36 | Ga0070670_100159846 | 3300005331 | Bacteria | 1952 |
| 37 | Ga0070670_100201020 | 3300005331 | Bacteria | 1731 |
| 38 | Ga0070670_100210533 | 3300005331 | Bacteria | 1690 |
| 39 | Ga0070670_100361455 | 3300005331 | Bacteria | 1276 |
| 40 | Ga0070670_101002631 | 3300005331 | Unclassified | 759 |
| 41 | Ga0070677_10013175 | 3300005333 | Bacteria | 2886 |
| 42 | Ga0070677_10018611 | 3300005333 | Bacteria | 2504 |
| 43 | Ga0070677_10147990 | 3300005333 | Bacteria | 1090 |
| 44 | Ga0068869_100203298 | 3300005334 | Bacteria | 1563 |
| 45 | Ga0068869_100306661 | 3300005334 | Bacteria | 1283 |
| 46 | Ga0070666_10078433 | 3300005335 | Bacteria | 2255 |
| 47 | Ga0070680_100035348 | 3300005336 | Bacteria | 4033 |
| 48 | Ga0070682_100045350 | 3300005337 | Bacteria | 2725 |
| 49 | Ga0070682_100272240 | 3300005337 | Bacteria | 1231 |
| 50 | Ga0070682_100706508 | 3300005337 | Unclassified | 809 |
| 51 | Ga0070682_101239500 | 3300005337 | Unclassified | 631 |
| 52 | Ga0070682_101983165 | 3300005337 | Bacteria | 512 |
| 53 | Ga0068868_100015105 | 3300005338 | Bacteria | 5703 |
| 54 | Ga0068868_100070716 | 3300005338 | Bacteria | 2782 |
| 55 | Ga0068868_100731513 | 3300005338 | Bacteria | 887 |
| 56 | Ga0068868_100766407 | 3300005338 | Bacteria | 868 |
| 57 | Ga0070660_100020101 | 3300005339 | Bacteria | 4903 |
| 58 | Ga0070660_100300871 | 3300005339 | Bacteria | 1315 |
| 59 | Ga0070689_100728765 | 3300005340 | Bacteria | 867 |
| 60 | Ga0070689_101003995 | 3300005340 | Unclassified | 742 |
| 61 | Ga0070687_100000838 | 3300005343 | Bacteria | 10250 |
| 62 | Ga0070687_100060322 | 3300005343 | Bacteria | 2000 |
| 63 | Ga0070687_100263472 | 3300005343 | Bacteria | 1077 |
| 64 | Ga0070687_100329096 | 3300005343 | Bacteria | 979 |
| 65 | Ga0070661_100001685 | 3300005344 | Bacteria | 15290 |
| 66 | Ga0070661_100836437 | 3300005344 | Unclassified | 757 |
| 67 | Ga0070692_10152686 | 3300005345 | Bacteria | 1316 |
| 68 | Ga0070668_100175198 | 3300005347 | Bacteria | 1748 |
| 69 | Ga0070668_100483661 | 3300005347 | Bacteria | 1069 |
| 70 | Ga0070668_100502734 | 3300005347 | Bacteria | 1049 |
| 71 | Ga0070668_101054744 | 3300005347 | Bacteria | 732 |
| 72 | Ga0070669_100102445 | 3300005353 | Bacteria | 2161 |
| 73 | Ga0070669_100169255 | 3300005353 | Bacteria | 1702 |
| 74 | Ga0070669_100238876 | 3300005353 | Bacteria | 1443 |
| 75 | Ga0070669_100726853 | 3300005353 | Bacteria | 840 |
| 76 | Ga0070669_100851268 | 3300005353 | Unclassified | 777 |
| 77 | Ga0070669_101206687 | 3300005353 | Bacteria | 654 |
| 78 | Ga0070675_100027766 | 3300005354 | Bacteria | 4550 |
| 79 | Ga0070675_100028796 | 3300005354 | Bacteria | 4474 |
| 80 | Ga0070675_100056542 | 3300005354 | Bacteria | 3233 |
| 81 | Ga0070675_100085424 | 3300005354 | Bacteria | 2637 |
| 82 | Ga0070675_100271152 | 3300005354 | Bacteria | 1489 |
| 83 | Ga0070671_100018271 | 3300005355 | Bacteria | 5694 |
| 84 | Ga0070671_100037415 | 3300005355 | Bacteria | 4024 |
| 85 | Ga0070671_100683194 | 3300005355 | Bacteria | 890 |
| 86 | Ga0070671_100705004 | 3300005355 | Bacteria | 876 |
| 87 | Ga0070674_100056100 | 3300005356 | Bacteria | 2731 |
| 88 | Ga0070674_100158733 | 3300005356 | Bacteria | 1714 |
| 89 | Ga0070674_100451798 | 3300005356 | Bacteria | 1061 |
| 90 | Ga0070674_100552663 | 3300005356 | Unclassified | 966 |
| 91 | Ga0070673_100005284 | 3300005364 | Bacteria | 8251 |
| 92 | Ga0070673_100009831 | 3300005364 | Bacteria | 6443 |
| 93 | Ga0070673_100368076 | 3300005364 | Bacteria | 1279 |
| 94 | Ga0070673_100771204 | 3300005364 | Bacteria | 886 |
| 95 | Ga0070673_100779839 | 3300005364 | Bacteria | 882 |
| 96 | Ga0070673_100801352 | 3300005364 | Unclassified | 870 |
| 97 | Ga0070673_101037251 | 3300005364 | Bacteria | 764 |
| 98 | Ga0070673_101051482 | 3300005364 | Bacteria | 759 |
| 99 | Ga0070673_101063981 | 3300005364 | Bacteria | 755 |
| 100 | Ga0070673_101832253 | 3300005364 | Unclassified | 575 |
| 101 | Ga0070688_100188862 | 3300005365 | Unclassified | 1434 |
| 102 | Ga0070688_100273415 | 3300005365 | Bacteria | 1211 |
| 103 | Ga0070688_100362755 | 3300005365 | Bacteria | 1064 |
| 104 | Ga0070688_100411196 | 3300005365 | Bacteria | 1003 |
| 105 | Ga0070659_100004313 | 3300005366 | Bacteria | 10156 |
| 106 | Ga0070659_100371785 | 3300005366 | Bacteria | 1203 |
| 107 | Ga0070659_100664506 | 3300005366 | Bacteria | 899 |
| 108 | Ga0070667_100181821 | 3300005367 | Bacteria | 1860 |
| 109 | Ga0070667_100255773 | 3300005367 | Bacteria | 1567 |
| 110 | Ga0070667_100262152 | 3300005367 | Bacteria | 1548 |
| 111 | Ga0070667_100496072 | 3300005367 | Bacteria | 1119 |
| 112 | Ga0070713_100924860 | 3300005436 | Bacteria | 839 |
| 113 | Ga0070713_101913483 | 3300005436 | Bacteria | 575 |
| 114 | Ga0070713_102208574 | 3300005436 | Bacteria | 533 |
| 115 | Ga0070663_100189737 | 3300005455 | Bacteria | 1599 |
| 116 | Ga0070678_100058471 | 3300005456 | Bacteria | 2830 |
| 117 | Ga0070678_100784343 | 3300005456 | Bacteria | 864 |
| 118 | Ga0070678_100883314 | 3300005456 | Bacteria | 816 |
| 119 | Ga0070662_100091601 | 3300005457 | Bacteria | 2284 |
| 120 | Ga0070662_100169463 | 3300005457 | Bacteria | 1714 |
| 121 | Ga0070681_10678192 | 3300005458 | Bacteria | 946 |
| 122 | Ga0070681_10890796 | 3300005458 | Bacteria | 808 |
| 123 | Ga0068867_100077692 | 3300005459 | Bacteria | 2495 |
| 124 | Ga0068867_100109447 | 3300005459 | Bacteria | 2121 |
| 125 | Ga0068867_100508756 | 3300005459 | Bacteria | 1036 |
| 126 | Ga0068867_100822316 | 3300005459 | Bacteria | 830 |
| 127 | Ga0070685_10240624 | 3300005466 | Bacteria | 1194 |
| 128 | Ga0070685_10242637 | 3300005466 | Bacteria | 1190 |
| 129 | Ga0070685_10757421 | 3300005466 | Unclassified | 712 |
| 130 | Ga0070685_10828157 | 3300005466 | Bacteria | 684 |
| 131 | Ga0070679_100108447 | 3300005530 | Bacteria | 2762 |
| 132 | Ga0070684_100001962 | 3300005535 | Bacteria | 15111 |
| 133 | Ga0070684_100560678 | 3300005535 | Bacteria | 1060 |
| 134 | Ga0070684_101072079 | 3300005535 | Bacteria | 757 |
| 135 | Ga0068853_100002136 | 3300005539 | Bacteria | 14716 |
| 136 | Ga0068853_100304146 | 3300005539 | Bacteria | 1475 |
| 137 | Ga0068853_101012795 | 3300005539 | Bacteria | 800 |
| 138 | Ga0068853_101879087 | 3300005539 | Unclassified | 581 |
| 139 | Ga0070672_100030162 | 3300005543 | Bacteria | 4071 |
| 140 | Ga0070672_100083790 | 3300005543 | Bacteria | 2559 |
| 141 | Ga0070672_100135692 | 3300005543 | Bacteria | 2026 |
| 142 | Ga0070672_100164454 | 3300005543 | Bacteria | 1843 |
| 143 | Ga0070672_100381934 | 3300005543 | Bacteria | 1205 |
| 144 | Ga0070672_100715087 | 3300005543 | Bacteria | 877 |
| 145 | Ga0070686_100037699 | 3300005544 | Bacteria | 3000 |
| 146 | Ga0070686_100041373 | 3300005544 | Bacteria | 2880 |
| 147 | Ga0070665_100289365 | 3300005548 | Bacteria | 1641 |
| 148 | Ga0070665_100983163 | 3300005548 | Unclassified | 856 |
| 149 | Ga0070665_101296901 | 3300005548 | Unclassified | 738 |
| 150 | Ga0070704_100460810 | 3300005549 | Bacteria | 1096 |
| 151 | Ga0070704_100815904 | 3300005549 | Bacteria | 834 |
| 152 | Ga0068855_101071243 | 3300005563 | Unclassified | 844 |
| 153 | Ga0068855_101073201 | 3300005563 | Bacteria | 843 |
| 154 | Ga0070664_100001137 | 3300005564 | Bacteria | 21035 |
| 155 | Ga0070664_100003013 | 3300005564 | Bacteria | 13617 |
| 156 | Ga0070664_100056457 | 3300005564 | Bacteria | 3336 |
| 157 | Ga0070664_102201636 | 3300005564 | Bacteria | 523 |
| 158 | Ga0068857_100001716 | 3300005577 | Bacteria | 17629 |
| 159 | Ga0068857_100196354 | 3300005577 | Bacteria | 1839 |
| 160 | Ga0068857_100342736 | 3300005577 | Bacteria | 1383 |
| 161 | Ga0068857_100774592 | 3300005577 | Unclassified | 915 |
| 162 | Ga0068857_102064063 | 3300005577 | Bacteria | 559 |
| 163 | Ga0068854_100166429 | 3300005578 | Bacteria | 1712 |
| 164 | Ga0068854_100411413 | 3300005578 | Bacteria | 1121 |
| 165 | Ga0068856_100285973 | 3300005614 | Bacteria | 1666 |
| 166 | Ga0068856_100419678 | 3300005614 | Bacteria | 1358 |
| 167 | Ga0070702_100007150 | 3300005615 | Bacteria | 5332 |
| 168 | Ga0070702_100249024 | 3300005615 | Unclassified | 1203 |
| 169 | Ga0068852_100007485 | 3300005616 | Bacteria | 7971 |
| 170 | Ga0068852_100033007 | 3300005616 | Bacteria | 4293 |
| 171 | Ga0068852_100079407 | 3300005616 | Bacteria | 2906 |
| 172 | Ga0068852_100130404 | 3300005616 | Bacteria | 2314 |
| 173 | Ga0068852_100209319 | 3300005616 | Bacteria | 1849 |
| 174 | Ga0068852_100302890 | 3300005616 | Bacteria | 1547 |
| 175 | Ga0068852_100571807 | 3300005616 | Bacteria | 1132 |
| 176 | Ga0068852_101940801 | 3300005616 | Bacteria | 611 |
| 177 | Ga0068859_100016441 | 3300005617 | Bacteria | 7431 |
| 178 | Ga0068859_100135963 | 3300005617 | Bacteria | 2531 |
| 179 | Ga0068859_100389313 | 3300005617 | Bacteria | 1490 |
| 180 | Ga0068859_100563242 | 3300005617 | Bacteria | 1234 |
| 181 | Ga0068859_101442173 | 3300005617 | Unclassified | 759 |
| 182 | Ga0068859_101599148 | 3300005617 | Bacteria | 720 |
| 183 | Ga0068859_102410511 | 3300005617 | Unclassified | 580 |
| 184 | Ga0068864_100222731 | 3300005618 | Bacteria | 1741 |
| 185 | Ga0068864_100268024 | 3300005618 | Bacteria | 1590 |
| 186 | Ga0068864_100384987 | 3300005618 | Bacteria | 1330 |
| 187 | Ga0068864_100735807 | 3300005618 | Bacteria | 966 |
| 188 | Ga0068864_100842891 | 3300005618 | Unclassified | 903 |
| 189 | Ga0068864_100858915 | 3300005618 | Bacteria | 894 |
| 190 | Ga0068866_10032849 | 3300005718 | Bacteria | 2512 |
| 191 | Ga0068861_100100355 | 3300005719 | Bacteria | 2300 |
| 192 | Ga0068861_100109099 | 3300005719 | Bacteria | 2215 |
| 193 | Ga0068861_101774520 | 3300005719 | Bacteria | 611 |
| 194 | Ga0068851_10000072 | 3300005834 | Bacteria | 57370 |
| 195 | Ga0068851_10076116 | 3300005834 | Bacteria | 1745 |
| 196 | Ga0068851_10171215 | 3300005834 | Bacteria | 1198 |
| 197 | Ga0068851_10609589 | 3300005834 | Bacteria | 665 |
| 198 | Ga0068870_10093875 | 3300005840 | Bacteria | 1683 |
| 199 | Ga0068870_10101857 | 3300005840 | Bacteria | 1624 |
| 200 | Ga0068870_10206300 | 3300005840 | Bacteria | 1194 |
| 201 | Ga0068870_10238087 | 3300005840 | Bacteria | 1122 |
| 202 | Ga0068870_10315638 | 3300005840 | Bacteria | 991 |
| 203 | Ga0068863_100008733 | 3300005841 | Bacteria | 9895 |
| 204 | Ga0068863_100293521 | 3300005841 | Unclassified | 1576 |
| 205 | Ga0068863_100702162 | 3300005841 | Bacteria | 1005 |
| 206 | Ga0068858_100075507 | 3300005842 | Bacteria | 3131 |
| 207 | Ga0068858_100218978 | 3300005842 | Bacteria | 1802 |
| 208 | Ga0068858_100520807 | 3300005842 | Bacteria | 1150 |
| 209 | Ga0068860_100011727 | 3300005843 | Bacteria | 8637 |
| 210 | Ga0068860_100054837 | 3300005843 | Bacteria | 3788 |
| 211 | Ga0068860_100100474 | 3300005843 | Bacteria | 2760 |
| 212 | Ga0068860_100288538 | 3300005843 | Bacteria | 1605 |
| 213 | Ga0068860_100780097 | 3300005843 | Bacteria | 968 |
| 214 | Ga0068862_100176021 | 3300005844 | Bacteria | 1918 |
| 215 | Ga0068862_100394910 | 3300005844 | Bacteria | 1293 |
| 216 | Ga0068862_101139270 | 3300005844 | Bacteria | 776 |
| 217 | Ga0070717_10850484 | 3300006028 | Bacteria | 830 |
| 218 | Ga0070715_10346453 | 3300006163 | Bacteria | 810 |
| 219 | Ga0097621_100008970 | 3300006237 | Bacteria | 7234 |
| 220 | Ga0097621_100061486 | 3300006237 | Bacteria | 3081 |
| 221 | Ga0097621_100255991 | 3300006237 | Bacteria | 1534 |
| 222 | Ga0068871_100093920 | 3300006358 | Bacteria | 2503 |
| 223 | Ga0068871_100276881 | 3300006358 | Bacteria | 1467 |
| 224 | Ga0068871_100341845 | 3300006358 | Bacteria | 1322 |
| 225 | Ga0068871_100561723 | 3300006358 | Bacteria | 1034 |
| 226 | Ga0075428_100928658 | 3300006844 | Bacteria | 922 |
| 227 | Ga0075429_100441428 | 3300006880 | Bacteria | 1140 |
| 228 | Ga0075429_100535334 | 3300006880 | Bacteria | 1027 |
| 229 | Ga0068865_100291190 | 3300006881 | Bacteria | 1303 |
| 230 | Ga0068865_100309166 | 3300006881 | Bacteria | 1268 |
| 231 | Ga0068865_100491570 | 3300006881 | Bacteria | 1021 |
| 232 | Ga0097620_100016441 | 3300006931 | Bacteria | 7431 |
| 233 | Ga0097620_100135965 | 3300006931 | Bacteria | 2531 |
| 234 | Ga0097620_100389319 | 3300006931 | Bacteria | 1490 |
| 235 | Ga0097620_100563205 | 3300006931 | Bacteria | 1234 |
| 236 | Ga0097620_101442215 | 3300006931 | Unclassified | 759 |
| 237 | Ga0097620_101599154 | 3300006931 | Bacteria | 720 |
| 238 | Ga0097620_102410578 | 3300006931 | Unclassified | 580 |
| 239 | Ga0111539_10718755 | 3300009094 | Bacteria | 1163 |
| 240 | Ga0105247_10004404 | 3300009101 | Bacteria | 8986 |
| 241 | Ga0105247_10016725 | 3300009101 | Bacteria | 4398 |
| 242 | Ga0105243_10398155 | 3300009148 | Bacteria | 1278 |
| 243 | Ga0105241_10440903 | 3300009174 | Bacteria | 1150 |
| 244 | Ga0105242_10499138 | 3300009176 | Unclassified | 1157 |
| 245 | Ga0105242_10576529 | 3300009176 | Bacteria | 1083 |
| 246 | Ga0105248_10153330 | 3300009177 | Bacteria | 2599 |
| 247 | Ga0105237_10663394 | 3300009545 | Bacteria | 1050 |
| 248 | Ga0105238_10409263 | 3300009551 | Bacteria | 1350 |
| 249 | Ga0105249_10000762 | 3300009553 | Bacteria | 28926 |
| 250 | Ga0105249_10053326 | 3300009553 | Bacteria | 3697 |
| 251 | Ga0105249_10382863 | 3300009553 | Bacteria | 1433 |
| 252 | Ga0105249_10922785 | 3300009553 | Unclassified | 940 |
| 253 | Ga0105249_10981964 | 3300009553 | Bacteria | 913 |
| 254 | Ga0105249_11521844 | 3300009553 | Bacteria | 741 |
| 255 | Ga0105239_10662477 | 3300010375 | Bacteria | 1192 |
| 256 | Ga0105239_10724578 | 3300010375 | Bacteria | 1138 |
| 257 | Ga0105246_10276435 | 3300011119 | Bacteria | 1345 |
| 258 | Ga0105246_11103996 | 3300011119 | Bacteria | 724 |
| 259 | Ga0157373_10174789 | 3300013100 | Unclassified | 1511 |
| 260 | Ga0157373_10252614 | 3300013100 | Bacteria | 1247 |
| 261 | Ga0157371_10015329 | 3300013102 | Bacteria | 5753 |
| 262 | Ga0157371_10176316 | 3300013102 | Bacteria | 1528 |
| 263 | Ga0157370_10424994 | 3300013104 | Bacteria | 1222 |
| 264 | Ga0157370_10475281 | 3300013104 | Bacteria | 1149 |
| 265 | Ga0157370_10873099 | 3300013104 | Bacteria | 817 |
| 266 | Ga0157369_10186796 | 3300013105 | Bacteria | 2179 |
| 267 | Ga0157369_10410781 | 3300013105 | Bacteria | 1404 |
| 268 | Ga0157374_10037538 | 3300013296 | Bacteria | 4447 |
| 269 | Ga0157374_10166571 | 3300013296 | Bacteria | 2148 |
| 270 | Ga0157374_10418726 | 3300013296 | Bacteria | 1338 |
| 271 | Ga0157374_10913959 | 3300013296 | Bacteria | 895 |
| 272 | Ga0157374_10989705 | 3300013296 | Bacteria | 860 |
| 273 | Ga0157374_11608026 | 3300013296 | Bacteria | 674 |
| 274 | Ga0157378_10000709 | 3300013297 | Bacteria | 31237 |
| 275 | Ga0157378_10068340 | 3300013297 | Bacteria | 3186 |
| 276 | Ga0157378_10137489 | 3300013297 | Bacteria | 2266 |
| 277 | Ga0157378_10273642 | 3300013297 | Bacteria | 1625 |
| 278 | Ga0157378_10290041 | 3300013297 | Bacteria | 1580 |
| 279 | Ga0157378_10477167 | 3300013297 | Bacteria | 1242 |
| 280 | Ga0157378_10761286 | 3300013297 | Unclassified | 992 |
| 281 | Ga0157378_10913434 | 3300013297 | Bacteria | 909 |
| 282 | Ga0163162_10061543 | 3300013306 | Bacteria | 3791 |
| 283 | Ga0163162_10220927 | 3300013306 | Bacteria | 2025 |
| 284 | Ga0163162_10284284 | 3300013306 | Bacteria | 1786 |
| 285 | Ga0163162_10554883 | 3300013306 | Bacteria | 1277 |
| 286 | Ga0163162_10579720 | 3300013306 | Bacteria | 1249 |
| 287 | Ga0163162_10855707 | 3300013306 | Bacteria | 1024 |
| 288 | Ga0157372_10044094 | 3300013307 | Bacteria | 4941 |
| 289 | Ga0157372_10138196 | 3300013307 | Bacteria | 2807 |
| 290 | Ga0157372_10244080 | 3300013307 | Unclassified | 2084 |
| 291 | Ga0157372_10326210 | 3300013307 | Bacteria | 1787 |
| 292 | Ga0157372_10428260 | 3300013307 | Bacteria | 1542 |
| 293 | Ga0157372_10474095 | 3300013307 | Bacteria | 1459 |
| 294 | Ga0157372_10517117 | 3300013307 | Bacteria | 1392 |
| 295 | Ga0157372_10618753 | 3300013307 | Bacteria | 1262 |
| 296 | Ga0157372_10757105 | 3300013307 | Bacteria | 1129 |
| 297 | Ga0157372_10792845 | 3300013307 | Bacteria | 1101 |
| 298 | Ga0157372_11045870 | 3300013307 | Bacteria | 945 |
| 299 | Ga0157372_11110776 | 3300013307 | Unclassified | 914 |
| 300 | Ga0157372_11227177 | 3300013307 | Bacteria | 866 |
| 301 | Ga0157372_12699953 | 3300013307 | Bacteria | 570 |
| 302 | Ga0157372_13011144 | 3300013307 | Bacteria | 539 |
| 303 | Ga0157375_10029892 | 3300013308 | Bacteria | 5130 |
| 304 | Ga0157375_10376446 | 3300013308 | Bacteria | 1586 |
| 305 | Ga0157375_10872534 | 3300013308 | Bacteria | 1045 |
| 306 | Ga0157375_11251820 | 3300013308 | Bacteria | 871 |
| 307 | Ga0163163_10121634 | 3300014325 | Bacteria | 2644 |
| 308 | Ga0163163_10194683 | 3300014325 | Bacteria | 2075 |
| 309 | Ga0163163_10252665 | 3300014325 | Bacteria | 1813 |
| 310 | Ga0163163_10262306 | 3300014325 | Bacteria | 1779 |
| 311 | Ga0163163_10391609 | 3300014325 | Bacteria | 1447 |
| 312 | Ga0163163_12588917 | 3300014325 | Bacteria | 565 |
| 313 | Ga0157380_10000874 | 3300014326 | Bacteria | 18967 |
| 314 | Ga0157380_10013298 | 3300014326 | Bacteria | 5995 |
| 315 | Ga0157380_10257186 | 3300014326 | Bacteria | 1584 |
| 316 | Ga0157380_10908337 | 3300014326 | Bacteria | 907 |
| 317 | Ga0157380_11531965 | 3300014326 | Bacteria | 720 |
| 318 | Ga0157377_10060773 | 3300014745 | Bacteria | 2158 |
| 319 | Ga0157377_10202564 | 3300014745 | Bacteria | 1261 |
| 320 | Ga0157377_10518518 | 3300014745 | Bacteria | 836 |
| 321 | Ga0157379_10209045 | 3300014968 | Bacteria | 1766 |
| 322 | Ga0157379_10258653 | 3300014968 | Bacteria | 1581 |
| 323 | Ga0157379_10283108 | 3300014968 | Bacteria | 1509 |
| 324 | Ga0157379_10285786 | 3300014968 | Unclassified | 1501 |
| 325 | Ga0157379_11148254 | 3300014968 | Unclassified | 745 |
| 326 | Ga0157376_10007683 | 3300014969 | Bacteria | 7723 |
| 327 | Ga0157376_10102537 | 3300014969 | Bacteria | 2503 |
| 328 | Ga0157376_10305732 | 3300014969 | Bacteria | 1507 |
| 329 | Ga0157376_10597794 | 3300014969 | Bacteria | 1098 |
| 330 | Ga0157376_11238256 | 3300014969 | Bacteria | 775 |
| 331 | Ga0163161_10496688 | 3300017792 | Bacteria | 993 |
| 332 | Ga0209646_1000005 | 3300025246 | Bacteria | 717627 |
| 333 | Ga0209026_1000149 | 3300025250 | Bacteria | 111200 |
| 334 | Ga0209758_1001581 | 3300025297 | Bacteria | 26032 |
| 335 | Ga0207426_1000262 | 3300025302 | Bacteria | 111889 |
| 336 | Ga0207697_10025736 | 3300025315 | Bacteria | 2405 |
| 337 | Ga0207656_10000716 | 3300025321 | Bacteria | 10852 |
| 338 | Ga0207656_10044821 | 3300025321 | Bacteria | 1890 |
| 339 | Ga0207656_10187613 | 3300025321 | Bacteria | 994 |
| 340 | Ga0207656_10236554 | 3300025321 | Unclassified | 891 |
| 341 | Ga0207656_10649895 | 3300025321 | Unclassified | 539 |
| 342 | Ga0207682_10240664 | 3300025893 | Bacteria | 841 |
| 343 | Ga0207710_10021802 | 3300025900 | Bacteria | 2748 |
| 344 | Ga0207688_10022908 | 3300025901 | Bacteria | 3419 |
| 345 | Ga0207688_10078834 | 3300025901 | Bacteria | 1878 |
| 346 | Ga0207680_10253374 | 3300025903 | Bacteria | 1216 |
| 347 | Ga0207680_11280208 | 3300025903 | Bacteria | 522 |
| 348 | Ga0207647_10000054 | 3300025904 | Bacteria | 86704 |
| 349 | Ga0207645_10001414 | 3300025907 | Bacteria | 19668 |
| 350 | Ga0207645_10024138 | 3300025907 | Bacteria | 3945 |
| 351 | Ga0207645_10458274 | 3300025907 | Bacteria | 861 |
| 352 | Ga0207643_10017772 | 3300025908 | Bacteria | 3893 |
| 353 | Ga0207643_10380320 | 3300025908 | Unclassified | 890 |
| 354 | Ga0207643_10781610 | 3300025908 | Unclassified | 618 |
| 355 | Ga0207705_10017945 | 3300025909 | Bacteria | 5061 |
| 356 | Ga0207705_10038550 | 3300025909 | Bacteria | 3422 |
| 357 | Ga0207654_10165422 | 3300025911 | Unclassified | 1432 |
| 358 | Ga0207695_11155231 | 3300025913 | Bacteria | 654 |
| 359 | Ga0207660_10110671 | 3300025917 | Bacteria | 2066 |
| 360 | Ga0207662_10014557 | 3300025918 | Bacteria | 4416 |
| 361 | Ga0207662_10189665 | 3300025918 | Bacteria | 1326 |
| 362 | Ga0207657_10090557 | 3300025919 | Bacteria | 2553 |
| 363 | Ga0207657_10318804 | 3300025919 | Bacteria | 1229 |
| 364 | Ga0207649_10012497 | 3300025920 | Bacteria | 4714 |
| 365 | Ga0207649_11430612 | 3300025920 | Bacteria | 547 |
| 366 | Ga0207652_10018316 | 3300025921 | Bacteria | 5743 |
| 367 | Ga0207681_10247116 | 3300025923 | Bacteria | 1391 |
| 368 | Ga0207681_10261038 | 3300025923 | Bacteria | 1356 |
| 369 | Ga0207681_10323972 | 3300025923 | Bacteria | 1226 |
| 370 | Ga0207681_10844281 | 3300025923 | Bacteria | 766 |
| 371 | Ga0207681_11103113 | 3300025923 | Bacteria | 666 |
| 372 | Ga0207650_10002829 | 3300025925 | Bacteria | 11981 |
| 373 | Ga0207650_10052505 | 3300025925 | Bacteria | 3020 |
| 374 | Ga0207650_10057904 | 3300025925 | Bacteria | 2883 |
| 375 | Ga0207650_10062055 | 3300025925 | Bacteria | 2792 |
| 376 | Ga0207650_10077427 | 3300025925 | Bacteria | 2514 |
| 377 | Ga0207650_10303053 | 3300025925 | Bacteria | 1305 |
| 378 | Ga0207650_10414595 | 3300025925 | Bacteria | 1117 |
| 379 | Ga0207650_11656771 | 3300025925 | Bacteria | 542 |
| 380 | Ga0207650_11908688 | 3300025925 | Bacteria | 502 |
| 381 | Ga0207659_11335390 | 3300025926 | Bacteria | 615 |
| 382 | Ga0207644_10010486 | 3300025931 | Bacteria | 6108 |
| 383 | Ga0207644_10213757 | 3300025931 | Bacteria | 1526 |
| 384 | Ga0207644_10247387 | 3300025931 | Bacteria | 1421 |
| 385 | Ga0207644_10257732 | 3300025931 | Bacteria | 1394 |
| 386 | Ga0207644_10363033 | 3300025931 | Bacteria | 1178 |
| 387 | Ga0207644_10838977 | 3300025931 | Unclassified | 769 |
| 388 | Ga0207690_10003583 | 3300025932 | Bacteria | 9247 |
| 389 | Ga0207690_10121607 | 3300025932 | Bacteria | 1897 |
| 390 | Ga0207690_10737211 | 3300025932 | Bacteria | 812 |
| 391 | Ga0207706_10132112 | 3300025933 | Bacteria | 2196 |
| 392 | Ga0207706_10207931 | 3300025933 | Bacteria | 1716 |
| 393 | Ga0207706_10764544 | 3300025933 | Bacteria | 822 |
| 394 | Ga0207686_10000863 | 3300025934 | Bacteria | 18417 |
| 395 | Ga0207686_10302380 | 3300025934 | Bacteria | 1188 |
| 396 | Ga0207686_10362798 | 3300025934 | Bacteria | 1094 |
| 397 | Ga0207686_11096882 | 3300025934 | Bacteria | 649 |
| 398 | Ga0207670_10593985 | 3300025936 | Bacteria | 908 |
| 399 | Ga0207669_10216620 | 3300025937 | Bacteria | 1402 |
| 400 | Ga0207669_10287032 | 3300025937 | Bacteria | 1244 |
| 401 | Ga0207704_10433361 | 3300025938 | Bacteria | 1045 |
| 402 | Ga0207691_10007955 | 3300025940 | Bacteria | 10200 |
| 403 | Ga0207691_10089266 | 3300025940 | Bacteria | 2764 |
| 404 | Ga0207691_10120619 | 3300025940 | Bacteria | 2324 |
| 405 | Ga0207691_10771262 | 3300025940 | Bacteria | 809 |
| 406 | Ga0207711_10110099 | 3300025941 | Bacteria | 2448 |
| 407 | Ga0207689_10239230 | 3300025942 | Bacteria | 1501 |
| 408 | Ga0207689_11465250 | 3300025942 | Bacteria | 571 |
| 409 | Ga0207661_10006150 | 3300025944 | Bacteria | 8484 |
| 410 | Ga0207661_10137810 | 3300025944 | Bacteria | 2097 |
| 411 | Ga0207661_10847201 | 3300025944 | Bacteria | 842 |
| 412 | Ga0207679_10000777 | 3300025945 | Bacteria | 20886 |
| 413 | Ga0207679_10033880 | 3300025945 | Bacteria | 3598 |
| 414 | Ga0207679_10363725 | 3300025945 | Bacteria | 1264 |
| 415 | Ga0207651_10013586 | 3300025960 | Bacteria | 4666 |
| 416 | Ga0207651_10023535 | 3300025960 | Bacteria | 3792 |
| 417 | Ga0207651_10112459 | 3300025960 | Bacteria | 2047 |
| 418 | Ga0207651_10165654 | 3300025960 | Bacteria | 1737 |
| 419 | Ga0207651_10169433 | 3300025960 | Bacteria | 1721 |
| 420 | Ga0207651_10305387 | 3300025960 | Bacteria | 1325 |
| 421 | Ga0207651_10686151 | 3300025960 | Bacteria | 901 |
| 422 | Ga0207651_10697672 | 3300025960 | Bacteria | 894 |
| 423 | Ga0207712_10003245 | 3300025961 | Bacteria | 10332 |
| 424 | Ga0207712_10131798 | 3300025961 | Bacteria | 1906 |
| 425 | Ga0207712_10272490 | 3300025961 | Bacteria | 1378 |
| 426 | Ga0207668_10142924 | 3300025972 | Bacteria | 1843 |
| 427 | Ga0207668_10570103 | 3300025972 | Bacteria | 983 |
| 428 | Ga0207668_10621375 | 3300025972 | Bacteria | 943 |
| 429 | Ga0207640_10238928 | 3300025981 | Bacteria | 1403 |
| 430 | Ga0207640_10396375 | 3300025981 | Bacteria | 1123 |
| 431 | Ga0207658_10224740 | 3300025986 | Bacteria | 1581 |
| 432 | Ga0207658_10429834 | 3300025986 | Bacteria | 1166 |
| 433 | Ga0207658_10453946 | 3300025986 | Bacteria | 1135 |
| 434 | Ga0207658_10616872 | 3300025986 | Bacteria | 975 |
| 435 | Ga0207677_10009244 | 3300026023 | Bacteria | 5537 |
| 436 | Ga0207677_10056668 | 3300026023 | Bacteria | 2686 |
| 437 | Ga0207677_10300722 | 3300026023 | Bacteria | 1325 |
| 438 | Ga0207677_11287624 | 3300026023 | Bacteria | 671 |
| 439 | Ga0207703_10101147 | 3300026035 | Bacteria | 2444 |
| 440 | Ga0207703_10225221 | 3300026035 | Bacteria | 1679 |
| 441 | Ga0207639_10048916 | 3300026041 | Bacteria | 3203 |
| 442 | Ga0207639_10100749 | 3300026041 | Bacteria | 2334 |
| 443 | Ga0207639_10932318 | 3300026041 | Bacteria | 812 |
| 444 | Ga0207639_11055454 | 3300026041 | Bacteria | 761 |
| 445 | Ga0207639_11145788 | 3300026041 | Bacteria | 730 |
| 446 | Ga0207639_11211482 | 3300026041 | Bacteria | 708 |
| 447 | Ga0207678_10242081 | 3300026067 | Bacteria | 1545 |
| 448 | Ga0207678_10878619 | 3300026067 | Bacteria | 792 |
| 449 | Ga0207708_10233885 | 3300026075 | Bacteria | 1476 |
| 450 | Ga0207708_11018375 | 3300026075 | Bacteria | 720 |
| 451 | Ga0207641_10001211 | 3300026088 | Bacteria | 25807 |
| 452 | Ga0207641_10019514 | 3300026088 | Bacteria | 5565 |
| 453 | Ga0207641_10390897 | 3300026088 | Unclassified | 1334 |
| 454 | Ga0207648_10003106 | 3300026089 | Bacteria | 17541 |
| 455 | Ga0207648_10135503 | 3300026089 | Bacteria | 2169 |
| 456 | Ga0207648_10258930 | 3300026089 | Bacteria | 1552 |
| 457 | Ga0207676_10227994 | 3300026095 | Bacteria | 1663 |
| 458 | Ga0207676_10355481 | 3300026095 | Bacteria | 1356 |
| 459 | Ga0207676_10480386 | 3300026095 | Bacteria | 1177 |
| 460 | Ga0207674_10003303 | 3300026116 | Bacteria | 19833 |
| 461 | Ga0207674_10117029 | 3300026116 | Bacteria | 2636 |
| 462 | Ga0207674_10212768 | 3300026116 | Bacteria | 1882 |
| 463 | Ga0207674_10286027 | 3300026116 | Bacteria | 1597 |
| 464 | Ga0207674_10488144 | 3300026116 | Bacteria | 1190 |
| 465 | Ga0207675_100011319 | 3300026118 | Bacteria | 8350 |
| 466 | Ga0207675_100034745 | 3300026118 | Bacteria | 4702 |
| 467 | Ga0207675_100083149 | 3300026118 | Bacteria | 3002 |
| 468 | Ga0207675_100136931 | 3300026118 | Bacteria | 2324 |
| 469 | Ga0207675_100247006 | 3300026118 | Bacteria | 1726 |
| 470 | Ga0207675_100390747 | 3300026118 | Bacteria | 1369 |
| 471 | Ga0207675_101502595 | 3300026118 | Bacteria | 694 |
| 472 | Ga0207683_10020343 | 3300026121 | Bacteria | 5674 |
| 473 | Ga0207683_10052752 | 3300026121 | Bacteria | 3564 |
| 474 | Ga0207683_10243714 | 3300026121 | Bacteria | 1640 |
| 475 | Ga0207683_10324679 | 3300026121 | Unclassified | 1410 |
| 476 | Ga0207683_11561917 | 3300026121 | Bacteria | 609 |
| 477 | Ga0207698_10083962 | 3300026142 | Bacteria | 2580 |
| 478 | Ga0207698_10808450 | 3300026142 | Bacteria | 940 |
| 479 | Ga0207698_11066675 | 3300026142 | Bacteria | 820 |
| 480 | Ga0207698_11349549 | 3300026142 | Unclassified | 728 |
| 481 | Ga0207698_11807489 | 3300026142 | Bacteria | 626 |
| 482 | Ga0209995_1014434 | 3300027471 | Bacteria | 1295 |
| 483 | Ga0209999_1096173 | 3300027543 | Bacteria | 575 |
| 484 | Ga0209983_1028476 | 3300027665 | Bacteria | 1185 |
| 485 | Ga0209974_10016908 | 3300027876 | Bacteria | 2421 |
| 486 | Ga0207428_10385848 | 3300027907 | Bacteria | 1027 |
| 487 | Ga0268266_10459686 | 3300028379 | Bacteria | 1211 |
| 488 | Ga0268264_10016695 | 3300028381 | Bacteria | 6010 |
| 489 | Ga0268264_10017783 | 3300028381 | Bacteria | 5819 |
| 490 | Ga0268264_10057876 | 3300028381 | Bacteria | 3243 |
| 491 | Ga0268264_10148290 | 3300028381 | Bacteria | 2100 |
| 492 | Ga0268264_11456281 | 3300028381 | Bacteria | 695 |
| 493 | Ga0307515_10000107 | 3300028794 | Bacteria | 197046 |
| 494 | Ga0307515_10542041 | 3300028794 | Bacteria | 773 |
| 495 | Ga0307513_10335612 | 3300031456 | Bacteria | 1264 |
| 496 | Ga0307513_11009219 | 3300031456 | Bacteria | 542 |
| 497 | Ga0307508_10003038 | 3300031616 | Bacteria | 17271 |
| 498 | Ga0307413_10219491 | 3300031824 | Bacteria | 1388 |
| 499 | Ga0307413_11341476 | 3300031824 | Bacteria | 627 |
| 500 | Ga0307410_10037090 | 3300031852 | Bacteria | 3181 |
| 501 | Ga0307410_10770696 | 3300031852 | Bacteria | 816 |
| 502 | Ga0307406_10261768 | 3300031901 | Bacteria | 1309 |
| 503 | Ga0307406_10308655 | 3300031901 | Bacteria | 1219 |
| 504 | Ga0307407_10997343 | 3300031903 | Unclassified | 647 |
| 505 | Ga0307412_10105983 | 3300031911 | Bacteria | 1998 |
| 506 | Ga0307412_10410821 | 3300031911 | Bacteria | 1105 |
| 507 | Ga0307416_100422092 | 3300032002 | Bacteria | 1378 |
| 508 | Ga0307416_101860172 | 3300032002 | Bacteria | 706 |
| 509 | Ga0307414_10264235 | 3300032004 | Bacteria | 1438 |
| 510 | Ga0307414_10264994 | 3300032004 | Bacteria | 1436 |
| 511 | Ga0307414_10407248 | 3300032004 | Bacteria | 1183 |
| 512 | Ga0307414_10578044 | 3300032004 | Bacteria | 1005 |
| 513 | Ga0307411_10217493 | 3300032005 | Bacteria | 1480 |
| 514 | Ga0307415_100745818 | 3300032126 | Bacteria | 888 |
| 515 | Ga0307415_101605608 | 3300032126 | Unclassified | 625 |
| 516 | Ga0316592_1055522 | 3300033524 | Unclassified | 886 |
| 517 | Ga0373923_0269620 | 3300035111 | Bacteria | 800 |
| 518 | Ga0373943_0285807 | 3300035170 | Bacteria | 934 |
| 519 | Ga0373946_0047656 | 3300035171 | Bacteria | 1781 |
| 520 | Ga0316574_0581976 | 3300035398 | Unclassified | 693 |
| 521 | Ga0373937_0420990 | 3300036401 | Bacteria | 1268 |
| 522 | Ga0373937_0597281 | 3300036401 | Bacteria | 1048 |
| 523 | Ga0395899_0443656 | 3300037312 | Bacteria | 851 |
| 524 | Ga0395900_0079402 | 3300037418 | Bacteria | 3372 |
| 525 | Ga0395900_0430316 | 3300037418 | Bacteria | 1279 |
| 526 | Ga0395900_0965694 | 3300037418 | Bacteria | 773 |
| 527 | Ga0395898_0081787 | 3300037466 | Bacteria | 3114 |
| 528 | Ga0395898_0194299 | 3300037466 | Bacteria | 1939 |
| 529 | Ga0395905_0001345 | 3300037471 | Bacteria | 29943 |
| 530 | Ga0395905_0037653 | 3300037471 | Bacteria | 4540 |
| 531 | Ga0395905_0647072 | 3300037471 | Bacteria | 959 |
| 532 | Ga0395901_0183308 | 3300038443 | Bacteria | 2196 |
| 533 | Ga0395901_1211781 | 3300038443 | Bacteria | 720 |
| 534 | Ga0436365_0430263 | 3300039437 | Bacteria | 1592 |
| 535 | Ga0436365_1637134 | 3300039437 | Bacteria | 28226 |
| 536 | Ga0436362_0581654 | 3300039453 | Bacteria | 1075 |
| 537 | Ga0439439_0197426 | 3300041406 | Bacteria | 584 |
| 538 | Ga0439465_0053797 | 3300041413 | Bacteria | 1323 |
| 539 | Ga0439465_0212242 | 3300041413 | Bacteria | 708 |
| 540 | Ga0451802_1114912 | 3300041460 | Bacteria | 683 |
| 541 | Ga0439431_0001403 | 3300041997 | Bacteria | 5316 |
| 542 | Ga0439431_0027658 | 3300041997 | Bacteria | 1394 |
| 543 | Ga0439445_0092823 | 3300042004 | Bacteria | 851 |
| 544 | Ga0439449_0005016 | 3300042007 | Bacteria | 5092 |
| 545 | Ga0439452_091255 | 3300042010 | Bacteria | 658 |
| 546 | Ga0439457_011115 | 3300042014 | Bacteria | 2055 |
| 547 | Ga0450923_011615 | 3300042125 | Bacteria | 1587 |
| 548 | Ga0450897_002854 | 3300042128 | Bacteria | 1338 |
| 549 | Ga0450894_011226 | 3300042131 | Bacteria | 1165 |
| 550 | Ga0450894_062496 | 3300042131 | Bacteria | 562 |
| 551 | Ga0450895_019461 | 3300042132 | Bacteria | 624 |
| 552 | Ga0450898_003372 | 3300042134 | Bacteria | 2293 |
| 553 | Ga0450899_001053 | 3300042135 | Bacteria | 3129 |
| 554 | Ga0439434_0257936 | 3300042435 | Bacteria | 597 |
| 555 | Ga0451577_0039713 | 3300042876 | Bacteria | 4229 |
| 556 | Ga0451577_0050025 | 3300042876 | Bacteria | 3731 |
| 557 | Ga0451577_0147383 | 3300042876 | Bacteria | 2117 |
| 558 | Ga0453684_0021943 | 3300044712 | Bacteria | 9502 |
| 559 | Ga0453684_0047019 | 3300044712 | Bacteria | 5729 |
| 560 | Ga0453684_0072019 | 3300044712 | Bacteria | 4365 |
| 561 | Ga0466970_0477166 | 3300044765 | Bacteria | 717 |
| 562 | Ga0466959_0047185 | 3300045049 | Bacteria | 3169 |
| 563 | Ga0451576_0714991 | 3300045051 | Bacteria | 1052 |
| 564 | Ga0451576_1311102 | 3300045051 | Unclassified | 755 |
| 565 | Ga0466967_0403282 | 3300045976 | Bacteria | 1331 |
| 566 | Ga0495629_0075510 | 3300046459 | Bacteria | 2354 |
| 567 | Ga0495594_0084891 | 3300046499 | Bacteria | 1771 |
| 568 | Ga0495663_0024713 | 3300046525 | Bacteria | 1748 |
| 569 | Ga0495652_0479586 | 3300046529 | Bacteria | 866 |
| 570 | Ga0495598_0146920 | 3300046537 | Bacteria | 820 |
| 571 | Ga0495598_0163267 | 3300046537 | Unclassified | 785 |
| 572 | Ga0495621_0052447 | 3300046539 | Bacteria | 1462 |
| 573 | Ga0495656_0331411 | 3300046615 | Bacteria | 786 |
| 574 | Ga0495625_0049951 | 3300046660 | Bacteria | 3004 |
| 575 | Ga0495647_0181544 | 3300046681 | Bacteria | 916 |
| 576 | Ga0495670_0042608 | 3300046691 | Bacteria | 2265 |
| 577 | Ga0495649_0213035 | 3300046694 | Bacteria | 1001 |
| 578 | Ga0495672_0082899 | 3300047320 | Bacteria | 1782 |
| 579 | Ga0495615_0015991 | 3300048090 | Bacteria | 1612 |
| 580 | Ga0496114_0197382 | 3300048917 | Bacteria | 1762 |
| 581 | Ga0501306_062139 | 3300049127 | Bacteria | 617 |
| 582 | Ga0501309_009493 | 3300049129 | Bacteria | 1242 |
| 583 | Ga0501309_072973 | 3300049129 | Bacteria | 566 |
| 584 | Ga0501309_083319 | 3300049129 | Bacteria | 538 |
| 585 | Ga0501309_085695 | 3300049129 | Bacteria | 533 |
| 586 | Ga0501305_011154 | 3300049161 | Bacteria | 1210 |
| 587 | Ga0501305_065677 | 3300049161 | Bacteria | 631 |
| 588 | Ga0501307_005180 | 3300049162 | Bacteria | 1365 |
| 589 | Ga0501307_007686 | 3300049162 | Bacteria | 1194 |
| 590 | Ga0501307_012219 | 3300049162 | Bacteria | 1019 |
| 591 | Ga0501342_03950 | 3300049163 | Bacteria | 536 |
| 592 | Ga0501292_033515 | 3300049515 | Bacteria | 870 |
| 593 | Ga0501296_010317 | 3300049519 | Bacteria | 1106 |
| 594 | Ga0501298_002358 | 3300049521 | Bacteria | 2851 |
| 595 | Ga0501299_045504 | 3300049522 | Unclassified | 893 |
| 596 | Ga0501311_007156 | 3300049527 | Bacteria | 1279 |
| 597 | Ga0501311_030577 | 3300049527 | Bacteria | 778 |
| 598 | Ga0501312_013093 | 3300049528 | Bacteria | 1149 |
| 599 | Ga0501313_008796 | 3300049529 | Bacteria | 1130 |
| 600 | Ga0501313_012655 | 3300049529 | Bacteria | 985 |
| 601 | Ga0501313_029005 | 3300049529 | Bacteria | 712 |
| 602 | Ga0501314_029912 | 3300049530 | Bacteria | 601 |
| 603 | Ga0501315_008641 | 3300049531 | Bacteria | 1188 |
| 604 | Ga0501315_009328 | 3300049531 | Bacteria | 1158 |
| 605 | Ga0501315_016198 | 3300049531 | Bacteria | 963 |
| 606 | Ga0501315_017676 | 3300049531 | Bacteria | 934 |
| 607 | Ga0501315_085496 | 3300049531 | Bacteria | 541 |
| 608 | Ga0501316_005577 | 3300049532 | Bacteria | 1310 |
| 609 | Ga0501316_009012 | 3300049532 | Bacteria | 1112 |
| 610 | Ga0501316_011551 | 3300049532 | Bacteria | 1020 |
| 611 | Ga0501316_039908 | 3300049532 | Bacteria | 652 |
| 612 | Ga0501317_054896 | 3300049533 | Bacteria | 641 |
| 613 | Ga0501323_008601 | 3300049539 | Bacteria | 1188 |
| 614 | Ga0501323_008879 | 3300049539 | Bacteria | 1175 |
| 615 | Ga0501325_009730 | 3300049541 | Bacteria | 859 |
| 616 | Ga0501330_016179 | 3300049546 | Bacteria | 572 |
| 617 | Ga0501333_005926 | 3300049549 | Bacteria | 802 |
| 618 | Ga0501335_005974 | 3300049551 | Bacteria | 1098 |
| 619 | Ga0501335_006644 | 3300049551 | Bacteria | 1058 |
| 620 | Ga0501335_009232 | 3300049551 | Bacteria | 938 |
| 621 | Ga0501336_006843 | 3300049552 | Bacteria | 854 |
| 622 | Ga0501033_0162329 | 3300049570 | Unclassified | 1608 |
| 623 | Ga0501034_0008676 | 3300049571 | Bacteria | 10710 |
| 624 | Ga0501034_0144438 | 3300049571 | Bacteria | 2357 |
| 625 | Ga0501038_0908087 | 3300049574 | Bacteria | 650 |
| 626 | Ga0501039_0969830 | 3300049575 | Bacteria | 661 |
| 627 | Ga0501043_0058310 | 3300049579 | Bacteria | 3031 |
| 628 | Ga0501070_0757822 | 3300049586 | Bacteria | 765 |
| 629 | Ga0501198_001163 | 3300049649 | Bacteria | 3372 |
| 630 | Ga0501201_034416 | 3300049651 | Bacteria | 589 |
| 631 | Ga0501202_009450 | 3300049652 | Bacteria | 1793 |
| 632 | Ga0501202_032440 | 3300049652 | Bacteria | 1096 |
| 633 | Ga0501206_002023 | 3300049653 | Bacteria | 2558 |
| 634 | Ga0501207_063747 | 3300049654 | Bacteria | 680 |
| 635 | Ga0501207_142814 | 3300049654 | Bacteria | 511 |
| 636 | Ga0501209_086777 | 3300049656 | Bacteria | 907 |
| 637 | Ga0501217_000031 | 3300049661 | Bacteria | 15253 |
| 638 | Ga0501217_011991 | 3300049661 | Bacteria | 1925 |
| 639 | Ga0501217_145278 | 3300049661 | Bacteria | 705 |
| 640 | Ga0501223_004205 | 3300049663 | Bacteria | 3101 |
| 641 | Ga0501223_125109 | 3300049663 | Bacteria | 545 |
| 642 | Ga0501224_013830 | 3300049664 | Bacteria | 1192 |
| 643 | Ga0501227_079921 | 3300049665 | Bacteria | 856 |
| 644 | Ga0501240_013770 | 3300049673 | Bacteria | 1127 |
| 645 | Ga0501240_038286 | 3300049673 | Bacteria | 790 |
| 646 | Ga0501242_006955 | 3300049674 | Bacteria | 1298 |
| 647 | Ga0501243_001794 | 3300049675 | Bacteria | 3107 |
| 648 | Ga0501243_086756 | 3300049675 | Bacteria | 616 |
| 649 | Ga0501252_003521 | 3300049682 | Bacteria | 1618 |
| 650 | Ga0501252_045311 | 3300049682 | Unclassified | 650 |
| 651 | Ga0501257_007538 | 3300049686 | Bacteria | 2431 |
| 652 | Ga0501259_030282 | 3300049688 | Unclassified | 1017 |
| 653 | Ga0501259_037766 | 3300049688 | Bacteria | 938 |
| 654 | Ga0501261_002234 | 3300049690 | Bacteria | 2377 |
| 655 | Ga0501261_048851 | 3300049690 | Unclassified | 688 |
| 656 | Ga0501221_000508 | 3300049704 | Bacteria | 6138 |
| 657 | Ga0501221_044974 | 3300049704 | Bacteria | 977 |
| 658 | Ga0501225_0022573 | 3300049705 | Bacteria | 1737 |
| 659 | Ga0501225_0030890 | 3300049705 | Bacteria | 1474 |
| 660 | Ga0501234_018179 | 3300049707 | Bacteria | 1112 |
| 661 | Ga0501234_031464 | 3300049707 | Bacteria | 858 |
| 662 | Ga0501245_007144 | 3300049708 | Bacteria | 1575 |
| 663 | Ga0501245_034476 | 3300049708 | Bacteria | 849 |
| 664 | Ga0501265_041518 | 3300049762 | Bacteria | 697 |
| 665 | Ga0501266_000514 | 3300049763 | Bacteria | 5125 |
| 666 | Ga0501272_020900 | 3300049769 | Bacteria | 786 |
| 667 | Ga0501272_032026 | 3300049769 | Bacteria | 672 |
| 668 | Ga0501035_0151808 | 3300049822 | Bacteria | 2010 |
| 669 | Ga0501044_0079878 | 3300049823 | Bacteria | 3313 |
| 670 | Ga0501044_0452746 | 3300049823 | Unclassified | 1190 |
| 671 | Ga0501044_0457812 | 3300049823 | Bacteria | 1181 |
| 672 | nmdc:mga07m45_155622_c1 | 3300050496 | Bacteria | 1326 |
| 673 | nmdc:mga09592_416206_c1 | 3300050508 | Bacteria | 1161 |
| 674 | nmdc:mga08y16_318686_c1 | 3300050511 | Bacteria | 1601 |
| 675 | Ga0500646_0005972 | 3300053090 | Bacteria | 3089 |
| 676 | Ga0500646_0010977 | 3300053090 | Bacteria | 2327 |
| 677 | Ga0500658_0005944 | 3300053134 | Bacteria | 4539 |
| 678 | Ga0500588_0011805 | 3300053146 | Bacteria | 2149 |
| 679 | Ga0587073_0056738 | 3300059492 | Bacteria | 905 |
| 680 | Ga0587090_128716 | 3300059510 | Unclassified | 556 |
| 681 | Ga0587079_007677 | 3300059647 | Bacteria | 1622 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005293 | Ga0065715_10151075 | Ga0065715_101510752 | 119 |
| 2 | 3300005333 | Ga0070677_10013175 | Ga0070677_100131753 | 119 |
| 3 | 3300005347 | Ga0070668_100175198 | Ga0070668_1001751983 | 119 |
| 4 | 3300005354 | Ga0070675_100027766 | Ga0070675_1000277661 | 119 |
| 5 | 3300005356 | Ga0070674_100158733 | Ga0070674_1001587333 | 119 |
| 6 | 3300005364 | Ga0070673_101063981 | Ga0070673_1010639812 | 119 |
| 7 | 3300005459 | Ga0068867_100109447 | Ga0068867_1001094472 | 119 |
| 8 | 3300005543 | Ga0070672_100030162 | Ga0070672_1000301623 | 119 |
| 9 | 3300005618 | Ga0068864_100384987 | Ga0068864_1003849871 | 119 |
| 10 | 3300005719 | Ga0068861_100109099 | Ga0068861_1001090993 | 119 |
| 11 | 3300005840 | Ga0068870_10093875 | Ga0068870_100938752 | 119 |
| 12 | 3300013308 | Ga0157375_10872534 | Ga0157375_108725342 | 119 |
| 13 | 3300014326 | Ga0157380_10908337 | Ga0157380_109083372 | 119 |
| 14 | 3300025925 | Ga0207650_10414595 | Ga0207650_104145951 | 119 |
| 15 | 3300005355 | Ga0070671_100705004 | Ga0070671_1007050042 | 123 |
| 16 | 3300006237 | Ga0097621_100061486 | Ga0097621_1000614864 | 123 |
| 17 | 3300006358 | Ga0068871_100341845 | Ga0068871_1003418454 | 123 |
| 18 | 3300013297 | Ga0157378_10290041 | Ga0157378_102900413 | 123 |
| 19 | 3300025931 | Ga0207644_10257732 | Ga0207644_102577323 | 123 |
| 20 | 3300026121 | Ga0207683_10243714 | Ga0207683_102437143 | 123 |
| 21 | 3300049708 | Ga0501245_007144 | Ga0501245_007144_490_909 | 127 |
| 22 | 3300005436 | Ga0070713_102208574 | Ga0070713_1022085741 | 133 |
| 23 | 3300049531 | Ga0501315_017676 | Ga0501315_017676_313_726 | 133 |
| 24 | 3300025932 | Ga0207690_10737211 | Ga0207690_107372112 | 134 |
| 25 | 3300005290 | Ga0065712_10022972 | Ga0065712_100229722 | 135 |
| 26 | 3300005330 | Ga0070690_100147837 | Ga0070690_1001478371 | 135 |
| 27 | 3300005340 | Ga0070689_100728765 | Ga0070689_1007287651 | 135 |
| 28 | 3300005343 | Ga0070687_100060322 | Ga0070687_1000603222 | 135 |
| 29 | 3300005345 | Ga0070692_10152686 | Ga0070692_101526861 | 135 |
| 30 | 3300005364 | Ga0070673_101037251 | Ga0070673_1010372511 | 135 |
| 31 | 3300005365 | Ga0070688_100411196 | Ga0070688_1004111962 | 135 |
| 32 | 3300005466 | Ga0070685_10240624 | Ga0070685_102406243 | 135 |
| 33 | 3300005544 | Ga0070686_100041373 | Ga0070686_1000413731 | 135 |
| 34 | 3300005616 | Ga0068852_100209319 | Ga0068852_1002093191 | 135 |
| 35 | 3300005719 | Ga0068861_101774520 | Ga0068861_1017745201 | 135 |
| 36 | 3300005834 | Ga0068851_10171215 | Ga0068851_101712153 | 135 |
| 37 | 3300005841 | Ga0068863_100702162 | Ga0068863_1007021622 | 135 |
| 38 | 3300005842 | Ga0068858_100218978 | Ga0068858_1002189782 | 135 |
| 39 | 3300006237 | Ga0097621_100255991 | Ga0097621_1002559913 | 135 |
| 40 | 3300006358 | Ga0068871_100093920 | Ga0068871_1000939203 | 135 |
| 41 | 3300006844 | Ga0075428_100928658 | Ga0075428_1009286582 | 135 |
| 42 | 3300009177 | Ga0105248_10153330 | Ga0105248_101533303 | 135 |
| 43 | 3300009551 | Ga0105238_10409263 | Ga0105238_104092633 | 135 |
| 44 | 3300009553 | Ga0105249_11521844 | Ga0105249_115218441 | 135 |
| 45 | 3300013306 | Ga0163162_10061543 | Ga0163162_100615434 | 135 |
| 46 | 3300013306 | Ga0163162_10554883 | Ga0163162_105548833 | 135 |
| 47 | 3300013308 | Ga0157375_10376446 | Ga0157375_103764462 | 135 |
| 48 | 3300014325 | Ga0163163_12588917 | Ga0163163_125889171 | 135 |
| 49 | 3300014968 | Ga0157379_10258653 | Ga0157379_102586533 | 135 |
| 50 | 3300025321 | Ga0207656_10044821 | Ga0207656_100448212 | 135 |
| 51 | 3300025934 | Ga0207686_10000863 | Ga0207686_1000086319 | 135 |
| 52 | 3300025941 | Ga0207711_10110099 | Ga0207711_101100993 | 135 |
| 53 | 3300025961 | Ga0207712_10131798 | Ga0207712_101317983 | 135 |
| 54 | 3300026088 | Ga0207641_10001211 | Ga0207641_1000121123 | 135 |
| 55 | 3300026095 | Ga0207676_10227994 | Ga0207676_102279943 | 135 |
| 56 | 3300026118 | Ga0207675_100034745 | Ga0207675_1000347455 | 135 |
| 57 | 3300046459 | Ga0495629_0075510 | Ga0495629_0075510_865_1311 | 135 |
| 58 | 3300046499 | Ga0495594_0084891 | Ga0495594_0084891_1107_1553 | 135 |
| 59 | 3300046681 | Ga0495647_0181544 | Ga0495647_0181544_249_695 | 135 |
| 60 | 3300046694 | Ga0495649_0213035 | Ga0495649_0213035_202_648 | 135 |
| 61 | 3300014969 | Ga0157376_10597794 | Ga0157376_105977942 | 136 |
| 62 | 3300025903 | Ga0207680_11280208 | Ga0207680_112802081 | 136 |
| 63 | 3300046660 | Ga0495625_0049951 | Ga0495625_0049951_543_989 | 136 |
| 64 | 3300053146 | Ga0500588_0011805 | Ga0500588_0011805_248_694 | 136 |
| 65 | 3300006163 | Ga0070715_10346453 | Ga0070715_103464531 | 137 |
| 66 | 3300050496 | nmdc:mga07m45_155622_c1 | nmdc:mga07m45_155622_c1_308_754 | 137 |
| 67 | 3300014969 | Ga0157376_10305732 | Ga0157376_103057322 | 138 |
| 68 | 3300031616 | Ga0307508_10003038 | Ga0307508_100030382 | 138 |
| 69 | 3300005328 | Ga0070676_10225049 | Ga0070676_102250492 | 139 |
| 70 | 3300005330 | Ga0070690_100228537 | Ga0070690_1002285372 | 139 |
| 71 | 3300005331 | Ga0070670_101002631 | Ga0070670_1010026311 | 139 |
| 72 | 3300005333 | Ga0070677_10018611 | Ga0070677_100186111 | 139 |
| 73 | 3300005335 | Ga0070666_10078433 | Ga0070666_100784334 | 139 |
| 74 | 3300005337 | Ga0070682_100706508 | Ga0070682_1007065081 | 139 |
| 75 | 3300005338 | Ga0068868_100070716 | Ga0068868_1000707164 | 139 |
| 76 | 3300005343 | Ga0070687_100000838 | Ga0070687_1000008389 | 139 |
| 77 | 3300005347 | Ga0070668_100483661 | Ga0070668_1004836612 | 139 |
| 78 | 3300005353 | Ga0070669_100238876 | Ga0070669_1002388762 | 139 |
| 79 | 3300005353 | Ga0070669_100726853 | Ga0070669_1007268531 | 139 |
| 80 | 3300005355 | Ga0070671_100018271 | Ga0070671_1000182714 | 139 |
| 81 | 3300005356 | Ga0070674_100056100 | Ga0070674_1000561004 | 139 |
| 82 | 3300005364 | Ga0070673_100005284 | Ga0070673_1000052843 | 139 |
| 83 | 3300005364 | Ga0070673_101832253 | Ga0070673_1018322531 | 139 |
| 84 | 3300005365 | Ga0070688_100273415 | Ga0070688_1002734152 | 139 |
| 85 | 3300005366 | Ga0070659_100664506 | Ga0070659_1006645061 | 139 |
| 86 | 3300005367 | Ga0070667_100255773 | Ga0070667_1002557734 | 139 |
| 87 | 3300005455 | Ga0070663_100189737 | Ga0070663_1001897374 | 139 |
| 88 | 3300005456 | Ga0070678_100058471 | Ga0070678_1000584714 | 139 |
| 89 | 3300005457 | Ga0070662_100169463 | Ga0070662_1001694631 | 139 |
| 90 | 3300005459 | Ga0068867_100077692 | Ga0068867_1000776922 | 139 |
| 91 | 3300005459 | Ga0068867_100508756 | Ga0068867_1005087562 | 139 |
| 92 | 3300005543 | Ga0070672_100083790 | Ga0070672_1000837902 | 139 |
| 93 | 3300005543 | Ga0070672_100135692 | Ga0070672_1001356925 | 139 |
| 94 | 3300005544 | Ga0070686_100037699 | Ga0070686_1000376994 | 139 |
| 95 | 3300005564 | Ga0070664_100003013 | Ga0070664_1000030132 | 139 |
| 96 | 3300005615 | Ga0070702_100007150 | Ga0070702_1000071504 | 139 |
| 97 | 3300005616 | Ga0068852_100079407 | Ga0068852_1000794073 | 139 |
| 98 | 3300005617 | Ga0068859_100135963 | Ga0068859_1001359632 | 139 |
| 99 | 3300005618 | Ga0068864_100222731 | Ga0068864_1002227313 | 139 |
| 100 | 3300005618 | Ga0068864_100842891 | Ga0068864_1008428912 | 139 |
| 101 | 3300005840 | Ga0068870_10206300 | Ga0068870_102063002 | 139 |
| 102 | 3300005842 | Ga0068858_100075507 | Ga0068858_1000755074 | 139 |
| 103 | 3300005843 | Ga0068860_100288538 | Ga0068860_1002885382 | 139 |
| 104 | 3300006358 | Ga0068871_100276881 | Ga0068871_1002768813 | 139 |
| 105 | 3300006880 | Ga0075429_100441428 | Ga0075429_1004414282 | 139 |
| 106 | 3300006931 | Ga0097620_100135965 | Ga0097620_1001359652 | 139 |
| 107 | 3300009094 | Ga0111539_10718755 | Ga0111539_107187552 | 139 |
| 108 | 3300009148 | Ga0105243_10398155 | Ga0105243_103981553 | 139 |
| 109 | 3300009176 | Ga0105242_10576529 | Ga0105242_105765292 | 139 |
| 110 | 3300011119 | Ga0105246_11103996 | Ga0105246_111039961 | 139 |
| 111 | 3300013296 | Ga0157374_10418726 | Ga0157374_104187263 | 139 |
| 112 | 3300013297 | Ga0157378_10000709 | Ga0157378_1000070911 | 139 |
| 113 | 3300013306 | Ga0163162_10220927 | Ga0163162_102209272 | 139 |
| 114 | 3300013306 | Ga0163162_10284284 | Ga0163162_102842844 | 139 |
| 115 | 3300013306 | Ga0163162_10579720 | Ga0163162_105797203 | 139 |
| 116 | 3300013308 | Ga0157375_10029892 | Ga0157375_100298926 | 139 |
| 117 | 3300014326 | Ga0157380_10257186 | Ga0157380_102571862 | 139 |
| 118 | 3300014745 | Ga0157377_10202564 | Ga0157377_102025642 | 139 |
| 119 | 3300014968 | Ga0157379_10209045 | Ga0157379_102090453 | 139 |
| 120 | 3300014969 | Ga0157376_10102537 | Ga0157376_101025375 | 139 |
| 121 | 3300025321 | Ga0207656_10236554 | Ga0207656_102365542 | 139 |
| 122 | 3300025893 | Ga0207682_10240664 | Ga0207682_102406642 | 139 |
| 123 | 3300025901 | Ga0207688_10022908 | Ga0207688_100229084 | 139 |
| 124 | 3300025903 | Ga0207680_10253374 | Ga0207680_102533742 | 139 |
| 125 | 3300025907 | Ga0207645_10024138 | Ga0207645_100241385 | 139 |
| 126 | 3300025918 | Ga0207662_10189665 | Ga0207662_101896653 | 139 |
| 127 | 3300025923 | Ga0207681_10323972 | Ga0207681_103239722 | 139 |
| 128 | 3300025925 | Ga0207650_11656771 | Ga0207650_116567711 | 139 |
| 129 | 3300025931 | Ga0207644_10010486 | Ga0207644_100104863 | 139 |
| 130 | 3300025933 | Ga0207706_10207931 | Ga0207706_102079313 | 139 |
| 131 | 3300025934 | Ga0207686_10302380 | Ga0207686_103023802 | 139 |
| 132 | 3300025937 | Ga0207669_10287032 | Ga0207669_102870322 | 139 |
| 133 | 3300025940 | Ga0207691_10007955 | Ga0207691_100079555 | 139 |
| 134 | 3300025940 | Ga0207691_10120619 | Ga0207691_101206193 | 139 |
| 135 | 3300025945 | Ga0207679_10033880 | Ga0207679_100338802 | 139 |
| 136 | 3300025960 | Ga0207651_10305387 | Ga0207651_103053872 | 139 |
| 137 | 3300025972 | Ga0207668_10621375 | Ga0207668_106213752 | 139 |
| 138 | 3300025981 | Ga0207640_10238928 | Ga0207640_102389282 | 139 |
| 139 | 3300025986 | Ga0207658_10429834 | Ga0207658_104298341 | 139 |
| 140 | 3300026023 | Ga0207677_10056668 | Ga0207677_100566684 | 139 |
| 141 | 3300026035 | Ga0207703_10101147 | Ga0207703_101011472 | 139 |
| 142 | 3300026067 | Ga0207678_10242081 | Ga0207678_102420812 | 139 |
| 143 | 3300026089 | Ga0207648_10135503 | Ga0207648_101355033 | 139 |
| 144 | 3300026095 | Ga0207676_10355481 | Ga0207676_103554812 | 139 |
| 145 | 3300026118 | Ga0207675_100136931 | Ga0207675_1001369312 | 139 |
| 146 | 3300026121 | Ga0207683_10020343 | Ga0207683_100203435 | 139 |
| 147 | 3300026121 | Ga0207683_10052752 | Ga0207683_100527524 | 139 |
| 148 | 3300026142 | Ga0207698_10808450 | Ga0207698_108084501 | 139 |
| 149 | 3300027907 | Ga0207428_10385848 | Ga0207428_103858482 | 139 |
| 150 | 3300028381 | Ga0268264_11456281 | Ga0268264_114562811 | 139 |
| 151 | 3300031456 | Ga0307513_10335612 | Ga0307513_103356122 | 139 |
| 152 | 3300048917 | Ga0496114_0197382 | Ga0496114_0197382_593_1039 | 139 |
| 153 | 3300050508 | nmdc:mga09592_416206_c1 | nmdc:mga09592_416206_c1_676_1122 | 139 |
| 154 | 3300050511 | nmdc:mga08y16_318686_c1 | nmdc:mga08y16_318686_c1_437_883 | 139 |
| 155 | 3300005288 | Ga0065714_10134545 | Ga0065714_101345451 | 140 |
| 156 | 3300005616 | Ga0068852_100571807 | Ga0068852_1005718071 | 140 |
| 157 | 3300005834 | Ga0068851_10000072 | Ga0068851_100000729 | 140 |
| 158 | 3300009545 | Ga0105237_10663394 | Ga0105237_106633943 | 140 |
| 159 | 3300013297 | Ga0157378_10761286 | Ga0157378_107612861 | 140 |
| 160 | 3300013307 | Ga0157372_10757105 | Ga0157372_107571051 | 140 |
| 161 | 3300025321 | Ga0207656_10000716 | Ga0207656_100007169 | 140 |
| 162 | 3300026142 | Ga0207698_11349549 | Ga0207698_113495491 | 140 |
| 163 | 3300053134 | Ga0500658_0005944 | Ga0500658_0005944_2100_2522 | 140 |
| 164 | 3300005618 | Ga0068864_100268024 | Ga0068864_1002680242 | 141 |
| 165 | 3300025925 | Ga0207650_11908688 | Ga0207650_119086881 | 141 |
| 166 | 3300046529 | Ga0495652_0479586 | Ga0495652_0479586_106_552 | 141 |
| 167 | 3300002459 | JGI24751J29686_10000815 | JGI24751J29686_100008159 | 142 |
| 168 | 3300004803 | Ga0058862_12224181 | Ga0058862_122241812 | 142 |
| 169 | 3300005327 | Ga0070658_10126296 | Ga0070658_101262965 | 142 |
| 170 | 3300005331 | Ga0070670_100008929 | Ga0070670_1000089294 | 142 |
| 171 | 3300005336 | Ga0070680_100035348 | Ga0070680_1000353485 | 142 |
| 172 | 3300005337 | Ga0070682_100045350 | Ga0070682_1000453505 | 142 |
| 173 | 3300005339 | Ga0070660_100020101 | Ga0070660_1000201016 | 142 |
| 174 | 3300005436 | Ga0070713_101913483 | Ga0070713_1019134831 | 142 |
| 175 | 3300005458 | Ga0070681_10678192 | Ga0070681_106781922 | 142 |
| 176 | 3300005530 | Ga0070679_100108447 | Ga0070679_1001084472 | 142 |
| 177 | 3300005539 | Ga0068853_101012795 | Ga0068853_1010127951 | 142 |
| 178 | 3300005577 | Ga0068857_100774592 | Ga0068857_1007745922 | 142 |
| 179 | 3300005616 | Ga0068852_100033007 | Ga0068852_1000330073 | 142 |
| 180 | 3300009174 | Ga0105241_10440903 | Ga0105241_104409032 | 142 |
| 181 | 3300009553 | Ga0105249_10000762 | Ga0105249_1000076215 | 142 |
| 182 | 3300013102 | Ga0157371_10176316 | Ga0157371_101763162 | 142 |
| 183 | 3300013104 | Ga0157370_10424994 | Ga0157370_104249942 | 142 |
| 184 | 3300013105 | Ga0157369_10186796 | Ga0157369_101867961 | 142 |
| 185 | 3300014325 | Ga0163163_10121634 | Ga0163163_101216342 | 142 |
| 186 | 3300025909 | Ga0207705_10017945 | Ga0207705_100179454 | 142 |
| 187 | 3300025917 | Ga0207660_10110671 | Ga0207660_101106713 | 142 |
| 188 | 3300025919 | Ga0207657_10090557 | Ga0207657_100905573 | 142 |
| 189 | 3300025921 | Ga0207652_10018316 | Ga0207652_100183163 | 142 |
| 190 | 3300025925 | Ga0207650_10062055 | Ga0207650_100620552 | 142 |
| 191 | 3300025961 | Ga0207712_10003245 | Ga0207712_100032455 | 142 |
| 192 | 3300026041 | Ga0207639_11055454 | Ga0207639_110554542 | 142 |
| 193 | 3300026116 | Ga0207674_10286027 | Ga0207674_102860274 | 142 |
| 194 | 3300032004 | Ga0307414_10264235 | Ga0307414_102642352 | 142 |
| 195 | 3300049162 | Ga0501307_005180 | Ga0501307_005180_639_1085 | 142 |
| 196 | 3300053090 | Ga0500646_0010977 | Ga0500646_0010977_1317_1763 | 142 |
| 197 | 3300059647 | Ga0587079_007677 | Ga0587079_007677_29_475 | 142 |
| 198 | iso_pu_bacteria | 2883068021 | 2883073250 | 144 |
| 199 | iso_pu_bacteria | 2896085136 | 2896087353 | 144 |
| 200 | iso_pu_bacteria | 2896109856 | 2896114680 | 144 |
| 201 | iso_pu_bacteria | 2929154850 | 2929157760 | 144 |
| 202 | 3300049705 | Ga0501225_0030890 | Ga0501225_0030890_356_796 | 146 |
| 203 | 2162886011 | MRS1b_contig_3199889 | MRS1b_0148.00001430 | 148 |
| 204 | 3300001904 | JGI24736J21556_1008031 | JGI24736J21556_10080312 | 148 |
| 205 | 3300001979 | JGI24740J21852_10005418 | JGI24740J21852_100054186 | 148 |
| 206 | 3300002077 | JGI24744J21845_10007602 | JGI24744J21845_100076025 | 148 |
| 207 | 3300002738 | JGI25154J39366_1000020 | JGI25154J39366_100002058 | 148 |
| 208 | 3300002741 | JGI25157J39369_1007886 | JGI25157J39369_10078862 | 148 |
| 209 | 3300003215 | JGI25153J46596_10000449 | JGI25153J46596_1000044911 | 148 |
| 210 | 3300003320 | rootH2_10078683 | rootH2_100786832 | 148 |
| 211 | 3300003323 | rootH1_10083371 | rootH1_100833712 | 148 |
| 212 | 3300003354 | JGI25160J50197_1010153 | JGI25160J50197_10101534 | 148 |
| 213 | 3300003354 | JGI25160J50197_1016700 | JGI25160J50197_10167001 | 148 |
| 214 | 3300004801 | Ga0058860_11988454 | Ga0058860_119884543 | 148 |
| 215 | 3300005289 | Ga0065704_10084334 | Ga0065704_100843343 | 148 |
| 216 | 3300005289 | Ga0065704_10488012 | Ga0065704_104880121 | 148 |
| 217 | 3300005290 | Ga0065712_10034732 | Ga0065712_100347321 | 148 |
| 218 | 3300005290 | Ga0065712_10099081 | Ga0065712_100990811 | 148 |
| 219 | 3300005290 | Ga0065712_10256583 | Ga0065712_102565832 | 148 |
| 220 | 3300005293 | Ga0065715_10727538 | Ga0065715_107275381 | 148 |
| 221 | 3300005327 | Ga0070658_10004004 | Ga0070658_100040047 | 148 |
| 222 | 3300005327 | Ga0070658_10965419 | Ga0070658_109654191 | 148 |
| 223 | 3300005327 | Ga0070658_11784040 | Ga0070658_117840401 | 148 |
| 224 | 3300005328 | Ga0070676_10922198 | Ga0070676_109221981 | 148 |
| 225 | 3300005329 | Ga0070683_100014181 | Ga0070683_1000141818 | 148 |
| 226 | 3300005329 | Ga0070683_100163407 | Ga0070683_1001634071 | 148 |
| 227 | 3300005331 | Ga0070670_100050094 | Ga0070670_1000500944 | 148 |
| 228 | 3300005331 | Ga0070670_100159846 | Ga0070670_1001598463 | 148 |
| 229 | 3300005331 | Ga0070670_100201020 | Ga0070670_1002010201 | 148 |
| 230 | 3300005331 | Ga0070670_100210533 | Ga0070670_1002105331 | 148 |
| 231 | 3300005331 | Ga0070670_100361455 | Ga0070670_1003614553 | 148 |
| 232 | 3300005333 | Ga0070677_10147990 | Ga0070677_101479902 | 148 |
| 233 | 3300005334 | Ga0068869_100203298 | Ga0068869_1002032983 | 148 |
| 234 | 3300005334 | Ga0068869_100306661 | Ga0068869_1003066612 | 148 |
| 235 | 3300005337 | Ga0070682_100272240 | Ga0070682_1002722402 | 148 |
| 236 | 3300005337 | Ga0070682_101239500 | Ga0070682_1012395001 | 148 |
| 237 | 3300005337 | Ga0070682_101983165 | Ga0070682_1019831651 | 148 |
| 238 | 3300005338 | Ga0068868_100015105 | Ga0068868_1000151055 | 148 |
| 239 | 3300005338 | Ga0068868_100731513 | Ga0068868_1007315131 | 148 |
| 240 | 3300005338 | Ga0068868_100766407 | Ga0068868_1007664071 | 148 |
| 241 | 3300005339 | Ga0070660_100300871 | Ga0070660_1003008712 | 148 |
| 242 | 3300005340 | Ga0070689_101003995 | Ga0070689_1010039951 | 148 |
| 243 | 3300005343 | Ga0070687_100263472 | Ga0070687_1002634722 | 148 |
| 244 | 3300005343 | Ga0070687_100329096 | Ga0070687_1003290962 | 148 |
| 245 | 3300005344 | Ga0070661_100001685 | Ga0070661_10000168519 | 148 |
| 246 | 3300005344 | Ga0070661_100836437 | Ga0070661_1008364372 | 148 |
| 247 | 3300005347 | Ga0070668_100502734 | Ga0070668_1005027342 | 148 |
| 248 | 3300005347 | Ga0070668_101054744 | Ga0070668_1010547441 | 148 |
| 249 | 3300005353 | Ga0070669_100102445 | Ga0070669_1001024453 | 148 |
| 250 | 3300005353 | Ga0070669_100169255 | Ga0070669_1001692551 | 148 |
| 251 | 3300005353 | Ga0070669_100851268 | Ga0070669_1008512681 | 148 |
| 252 | 3300005353 | Ga0070669_101206687 | Ga0070669_1012066872 | 148 |
| 253 | 3300005354 | Ga0070675_100028796 | Ga0070675_1000287965 | 148 |
| 254 | 3300005354 | Ga0070675_100056542 | Ga0070675_1000565421 | 148 |
| 255 | 3300005354 | Ga0070675_100085424 | Ga0070675_1000854243 | 148 |
| 256 | 3300005354 | Ga0070675_100271152 | Ga0070675_1002711523 | 148 |
| 257 | 3300005355 | Ga0070671_100037415 | Ga0070671_1000374154 | 148 |
| 258 | 3300005355 | Ga0070671_100683194 | Ga0070671_1006831942 | 148 |
| 259 | 3300005356 | Ga0070674_100451798 | Ga0070674_1004517983 | 148 |
| 260 | 3300005356 | Ga0070674_100552663 | Ga0070674_1005526631 | 148 |
| 261 | 3300005364 | Ga0070673_100009831 | Ga0070673_1000098318 | 148 |
| 262 | 3300005364 | Ga0070673_100368076 | Ga0070673_1003680762 | 148 |
| 263 | 3300005364 | Ga0070673_100771204 | Ga0070673_1007712041 | 148 |
| 264 | 3300005364 | Ga0070673_100779839 | Ga0070673_1007798392 | 148 |
| 265 | 3300005364 | Ga0070673_100801352 | Ga0070673_1008013521 | 148 |
| 266 | 3300005364 | Ga0070673_101051482 | Ga0070673_1010514821 | 148 |
| 267 | 3300005365 | Ga0070688_100188862 | Ga0070688_1001888623 | 148 |
| 268 | 3300005365 | Ga0070688_100362755 | Ga0070688_1003627551 | 148 |
| 269 | 3300005366 | Ga0070659_100004313 | Ga0070659_1000043137 | 148 |
| 270 | 3300005366 | Ga0070659_100371785 | Ga0070659_1003717851 | 148 |
| 271 | 3300005367 | Ga0070667_100181821 | Ga0070667_1001818213 | 148 |
| 272 | 3300005367 | Ga0070667_100262152 | Ga0070667_1002621522 | 148 |
| 273 | 3300005367 | Ga0070667_100496072 | Ga0070667_1004960722 | 148 |
| 274 | 3300005436 | Ga0070713_100924860 | Ga0070713_1009248601 | 148 |
| 275 | 3300005456 | Ga0070678_100784343 | Ga0070678_1007843432 | 148 |
| 276 | 3300005456 | Ga0070678_100883314 | Ga0070678_1008833141 | 148 |
| 277 | 3300005457 | Ga0070662_100091601 | Ga0070662_1000916015 | 148 |
| 278 | 3300005458 | Ga0070681_10890796 | Ga0070681_108907961 | 148 |
| 279 | 3300005459 | Ga0068867_100822316 | Ga0068867_1008223162 | 148 |
| 280 | 3300005466 | Ga0070685_10242637 | Ga0070685_102426373 | 148 |
| 281 | 3300005466 | Ga0070685_10757421 | Ga0070685_107574211 | 148 |
| 282 | 3300005466 | Ga0070685_10828157 | Ga0070685_108281571 | 148 |
| 283 | 3300005535 | Ga0070684_100001962 | Ga0070684_1000019622 | 148 |
| 284 | 3300005535 | Ga0070684_100560678 | Ga0070684_1005606781 | 148 |
| 285 | 3300005535 | Ga0070684_101072079 | Ga0070684_1010720791 | 148 |
| 286 | 3300005539 | Ga0068853_100002136 | Ga0068853_1000021361 | 148 |
| 287 | 3300005539 | Ga0068853_100304146 | Ga0068853_1003041464 | 148 |
| 288 | 3300005539 | Ga0068853_101879087 | Ga0068853_1018790871 | 148 |
| 289 | 3300005543 | Ga0070672_100164454 | Ga0070672_1001644544 | 148 |
| 290 | 3300005543 | Ga0070672_100381934 | Ga0070672_1003819343 | 148 |
| 291 | 3300005543 | Ga0070672_100715087 | Ga0070672_1007150871 | 148 |
| 292 | 3300005548 | Ga0070665_100289365 | Ga0070665_1002893653 | 148 |
| 293 | 3300005548 | Ga0070665_100983163 | Ga0070665_1009831632 | 148 |
| 294 | 3300005548 | Ga0070665_101296901 | Ga0070665_1012969012 | 148 |
| 295 | 3300005549 | Ga0070704_100460810 | Ga0070704_1004608101 | 148 |
| 296 | 3300005549 | Ga0070704_100815904 | Ga0070704_1008159041 | 148 |
| 297 | 3300005563 | Ga0068855_101071243 | Ga0068855_1010712431 | 148 |
| 298 | 3300005563 | Ga0068855_101073201 | Ga0068855_1010732011 | 148 |
| 299 | 3300005564 | Ga0070664_100001137 | Ga0070664_1000011376 | 148 |
| 300 | 3300005564 | Ga0070664_100056457 | Ga0070664_1000564575 | 148 |
| 301 | 3300005564 | Ga0070664_102201636 | Ga0070664_1022016361 | 148 |
| 302 | 3300005577 | Ga0068857_100001716 | Ga0068857_10000171622 | 148 |
| 303 | 3300005577 | Ga0068857_100196354 | Ga0068857_1001963544 | 148 |
| 304 | 3300005577 | Ga0068857_100342736 | Ga0068857_1003427361 | 148 |
| 305 | 3300005577 | Ga0068857_102064063 | Ga0068857_1020640631 | 148 |
| 306 | 3300005578 | Ga0068854_100166429 | Ga0068854_1001664293 | 148 |
| 307 | 3300005578 | Ga0068854_100411413 | Ga0068854_1004114132 | 148 |
| 308 | 3300005614 | Ga0068856_100285973 | Ga0068856_1002859734 | 148 |
| 309 | 3300005614 | Ga0068856_100419678 | Ga0068856_1004196781 | 148 |
| 310 | 3300005615 | Ga0070702_100249024 | Ga0070702_1002490242 | 148 |
| 311 | 3300005616 | Ga0068852_100007485 | Ga0068852_1000074854 | 148 |
| 312 | 3300005616 | Ga0068852_100130404 | Ga0068852_1001304041 | 148 |
| 313 | 3300005616 | Ga0068852_100302890 | Ga0068852_1003028904 | 148 |
| 314 | 3300005616 | Ga0068852_101940801 | Ga0068852_1019408011 | 148 |
| 315 | 3300005617 | Ga0068859_100016441 | Ga0068859_1000164415 | 148 |
| 316 | 3300005617 | Ga0068859_100389313 | Ga0068859_1003893131 | 148 |
| 317 | 3300005617 | Ga0068859_100563242 | Ga0068859_1005632422 | 148 |
| 318 | 3300005617 | Ga0068859_101442173 | Ga0068859_1014421731 | 148 |
| 319 | 3300005617 | Ga0068859_101599148 | Ga0068859_1015991482 | 148 |
| 320 | 3300005617 | Ga0068859_102410511 | Ga0068859_1024105111 | 148 |
| 321 | 3300005618 | Ga0068864_100735807 | Ga0068864_1007358072 | 148 |
| 322 | 3300005618 | Ga0068864_100858915 | Ga0068864_1008589151 | 148 |
| 323 | 3300005718 | Ga0068866_10032849 | Ga0068866_100328493 | 148 |
| 324 | 3300005719 | Ga0068861_100100355 | Ga0068861_1001003554 | 148 |
| 325 | 3300005834 | Ga0068851_10076116 | Ga0068851_100761164 | 148 |
| 326 | 3300005834 | Ga0068851_10609589 | Ga0068851_106095891 | 148 |
| 327 | 3300005840 | Ga0068870_10101857 | Ga0068870_101018572 | 148 |
| 328 | 3300005840 | Ga0068870_10238087 | Ga0068870_102380872 | 148 |
| 329 | 3300005840 | Ga0068870_10315638 | Ga0068870_103156382 | 148 |
| 330 | 3300005841 | Ga0068863_100008733 | Ga0068863_1000087334 | 148 |
| 331 | 3300005841 | Ga0068863_100293521 | Ga0068863_1002935213 | 148 |
| 332 | 3300005842 | Ga0068858_100520807 | Ga0068858_1005208073 | 148 |
| 333 | 3300005843 | Ga0068860_100011727 | Ga0068860_1000117274 | 148 |
| 334 | 3300005843 | Ga0068860_100054837 | Ga0068860_1000548374 | 148 |
| 335 | 3300005843 | Ga0068860_100100474 | Ga0068860_1001004741 | 148 |
| 336 | 3300005843 | Ga0068860_100780097 | Ga0068860_1007800971 | 148 |
| 337 | 3300005844 | Ga0068862_100176021 | Ga0068862_1001760214 | 148 |
| 338 | 3300005844 | Ga0068862_100394910 | Ga0068862_1003949103 | 148 |
| 339 | 3300005844 | Ga0068862_101139270 | Ga0068862_1011392701 | 148 |
| 340 | 3300006028 | Ga0070717_10850484 | Ga0070717_108504842 | 148 |
| 341 | 3300006237 | Ga0097621_100008970 | Ga0097621_1000089703 | 148 |
| 342 | 3300006358 | Ga0068871_100561723 | Ga0068871_1005617232 | 148 |
| 343 | 3300006880 | Ga0075429_100535334 | Ga0075429_1005353341 | 148 |
| 344 | 3300006881 | Ga0068865_100291190 | Ga0068865_1002911901 | 148 |
| 345 | 3300006881 | Ga0068865_100309166 | Ga0068865_1003091662 | 148 |
| 346 | 3300006881 | Ga0068865_100491570 | Ga0068865_1004915701 | 148 |
| 347 | 3300006931 | Ga0097620_100016441 | Ga0097620_1000164415 | 148 |
| 348 | 3300006931 | Ga0097620_100389319 | Ga0097620_1003893194 | 148 |
| 349 | 3300006931 | Ga0097620_100563205 | Ga0097620_1005632052 | 148 |
| 350 | 3300006931 | Ga0097620_101442215 | Ga0097620_1014422151 | 148 |
| 351 | 3300006931 | Ga0097620_101599154 | Ga0097620_1015991542 | 148 |
| 352 | 3300006931 | Ga0097620_102410578 | Ga0097620_1024105781 | 148 |
| 353 | 3300009101 | Ga0105247_10004404 | Ga0105247_100044043 | 148 |
| 354 | 3300009101 | Ga0105247_10016725 | Ga0105247_100167253 | 148 |
| 355 | 3300009176 | Ga0105242_10499138 | Ga0105242_104991382 | 148 |
| 356 | 3300009553 | Ga0105249_10053326 | Ga0105249_100533264 | 148 |
| 357 | 3300009553 | Ga0105249_10382863 | Ga0105249_103828633 | 148 |
| 358 | 3300009553 | Ga0105249_10922785 | Ga0105249_109227853 | 148 |
| 359 | 3300009553 | Ga0105249_10981964 | Ga0105249_109819641 | 148 |
| 360 | 3300010375 | Ga0105239_10662477 | Ga0105239_106624772 | 148 |
| 361 | 3300010375 | Ga0105239_10724578 | Ga0105239_107245781 | 148 |
| 362 | 3300011119 | Ga0105246_10276435 | Ga0105246_102764352 | 148 |
| 363 | 3300013100 | Ga0157373_10174789 | Ga0157373_101747892 | 148 |
| 364 | 3300013100 | Ga0157373_10252614 | Ga0157373_102526142 | 148 |
| 365 | 3300013102 | Ga0157371_10015329 | Ga0157371_100153295 | 148 |
| 366 | 3300013104 | Ga0157370_10475281 | Ga0157370_104752812 | 148 |
| 367 | 3300013104 | Ga0157370_10873099 | Ga0157370_108730991 | 148 |
| 368 | 3300013105 | Ga0157369_10410781 | Ga0157369_104107813 | 148 |
| 369 | 3300013296 | Ga0157374_10037538 | Ga0157374_100375385 | 148 |
| 370 | 3300013296 | Ga0157374_10166571 | Ga0157374_101665714 | 148 |
| 371 | 3300013296 | Ga0157374_10913959 | Ga0157374_109139592 | 148 |
| 372 | 3300013296 | Ga0157374_10989705 | Ga0157374_109897052 | 148 |
| 373 | 3300013296 | Ga0157374_11608026 | Ga0157374_116080261 | 148 |
| 374 | 3300013297 | Ga0157378_10068340 | Ga0157378_100683402 | 148 |
| 375 | 3300013297 | Ga0157378_10137489 | Ga0157378_101374894 | 148 |
| 376 | 3300013297 | Ga0157378_10273642 | Ga0157378_102736421 | 148 |
| 377 | 3300013297 | Ga0157378_10477167 | Ga0157378_104771671 | 148 |
| 378 | 3300013297 | Ga0157378_10913434 | Ga0157378_109134342 | 148 |
| 379 | 3300013306 | Ga0163162_10855707 | Ga0163162_108557072 | 148 |
| 380 | 3300013307 | Ga0157372_10044094 | Ga0157372_100440942 | 148 |
| 381 | 3300013307 | Ga0157372_10138196 | Ga0157372_101381964 | 148 |
| 382 | 3300013307 | Ga0157372_10244080 | Ga0157372_102440801 | 148 |
| 383 | 3300013307 | Ga0157372_10326210 | Ga0157372_103262102 | 148 |
| 384 | 3300013307 | Ga0157372_10428260 | Ga0157372_104282602 | 148 |
| 385 | 3300013307 | Ga0157372_10474095 | Ga0157372_104740953 | 148 |
| 386 | 3300013307 | Ga0157372_10517117 | Ga0157372_105171173 | 148 |
| 387 | 3300013307 | Ga0157372_10618753 | Ga0157372_106187532 | 148 |
| 388 | 3300013307 | Ga0157372_10792845 | Ga0157372_107928451 | 148 |
| 389 | 3300013307 | Ga0157372_11045870 | Ga0157372_110458702 | 148 |
| 390 | 3300013307 | Ga0157372_11110776 | Ga0157372_111107763 | 148 |
| 391 | 3300013307 | Ga0157372_11227177 | Ga0157372_112271772 | 148 |
| 392 | 3300013307 | Ga0157372_12699953 | Ga0157372_126999532 | 148 |
| 393 | 3300013307 | Ga0157372_13011144 | Ga0157372_130111441 | 148 |
| 394 | 3300013308 | Ga0157375_11251820 | Ga0157375_112518201 | 148 |
| 395 | 3300014325 | Ga0163163_10194683 | Ga0163163_101946834 | 148 |
| 396 | 3300014325 | Ga0163163_10252665 | Ga0163163_102526652 | 148 |
| 397 | 3300014325 | Ga0163163_10262306 | Ga0163163_102623063 | 148 |
| 398 | 3300014325 | Ga0163163_10391609 | Ga0163163_103916093 | 148 |
| 399 | 3300014326 | Ga0157380_10000874 | Ga0157380_100008743 | 148 |
| 400 | 3300014326 | Ga0157380_10013298 | Ga0157380_100132981 | 148 |
| 401 | 3300014326 | Ga0157380_11531965 | Ga0157380_115319651 | 148 |
| 402 | 3300014745 | Ga0157377_10060773 | Ga0157377_100607734 | 148 |
| 403 | 3300014745 | Ga0157377_10518518 | Ga0157377_105185181 | 148 |
| 404 | 3300014968 | Ga0157379_10283108 | Ga0157379_102831082 | 148 |
| 405 | 3300014968 | Ga0157379_10285786 | Ga0157379_102857863 | 148 |
| 406 | 3300014968 | Ga0157379_11148254 | Ga0157379_111482541 | 148 |
| 407 | 3300014969 | Ga0157376_10007683 | Ga0157376_100076831 | 148 |
| 408 | 3300014969 | Ga0157376_11238256 | Ga0157376_112382562 | 148 |
| 409 | 3300017792 | Ga0163161_10496688 | Ga0163161_104966882 | 148 |
| 410 | 3300025246 | Ga0209646_1000005 | Ga0209646_1000005503 | 148 |
| 411 | 3300025250 | Ga0209026_1000149 | Ga0209026_10001494 | 148 |
| 412 | 3300025297 | Ga0209758_1001581 | Ga0209758_100158113 | 148 |
| 413 | 3300025302 | Ga0207426_1000262 | Ga0207426_100026229 | 148 |
| 414 | 3300025315 | Ga0207697_10025736 | Ga0207697_100257363 | 148 |
| 415 | 3300025321 | Ga0207656_10187613 | Ga0207656_101876131 | 148 |
| 416 | 3300025321 | Ga0207656_10649895 | Ga0207656_106498951 | 148 |
| 417 | 3300025900 | Ga0207710_10021802 | Ga0207710_100218023 | 148 |
| 418 | 3300025901 | Ga0207688_10078834 | Ga0207688_100788342 | 148 |
| 419 | 3300025904 | Ga0207647_10000054 | Ga0207647_100000547 | 148 |
| 420 | 3300025907 | Ga0207645_10001414 | Ga0207645_1000141418 | 148 |
| 421 | 3300025907 | Ga0207645_10458274 | Ga0207645_104582742 | 148 |
| 422 | 3300025908 | Ga0207643_10017772 | Ga0207643_100177723 | 148 |
| 423 | 3300025908 | Ga0207643_10380320 | Ga0207643_103803202 | 148 |
| 424 | 3300025908 | Ga0207643_10781610 | Ga0207643_107816101 | 148 |
| 425 | 3300025909 | Ga0207705_10038550 | Ga0207705_100385504 | 148 |
| 426 | 3300025911 | Ga0207654_10165422 | Ga0207654_101654222 | 148 |
| 427 | 3300025913 | Ga0207695_11155231 | Ga0207695_111552311 | 148 |
| 428 | 3300025918 | Ga0207662_10014557 | Ga0207662_100145574 | 148 |
| 429 | 3300025919 | Ga0207657_10318804 | Ga0207657_103188042 | 148 |
| 430 | 3300025920 | Ga0207649_10012497 | Ga0207649_100124972 | 148 |
| 431 | 3300025920 | Ga0207649_11430612 | Ga0207649_114306121 | 148 |
| 432 | 3300025923 | Ga0207681_10247116 | Ga0207681_102471163 | 148 |
| 433 | 3300025923 | Ga0207681_10261038 | Ga0207681_102610381 | 148 |
| 434 | 3300025923 | Ga0207681_10844281 | Ga0207681_108442811 | 148 |
| 435 | 3300025923 | Ga0207681_11103113 | Ga0207681_111031132 | 148 |
| 436 | 3300025925 | Ga0207650_10002829 | Ga0207650_1000282911 | 148 |
| 437 | 3300025925 | Ga0207650_10052505 | Ga0207650_100525053 | 148 |
| 438 | 3300025925 | Ga0207650_10057904 | Ga0207650_100579041 | 148 |
| 439 | 3300025925 | Ga0207650_10077427 | Ga0207650_100774273 | 148 |
| 440 | 3300025925 | Ga0207650_10303053 | Ga0207650_103030531 | 148 |
| 441 | 3300025926 | Ga0207659_11335390 | Ga0207659_113353901 | 148 |
| 442 | 3300025931 | Ga0207644_10213757 | Ga0207644_102137573 | 148 |
| 443 | 3300025931 | Ga0207644_10247387 | Ga0207644_102473874 | 148 |
| 444 | 3300025931 | Ga0207644_10363033 | Ga0207644_103630332 | 148 |
| 445 | 3300025931 | Ga0207644_10838977 | Ga0207644_108389771 | 148 |
| 446 | 3300025932 | Ga0207690_10003583 | Ga0207690_100035834 | 148 |
| 447 | 3300025932 | Ga0207690_10121607 | Ga0207690_101216073 | 148 |
| 448 | 3300025933 | Ga0207706_10132112 | Ga0207706_101321122 | 148 |
| 449 | 3300025933 | Ga0207706_10764544 | Ga0207706_107645441 | 148 |
| 450 | 3300025934 | Ga0207686_10362798 | Ga0207686_103627982 | 148 |
| 451 | 3300025934 | Ga0207686_11096882 | Ga0207686_110968821 | 148 |
| 452 | 3300025936 | Ga0207670_10593985 | Ga0207670_105939852 | 148 |
| 453 | 3300025937 | Ga0207669_10216620 | Ga0207669_102166201 | 148 |
| 454 | 3300025938 | Ga0207704_10433361 | Ga0207704_104333613 | 148 |
| 455 | 3300025940 | Ga0207691_10089266 | Ga0207691_100892665 | 148 |
| 456 | 3300025940 | Ga0207691_10771262 | Ga0207691_107712621 | 148 |
| 457 | 3300025942 | Ga0207689_10239230 | Ga0207689_102392302 | 148 |
| 458 | 3300025942 | Ga0207689_11465250 | Ga0207689_114652501 | 148 |
| 459 | 3300025944 | Ga0207661_10006150 | Ga0207661_100061506 | 148 |
| 460 | 3300025944 | Ga0207661_10137810 | Ga0207661_101378101 | 148 |
| 461 | 3300025944 | Ga0207661_10847201 | Ga0207661_108472011 | 148 |
| 462 | 3300025945 | Ga0207679_10000777 | Ga0207679_100007775 | 148 |
| 463 | 3300025945 | Ga0207679_10363725 | Ga0207679_103637251 | 148 |
| 464 | 3300025960 | Ga0207651_10013586 | Ga0207651_100135864 | 148 |
| 465 | 3300025960 | Ga0207651_10023535 | Ga0207651_100235355 | 148 |
| 466 | 3300025960 | Ga0207651_10112459 | Ga0207651_101124593 | 148 |
| 467 | 3300025960 | Ga0207651_10165654 | Ga0207651_101656542 | 148 |
| 468 | 3300025960 | Ga0207651_10169433 | Ga0207651_101694331 | 148 |
| 469 | 3300025960 | Ga0207651_10686151 | Ga0207651_106861512 | 148 |
| 470 | 3300025960 | Ga0207651_10697672 | Ga0207651_106976721 | 148 |
| 471 | 3300025961 | Ga0207712_10272490 | Ga0207712_102724902 | 148 |
| 472 | 3300025972 | Ga0207668_10142924 | Ga0207668_101429241 | 148 |
| 473 | 3300025972 | Ga0207668_10570103 | Ga0207668_105701031 | 148 |
| 474 | 3300025981 | Ga0207640_10396375 | Ga0207640_103963752 | 148 |
| 475 | 3300025986 | Ga0207658_10224740 | Ga0207658_102247403 | 148 |
| 476 | 3300025986 | Ga0207658_10453946 | Ga0207658_104539461 | 148 |
| 477 | 3300025986 | Ga0207658_10616872 | Ga0207658_106168722 | 148 |
| 478 | 3300026023 | Ga0207677_10009244 | Ga0207677_100092445 | 148 |
| 479 | 3300026023 | Ga0207677_10300722 | Ga0207677_103007224 | 148 |
| 480 | 3300026023 | Ga0207677_11287624 | Ga0207677_112876241 | 148 |
| 481 | 3300026035 | Ga0207703_10225221 | Ga0207703_102252213 | 148 |
| 482 | 3300026041 | Ga0207639_10048916 | Ga0207639_100489162 | 148 |
| 483 | 3300026041 | Ga0207639_10100749 | Ga0207639_101007493 | 148 |
| 484 | 3300026041 | Ga0207639_10932318 | Ga0207639_109323182 | 148 |
| 485 | 3300026041 | Ga0207639_11145788 | Ga0207639_111457882 | 148 |
| 486 | 3300026041 | Ga0207639_11211482 | Ga0207639_112114821 | 148 |
| 487 | 3300026067 | Ga0207678_10878619 | Ga0207678_108786191 | 148 |
| 488 | 3300026075 | Ga0207708_10233885 | Ga0207708_102338852 | 148 |
| 489 | 3300026075 | Ga0207708_11018375 | Ga0207708_110183752 | 148 |
| 490 | 3300026088 | Ga0207641_10019514 | Ga0207641_100195144 | 148 |
| 491 | 3300026088 | Ga0207641_10390897 | Ga0207641_103908971 | 148 |
| 492 | 3300026089 | Ga0207648_10003106 | Ga0207648_100031062 | 148 |
| 493 | 3300026089 | Ga0207648_10258930 | Ga0207648_102589303 | 148 |
| 494 | 3300026095 | Ga0207676_10480386 | Ga0207676_104803861 | 148 |
| 495 | 3300026116 | Ga0207674_10003303 | Ga0207674_100033034 | 148 |
| 496 | 3300026116 | Ga0207674_10117029 | Ga0207674_101170294 | 148 |
| 497 | 3300026116 | Ga0207674_10212768 | Ga0207674_102127682 | 148 |
| 498 | 3300026116 | Ga0207674_10488144 | Ga0207674_104881442 | 148 |
| 499 | 3300026118 | Ga0207675_100011319 | Ga0207675_1000113198 | 148 |
| 500 | 3300026118 | Ga0207675_100083149 | Ga0207675_1000831495 | 148 |
| 501 | 3300026118 | Ga0207675_100247006 | Ga0207675_1002470062 | 148 |
| 502 | 3300026118 | Ga0207675_100390747 | Ga0207675_1003907471 | 148 |
| 503 | 3300026118 | Ga0207675_101502595 | Ga0207675_1015025951 | 148 |
| 504 | 3300026121 | Ga0207683_10324679 | Ga0207683_103246792 | 148 |
| 505 | 3300026121 | Ga0207683_11561917 | Ga0207683_115619171 | 148 |
| 506 | 3300026142 | Ga0207698_10083962 | Ga0207698_100839624 | 148 |
| 507 | 3300026142 | Ga0207698_11066675 | Ga0207698_110666751 | 148 |
| 508 | 3300026142 | Ga0207698_11807489 | Ga0207698_118074891 | 148 |
| 509 | 3300027471 | Ga0209995_1014434 | Ga0209995_10144342 | 148 |
| 510 | 3300027543 | Ga0209999_1096173 | Ga0209999_10961732 | 148 |
| 511 | 3300027665 | Ga0209983_1028476 | Ga0209983_10284761 | 148 |
| 512 | 3300027876 | Ga0209974_10016908 | Ga0209974_100169084 | 148 |
| 513 | 3300028379 | Ga0268266_10459686 | Ga0268266_104596862 | 148 |
| 514 | 3300028381 | Ga0268264_10016695 | Ga0268264_100166955 | 148 |
| 515 | 3300028381 | Ga0268264_10017783 | Ga0268264_100177834 | 148 |
| 516 | 3300028381 | Ga0268264_10057876 | Ga0268264_100578762 | 148 |
| 517 | 3300028381 | Ga0268264_10148290 | Ga0268264_101482903 | 148 |
| 518 | 3300028794 | Ga0307515_10000107 | Ga0307515_1000010716 | 148 |
| 519 | 3300028794 | Ga0307515_10542041 | Ga0307515_105420411 | 148 |
| 520 | 3300031456 | Ga0307513_11009219 | Ga0307513_110092191 | 148 |
| 521 | 3300031824 | Ga0307413_10219491 | Ga0307413_102194912 | 148 |
| 522 | 3300031824 | Ga0307413_11341476 | Ga0307413_113414761 | 148 |
| 523 | 3300031852 | Ga0307410_10037090 | Ga0307410_100370901 | 148 |
| 524 | 3300031852 | Ga0307410_10770696 | Ga0307410_107706961 | 148 |
| 525 | 3300031901 | Ga0307406_10261768 | Ga0307406_102617682 | 148 |
| 526 | 3300031901 | Ga0307406_10308655 | Ga0307406_103086552 | 148 |
| 527 | 3300031903 | Ga0307407_10997343 | Ga0307407_109973431 | 148 |
| 528 | 3300031911 | Ga0307412_10105983 | Ga0307412_101059832 | 148 |
| 529 | 3300031911 | Ga0307412_10410821 | Ga0307412_104108212 | 148 |
| 530 | 3300032002 | Ga0307416_100422092 | Ga0307416_1004220923 | 148 |
| 531 | 3300032002 | Ga0307416_101860172 | Ga0307416_1018601721 | 148 |
| 532 | 3300032004 | Ga0307414_10264994 | Ga0307414_102649942 | 148 |
| 533 | 3300032004 | Ga0307414_10407248 | Ga0307414_104072481 | 148 |
| 534 | 3300032004 | Ga0307414_10578044 | Ga0307414_105780443 | 148 |
| 535 | 3300032005 | Ga0307411_10217493 | Ga0307411_102174933 | 148 |
| 536 | 3300032126 | Ga0307415_100745818 | Ga0307415_1007458181 | 148 |
| 537 | 3300032126 | Ga0307415_101605608 | Ga0307415_1016056081 | 148 |
| 538 | 3300033524 | Ga0316592_1055522 | Ga0316592_10555222 | 148 |
| 539 | 3300035111 | Ga0373923_0269620 | Ga0373923_0269620_121_567 | 148 |
| 540 | 3300035170 | Ga0373943_0285807 | Ga0373943_0285807_34_480 | 148 |
| 541 | 3300035171 | Ga0373946_0047656 | Ga0373946_0047656_519_965 | 148 |
| 542 | 3300035398 | Ga0316574_0581976 | Ga0316574_0581976_206_652 | 148 |
| 543 | 3300036401 | Ga0373937_0420990 | Ga0373937_0420990_521_967 | 148 |
| 544 | 3300036401 | Ga0373937_0597281 | Ga0373937_0597281_312_758 | 148 |
| 545 | 3300037312 | Ga0395899_0443656 | Ga0395899_0443656_180_626 | 148 |
| 546 | 3300037418 | Ga0395900_0079402 | Ga0395900_0079402_36_482 | 148 |
| 547 | 3300037418 | Ga0395900_0430316 | Ga0395900_0430316_613_1059 | 148 |
| 548 | 3300037418 | Ga0395900_0965694 | Ga0395900_0965694_234_680 | 148 |
| 549 | 3300037466 | Ga0395898_0081787 | Ga0395898_0081787_636_1082 | 148 |
| 550 | 3300037466 | Ga0395898_0194299 | Ga0395898_0194299_772_1218 | 148 |
| 551 | 3300037471 | Ga0395905_0001345 | Ga0395905_0001345_4163_4609 | 148 |
| 552 | 3300037471 | Ga0395905_0037653 | Ga0395905_0037653_3288_3785 | 148 |
| 553 | 3300037471 | Ga0395905_0647072 | Ga0395905_0647072_337_783 | 148 |
| 554 | 3300038443 | Ga0395901_0183308 | Ga0395901_0183308_570_1016 | 148 |
| 555 | 3300038443 | Ga0395901_1211781 | Ga0395901_1211781_84_530 | 148 |
| 556 | 3300039437 | Ga0436365_0430263 | Ga0436365_0430263_976_1422 | 148 |
| 557 | 3300039437 | Ga0436365_1637134 | Ga0436365_1637134_23787_24233 | 148 |
| 558 | 3300039453 | Ga0436362_0581654 | Ga0436362_0581654_48_494 | 148 |
| 559 | 3300041406 | Ga0439439_0197426 | Ga0439439_0197426_13_477 | 148 |
| 560 | 3300041413 | Ga0439465_0053797 | Ga0439465_0053797_570_1034 | 148 |
| 561 | 3300041413 | Ga0439465_0212242 | Ga0439465_0212242_36_482 | 148 |
| 562 | 3300041460 | Ga0451802_1114912 | Ga0451802_1114912_172_618 | 148 |
| 563 | 3300041997 | Ga0439431_0001403 | Ga0439431_0001403_4805_5251 | 148 |
| 564 | 3300041997 | Ga0439431_0027658 | Ga0439431_0027658_834_1298 | 148 |
| 565 | 3300042004 | Ga0439445_0092823 | Ga0439445_0092823_324_770 | 148 |
| 566 | 3300042007 | Ga0439449_0005016 | Ga0439449_0005016_2053_2499 | 148 |
| 567 | 3300042010 | Ga0439452_091255 | Ga0439452_091255_163_627 | 148 |
| 568 | 3300042014 | Ga0439457_011115 | Ga0439457_011115_879_1343 | 148 |
| 569 | 3300042125 | Ga0450923_011615 | Ga0450923_011615_560_1006 | 148 |
| 570 | 3300042128 | Ga0450897_002854 | Ga0450897_002854_554_1018 | 148 |
| 571 | 3300042131 | Ga0450894_011226 | Ga0450894_011226_670_1134 | 148 |
| 572 | 3300042131 | Ga0450894_062496 | Ga0450894_062496_24_470 | 148 |
| 573 | 3300042132 | Ga0450895_019461 | Ga0450895_019461_84_548 | 148 |
| 574 | 3300042134 | Ga0450898_003372 | Ga0450898_003372_989_1453 | 148 |
| 575 | 3300042135 | Ga0450899_001053 | Ga0450899_001053_1544_2008 | 148 |
| 576 | 3300042435 | Ga0439434_0257936 | Ga0439434_0257936_78_542 | 148 |
| 577 | 3300042876 | Ga0451577_0039713 | Ga0451577_0039713_22_468 | 148 |
| 578 | 3300042876 | Ga0451577_0050025 | Ga0451577_0050025_2235_2681 | 148 |
| 579 | 3300042876 | Ga0451577_0147383 | Ga0451577_0147383_774_1220 | 148 |
| 580 | 3300044712 | Ga0453684_0021943 | Ga0453684_0021943_8499_8945 | 148 |
| 581 | 3300044712 | Ga0453684_0047019 | Ga0453684_0047019_219_668 | 148 |
| 582 | 3300044712 | Ga0453684_0072019 | Ga0453684_0072019_881_1327 | 148 |
| 583 | 3300044765 | Ga0466970_0477166 | Ga0466970_0477166_146_592 | 148 |
| 584 | 3300045049 | Ga0466959_0047185 | Ga0466959_0047185_1661_2107 | 148 |
| 585 | 3300045051 | Ga0451576_0714991 | Ga0451576_0714991_483_929 | 148 |
| 586 | 3300045051 | Ga0451576_1311102 | Ga0451576_1311102_121_567 | 148 |
| 587 | 3300045976 | Ga0466967_0403282 | Ga0466967_0403282_294_740 | 148 |
| 588 | 3300046525 | Ga0495663_0024713 | Ga0495663_0024713_877_1323 | 148 |
| 589 | 3300046537 | Ga0495598_0146920 | Ga0495598_0146920_124_570 | 148 |
| 590 | 3300046537 | Ga0495598_0163267 | Ga0495598_0163267_83_529 | 148 |
| 591 | 3300046539 | Ga0495621_0052447 | Ga0495621_0052447_645_1091 | 148 |
| 592 | 3300046615 | Ga0495656_0331411 | Ga0495656_0331411_64_510 | 148 |
| 593 | 3300046691 | Ga0495670_0042608 | Ga0495670_0042608_859_1305 | 148 |
| 594 | 3300047320 | Ga0495672_0082899 | Ga0495672_0082899_934_1380 | 148 |
| 595 | 3300048090 | Ga0495615_0015991 | Ga0495615_0015991_275_721 | 148 |
| 596 | 3300049127 | Ga0501306_062139 | Ga0501306_062139_10_456 | 148 |
| 597 | 3300049129 | Ga0501309_009493 | Ga0501309_009493_729_1211 | 148 |
| 598 | 3300049129 | Ga0501309_072973 | Ga0501309_072973_11_457 | 148 |
| 599 | 3300049129 | Ga0501309_083319 | Ga0501309_083319_78_524 | 148 |
| 600 | 3300049129 | Ga0501309_085695 | Ga0501309_085695_30_476 | 148 |
| 601 | 3300049161 | Ga0501305_011154 | Ga0501305_011154_702_1184 | 148 |
| 602 | 3300049161 | Ga0501305_065677 | Ga0501305_065677_117_563 | 148 |
| 603 | 3300049162 | Ga0501307_007686 | Ga0501307_007686_720_1166 | 148 |
| 604 | 3300049162 | Ga0501307_012219 | Ga0501307_012219_30_512 | 148 |
| 605 | 3300049163 | Ga0501342_03950 | Ga0501342_03950_70_516 | 148 |
| 606 | 3300049515 | Ga0501292_033515 | Ga0501292_033515_268_732 | 148 |
| 607 | 3300049519 | Ga0501296_010317 | Ga0501296_010317_210_692 | 148 |
| 608 | 3300049521 | Ga0501298_002358 | Ga0501298_002358_579_1043 | 148 |
| 609 | 3300049522 | Ga0501299_045504 | Ga0501299_045504_433_879 | 148 |
| 610 | 3300049527 | Ga0501311_007156 | Ga0501311_007156_731_1213 | 148 |
| 611 | 3300049527 | Ga0501311_030577 | Ga0501311_030577_321_767 | 148 |
| 612 | 3300049528 | Ga0501312_013093 | Ga0501312_013093_683_1129 | 148 |
| 613 | 3300049529 | Ga0501313_008796 | Ga0501313_008796_657_1103 | 148 |
| 614 | 3300049529 | Ga0501313_012655 | Ga0501313_012655_473_955 | 148 |
| 615 | 3300049529 | Ga0501313_029005 | Ga0501313_029005_255_701 | 148 |
| 616 | 3300049530 | Ga0501314_029912 | Ga0501314_029912_87_572 | 148 |
| 617 | 3300049531 | Ga0501315_008641 | Ga0501315_008641_715_1161 | 148 |
| 618 | 3300049531 | Ga0501315_009328 | Ga0501315_009328_700_1146 | 148 |
| 619 | 3300049531 | Ga0501315_016198 | Ga0501315_016198_375_821 | 148 |
| 620 | 3300049531 | Ga0501315_085496 | Ga0501315_085496_26_472 | 148 |
| 621 | 3300049532 | Ga0501316_005577 | Ga0501316_005577_800_1282 | 148 |
| 622 | 3300049532 | Ga0501316_009012 | Ga0501316_009012_31_477 | 148 |
| 623 | 3300049532 | Ga0501316_011551 | Ga0501316_011551_563_1009 | 148 |
| 624 | 3300049532 | Ga0501316_039908 | Ga0501316_039908_180_626 | 148 |
| 625 | 3300049533 | Ga0501317_054896 | Ga0501317_054896_184_630 | 148 |
| 626 | 3300049539 | Ga0501323_008601 | Ga0501323_008601_31_513 | 148 |
| 627 | 3300049539 | Ga0501323_008879 | Ga0501323_008879_714_1160 | 148 |
| 628 | 3300049541 | Ga0501325_009730 | Ga0501325_009730_402_848 | 148 |
| 629 | 3300049546 | Ga0501330_016179 | Ga0501330_016179_29_475 | 148 |
| 630 | 3300049549 | Ga0501333_005926 | Ga0501333_005926_294_740 | 148 |
| 631 | 3300049551 | Ga0501335_005974 | Ga0501335_005974_641_1087 | 148 |
| 632 | 3300049551 | Ga0501335_006644 | Ga0501335_006644_524_970 | 148 |
| 633 | 3300049551 | Ga0501335_009232 | Ga0501335_009232_468_914 | 148 |
| 634 | 3300049552 | Ga0501336_006843 | Ga0501336_006843_397_843 | 148 |
| 635 | 3300049570 | Ga0501033_0162329 | Ga0501033_0162329_1113_1559 | 148 |
| 636 | 3300049571 | Ga0501034_0008676 | Ga0501034_0008676_336_782 | 148 |
| 637 | 3300049571 | Ga0501034_0144438 | Ga0501034_0144438_967_1413 | 148 |
| 638 | 3300049574 | Ga0501038_0908087 | Ga0501038_0908087_88_534 | 148 |
| 639 | 3300049575 | Ga0501039_0969830 | Ga0501039_0969830_120_566 | 148 |
| 640 | 3300049579 | Ga0501043_0058310 | Ga0501043_0058310_1508_1954 | 148 |
| 641 | 3300049586 | Ga0501070_0757822 | Ga0501070_0757822_68_514 | 148 |
| 642 | 3300049649 | Ga0501198_001163 | Ga0501198_001163_750_1214 | 148 |
| 643 | 3300049651 | Ga0501201_034416 | Ga0501201_034416_91_573 | 148 |
| 644 | 3300049652 | Ga0501202_009450 | Ga0501202_009450_638_1102 | 148 |
| 645 | 3300049652 | Ga0501202_032440 | Ga0501202_032440_600_1046 | 148 |
| 646 | 3300049653 | Ga0501206_002023 | Ga0501206_002023_1640_2104 | 148 |
| 647 | 3300049654 | Ga0501207_063747 | Ga0501207_063747_140_604 | 148 |
| 648 | 3300049654 | Ga0501207_142814 | Ga0501207_142814_37_483 | 148 |
| 649 | 3300049656 | Ga0501209_086777 | Ga0501209_086777_435_881 | 148 |
| 650 | 3300049661 | Ga0501217_000031 | Ga0501217_000031_5554_6018 | 148 |
| 651 | 3300049661 | Ga0501217_011991 | Ga0501217_011991_567_1013 | 148 |
| 652 | 3300049661 | Ga0501217_145278 | Ga0501217_145278_111_557 | 148 |
| 653 | 3300049663 | Ga0501223_004205 | Ga0501223_004205_650_1114 | 148 |
| 654 | 3300049663 | Ga0501223_125109 | Ga0501223_125109_19_465 | 148 |
| 655 | 3300049664 | Ga0501224_013830 | Ga0501224_013830_691_1137 | 148 |
| 656 | 3300049665 | Ga0501227_079921 | Ga0501227_079921_104_550 | 148 |
| 657 | 3300049673 | Ga0501240_013770 | Ga0501240_013770_444_908 | 148 |
| 658 | 3300049673 | Ga0501240_038286 | Ga0501240_038286_295_741 | 148 |
| 659 | 3300049674 | Ga0501242_006955 | Ga0501242_006955_389_853 | 148 |
| 660 | 3300049675 | Ga0501243_001794 | Ga0501243_001794_2547_3011 | 148 |
| 661 | 3300049675 | Ga0501243_086756 | Ga0501243_086756_90_536 | 148 |
| 662 | 3300049682 | Ga0501252_003521 | Ga0501252_003521_563_1027 | 148 |
| 663 | 3300049682 | Ga0501252_045311 | Ga0501252_045311_130_576 | 148 |
| 664 | 3300049686 | Ga0501257_007538 | Ga0501257_007538_1256_1702 | 148 |
| 665 | 3300049688 | Ga0501259_030282 | Ga0501259_030282_79_543 | 148 |
| 666 | 3300049688 | Ga0501259_037766 | Ga0501259_037766_430_912 | 148 |
| 667 | 3300049690 | Ga0501261_002234 | Ga0501261_002234_1399_1863 | 148 |
| 668 | 3300049690 | Ga0501261_048851 | Ga0501261_048851_44_490 | 148 |
| 669 | 3300049704 | Ga0501221_000508 | Ga0501221_000508_4600_5064 | 148 |
| 670 | 3300049704 | Ga0501221_044974 | Ga0501221_044974_409_855 | 148 |
| 671 | 3300049705 | Ga0501225_0022573 | Ga0501225_0022573_911_1357 | 148 |
| 672 | 3300049707 | Ga0501234_018179 | Ga0501234_018179_382_828 | 148 |
| 673 | 3300049707 | Ga0501234_031464 | Ga0501234_031464_80_526 | 148 |
| 674 | 3300049708 | Ga0501245_034476 | Ga0501245_034476_253_699 | 148 |
| 675 | 3300049762 | Ga0501265_041518 | Ga0501265_041518_72_536 | 148 |
| 676 | 3300049763 | Ga0501266_000514 | Ga0501266_000514_3963_4445 | 148 |
| 677 | 3300049769 | Ga0501272_020900 | Ga0501272_020900_261_707 | 148 |
| 678 | 3300049769 | Ga0501272_032026 | Ga0501272_032026_143_589 | 148 |
| 679 | 3300049822 | Ga0501035_0151808 | Ga0501035_0151808_828_1274 | 148 |
| 680 | 3300049823 | Ga0501044_0079878 | Ga0501044_0079878_266_712 | 148 |
| 681 | 3300049823 | Ga0501044_0452746 | Ga0501044_0452746_443_889 | 148 |
| 682 | 3300049823 | Ga0501044_0457812 | Ga0501044_0457812_498_944 | 148 |
| 683 | 3300053090 | Ga0500646_0005972 | Ga0500646_0005972_1298_1744 | 148 |
| 684 | 3300059492 | Ga0587073_0056738 | Ga0587073_0056738_447_893 | 148 |
| 685 | 3300059510 | Ga0587090_128716 | Ga0587090_128716_97_543 | 148 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8cgd-assembly1.cif.gz_h | clindamycin bound to the 50s subunit | 1.008 | 1 | 40 |
| 8ceu-assembly1.cif.gz_h | retapamulin and capreomycin bound to the 50s subunit | 1.002 | 1 | 40 |
| 8fto-assembly1.cif.gz_h | e. coli 70s ribosome with an improved ms2 tag inserted in h98 | 1.002 | 1 | 40 |
| 8aye-assembly1.cif.gz_h | e. coli 70s ribosome bound to thermorubin and fmet-trna | 1 | 1 | 40 |
| 7y7e-assembly1.cif.gz_h | structure of the bacterial ribosome with human trna asp(manq34) and mrna(gau) | 0.9993 | 1 | 40 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4rbcI01 | Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L9; domain 1;Ribosomal protein L9, N-terminal domain | 0.9875 | 1 | 57 | 3.40.5.10 |
| af_Q2G2T3_1_54_3.40.5.10 | Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L9; domain 1;Ribosomal protein L9, N-terminal domain | 0.9866 | 1 | 51 | 3.40.5.10 |
| 4qcvI01 | Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L9; domain 1;Ribosomal protein L9, N-terminal domain | 0.9841 | 1 | 57 | 3.40.5.10 |
| 4qcxI01 | Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L9; domain 1;Ribosomal protein L9, N-terminal domain | 0.9758 | 1 | 57 | 3.40.5.10 |
| 4l6lI01 | Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L9; domain 1;Ribosomal protein L9, N-terminal domain | 0.974 | 1 | 57 | 3.40.5.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1F3P1U0-F1-model_v4 | Large ribosomal subunit protein bL9 | 0.9776 | 1 | 148 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A5N8YDQ1-F1-model_v4 | Large ribosomal subunit protein bL9 | 0.9683 | 1 | 147 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A7C4UT27-F1-model_v4 | Large ribosomal subunit protein bL9 | 0.9676 | 1 | 148 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A7C4JUF5-F1-model_v4 | Large ribosomal subunit protein bL9 | 0.9635 | 1 | 148 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A7V2RM38-F1-model_v4 | Large ribosomal subunit protein bL9 | 0.9634 | 1 | 148 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar