F475104

General Info

Members Datasets Scaffolds Average Seq Length
685 294 681 146

Family's Representative Sequence

Representative Sequence 3300005290|Ga0065712_10256583|Ga0065712_102565832
Length 166
Sequence MAERGQSRVKRDWLKQLTMDIILIQDVDNLGGKNELVKVKNGYARNFLIPRGLAVEANPSNRKQLDERMKVAKKKEDQMLAQINNVIAKLQEGPVKVGAKTGTSGKIFGSVTALQISRAIRDQKGYEIDRKKIHITDDVKELGTYKASIDFGNGHHADVEFEVVAE

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
3 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
4 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
5 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
6 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
7 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
8 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
9 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
10 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
11 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
16 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
17 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
18 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
20 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
21 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
24 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
25 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
28 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
29 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
30 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
31 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
32 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
33 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
34 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
35 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
36 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
37 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
38 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
39 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
40 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
41 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
42 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
43 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
44 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
45 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
46 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
47 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
48 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
49 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
50 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
51 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
52 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
53 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
73 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
79 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
98 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
99 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
113 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
114 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
115 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
116 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
170 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
173 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
174 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
175 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
176 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
177 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
178 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
179 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
180 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
181 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
182 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
183 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
184 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
186 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
187 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
188 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
189 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
190 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
191 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
192 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
193 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
194 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
195 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
196 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
197 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
198 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
199 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
200 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
201 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
202 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
203 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
204 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
205 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
206 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
207 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
208 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
209 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
210 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
211 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
212 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
213 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
214 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
215 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
216 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
217 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
218 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
219 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
220 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
221 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
222 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
223 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
224 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
225 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
226 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
227 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
228 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
229 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
230 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
231 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
232 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
234 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 3300049163 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
238 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
239 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
240 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
241 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
242 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
243 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
244 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
245 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
246 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
247 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
248 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
249 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
250 3300049546 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
251 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
252 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
253 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
254 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
260 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
261 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
262 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
263 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
264 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
265 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
266 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
267 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
268 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
269 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
270 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
271 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
272 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
273 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
274 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
275 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
276 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
277 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
278 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
279 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
280 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
281 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
282 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
283 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
284 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
286 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
287 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
288 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
289 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
290 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
291 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
292 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
293 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
294 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.14
Metatranscriptomes 6.28
Isolates 0.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.46
Nodule 0
Rhizoplane 0.29
Rhizosphere 95.91
Stem 0
Stem Tuber 0
Unclassified 2.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_3199889 2162886011 Bacteria 842
2 JGI24736J21556_1008031 3300001904 Bacteria 1760
3 JGI24740J21852_10005418 3300001979 Bacteria 5398
4 JGI24744J21845_10007602 3300002077 Bacteria 2239
5 JGI24751J29686_10000815 3300002459 Bacteria 7260
6 JGI25154J39366_1000020 3300002738 Bacteria 233181
7 JGI25157J39369_1007886 3300002741 Bacteria 1511
8 JGI25153J46596_10000449 3300003215 Bacteria 26469
9 rootH2_10078683 3300003320 Bacteria 1653
10 rootH1_10083371 3300003323 Bacteria 1582
11 JGI25160J50197_1010153 3300003354 Bacteria 3426
12 JGI25160J50197_1016700 3300003354 Bacteria 2355
13 Ga0058860_11988454 3300004801 Bacteria 1560
14 Ga0058862_12224181 3300004803 Bacteria 761
15 Ga0065714_10134545 3300005288 Bacteria 1211
16 Ga0065704_10084334 3300005289 Bacteria 3346
17 Ga0065704_10488012 3300005289 Bacteria 670
18 Ga0065712_10022972 3300005290 Bacteria 1468
19 Ga0065712_10034732 3300005290 Bacteria 747
20 Ga0065712_10099081 3300005290 Bacteria 2101
21 Ga0065712_10256583 3300005290 Bacteria 924
22 Ga0065715_10151075 3300005293 Bacteria 1728
23 Ga0065715_10727538 3300005293 Bacteria 590
24 Ga0070658_10004004 3300005327 Bacteria 12069
25 Ga0070658_10126296 3300005327 Bacteria 2129
26 Ga0070658_10965419 3300005327 Bacteria 741
27 Ga0070658_11784040 3300005327 Unclassified 532
28 Ga0070676_10225049 3300005328 Bacteria 1241
29 Ga0070676_10922198 3300005328 Bacteria 652
30 Ga0070683_100014181 3300005329 Bacteria 6962
31 Ga0070683_100163407 3300005329 Bacteria 2112
32 Ga0070690_100147837 3300005330 Bacteria 1600
33 Ga0070690_100228537 3300005330 Bacteria 1307
34 Ga0070670_100008929 3300005331 Bacteria 8561
35 Ga0070670_100050094 3300005331 Bacteria 3589
36 Ga0070670_100159846 3300005331 Bacteria 1952
37 Ga0070670_100201020 3300005331 Bacteria 1731
38 Ga0070670_100210533 3300005331 Bacteria 1690
39 Ga0070670_100361455 3300005331 Bacteria 1276
40 Ga0070670_101002631 3300005331 Unclassified 759
41 Ga0070677_10013175 3300005333 Bacteria 2886
42 Ga0070677_10018611 3300005333 Bacteria 2504
43 Ga0070677_10147990 3300005333 Bacteria 1090
44 Ga0068869_100203298 3300005334 Bacteria 1563
45 Ga0068869_100306661 3300005334 Bacteria 1283
46 Ga0070666_10078433 3300005335 Bacteria 2255
47 Ga0070680_100035348 3300005336 Bacteria 4033
48 Ga0070682_100045350 3300005337 Bacteria 2725
49 Ga0070682_100272240 3300005337 Bacteria 1231
50 Ga0070682_100706508 3300005337 Unclassified 809
51 Ga0070682_101239500 3300005337 Unclassified 631
52 Ga0070682_101983165 3300005337 Bacteria 512
53 Ga0068868_100015105 3300005338 Bacteria 5703
54 Ga0068868_100070716 3300005338 Bacteria 2782
55 Ga0068868_100731513 3300005338 Bacteria 887
56 Ga0068868_100766407 3300005338 Bacteria 868
57 Ga0070660_100020101 3300005339 Bacteria 4903
58 Ga0070660_100300871 3300005339 Bacteria 1315
59 Ga0070689_100728765 3300005340 Bacteria 867
60 Ga0070689_101003995 3300005340 Unclassified 742
61 Ga0070687_100000838 3300005343 Bacteria 10250
62 Ga0070687_100060322 3300005343 Bacteria 2000
63 Ga0070687_100263472 3300005343 Bacteria 1077
64 Ga0070687_100329096 3300005343 Bacteria 979
65 Ga0070661_100001685 3300005344 Bacteria 15290
66 Ga0070661_100836437 3300005344 Unclassified 757
67 Ga0070692_10152686 3300005345 Bacteria 1316
68 Ga0070668_100175198 3300005347 Bacteria 1748
69 Ga0070668_100483661 3300005347 Bacteria 1069
70 Ga0070668_100502734 3300005347 Bacteria 1049
71 Ga0070668_101054744 3300005347 Bacteria 732
72 Ga0070669_100102445 3300005353 Bacteria 2161
73 Ga0070669_100169255 3300005353 Bacteria 1702
74 Ga0070669_100238876 3300005353 Bacteria 1443
75 Ga0070669_100726853 3300005353 Bacteria 840
76 Ga0070669_100851268 3300005353 Unclassified 777
77 Ga0070669_101206687 3300005353 Bacteria 654
78 Ga0070675_100027766 3300005354 Bacteria 4550
79 Ga0070675_100028796 3300005354 Bacteria 4474
80 Ga0070675_100056542 3300005354 Bacteria 3233
81 Ga0070675_100085424 3300005354 Bacteria 2637
82 Ga0070675_100271152 3300005354 Bacteria 1489
83 Ga0070671_100018271 3300005355 Bacteria 5694
84 Ga0070671_100037415 3300005355 Bacteria 4024
85 Ga0070671_100683194 3300005355 Bacteria 890
86 Ga0070671_100705004 3300005355 Bacteria 876
87 Ga0070674_100056100 3300005356 Bacteria 2731
88 Ga0070674_100158733 3300005356 Bacteria 1714
89 Ga0070674_100451798 3300005356 Bacteria 1061
90 Ga0070674_100552663 3300005356 Unclassified 966
91 Ga0070673_100005284 3300005364 Bacteria 8251
92 Ga0070673_100009831 3300005364 Bacteria 6443
93 Ga0070673_100368076 3300005364 Bacteria 1279
94 Ga0070673_100771204 3300005364 Bacteria 886
95 Ga0070673_100779839 3300005364 Bacteria 882
96 Ga0070673_100801352 3300005364 Unclassified 870
97 Ga0070673_101037251 3300005364 Bacteria 764
98 Ga0070673_101051482 3300005364 Bacteria 759
99 Ga0070673_101063981 3300005364 Bacteria 755
100 Ga0070673_101832253 3300005364 Unclassified 575
101 Ga0070688_100188862 3300005365 Unclassified 1434
102 Ga0070688_100273415 3300005365 Bacteria 1211
103 Ga0070688_100362755 3300005365 Bacteria 1064
104 Ga0070688_100411196 3300005365 Bacteria 1003
105 Ga0070659_100004313 3300005366 Bacteria 10156
106 Ga0070659_100371785 3300005366 Bacteria 1203
107 Ga0070659_100664506 3300005366 Bacteria 899
108 Ga0070667_100181821 3300005367 Bacteria 1860
109 Ga0070667_100255773 3300005367 Bacteria 1567
110 Ga0070667_100262152 3300005367 Bacteria 1548
111 Ga0070667_100496072 3300005367 Bacteria 1119
112 Ga0070713_100924860 3300005436 Bacteria 839
113 Ga0070713_101913483 3300005436 Bacteria 575
114 Ga0070713_102208574 3300005436 Bacteria 533
115 Ga0070663_100189737 3300005455 Bacteria 1599
116 Ga0070678_100058471 3300005456 Bacteria 2830
117 Ga0070678_100784343 3300005456 Bacteria 864
118 Ga0070678_100883314 3300005456 Bacteria 816
119 Ga0070662_100091601 3300005457 Bacteria 2284
120 Ga0070662_100169463 3300005457 Bacteria 1714
121 Ga0070681_10678192 3300005458 Bacteria 946
122 Ga0070681_10890796 3300005458 Bacteria 808
123 Ga0068867_100077692 3300005459 Bacteria 2495
124 Ga0068867_100109447 3300005459 Bacteria 2121
125 Ga0068867_100508756 3300005459 Bacteria 1036
126 Ga0068867_100822316 3300005459 Bacteria 830
127 Ga0070685_10240624 3300005466 Bacteria 1194
128 Ga0070685_10242637 3300005466 Bacteria 1190
129 Ga0070685_10757421 3300005466 Unclassified 712
130 Ga0070685_10828157 3300005466 Bacteria 684
131 Ga0070679_100108447 3300005530 Bacteria 2762
132 Ga0070684_100001962 3300005535 Bacteria 15111
133 Ga0070684_100560678 3300005535 Bacteria 1060
134 Ga0070684_101072079 3300005535 Bacteria 757
135 Ga0068853_100002136 3300005539 Bacteria 14716
136 Ga0068853_100304146 3300005539 Bacteria 1475
137 Ga0068853_101012795 3300005539 Bacteria 800
138 Ga0068853_101879087 3300005539 Unclassified 581
139 Ga0070672_100030162 3300005543 Bacteria 4071
140 Ga0070672_100083790 3300005543 Bacteria 2559
141 Ga0070672_100135692 3300005543 Bacteria 2026
142 Ga0070672_100164454 3300005543 Bacteria 1843
143 Ga0070672_100381934 3300005543 Bacteria 1205
144 Ga0070672_100715087 3300005543 Bacteria 877
145 Ga0070686_100037699 3300005544 Bacteria 3000
146 Ga0070686_100041373 3300005544 Bacteria 2880
147 Ga0070665_100289365 3300005548 Bacteria 1641
148 Ga0070665_100983163 3300005548 Unclassified 856
149 Ga0070665_101296901 3300005548 Unclassified 738
150 Ga0070704_100460810 3300005549 Bacteria 1096
151 Ga0070704_100815904 3300005549 Bacteria 834
152 Ga0068855_101071243 3300005563 Unclassified 844
153 Ga0068855_101073201 3300005563 Bacteria 843
154 Ga0070664_100001137 3300005564 Bacteria 21035
155 Ga0070664_100003013 3300005564 Bacteria 13617
156 Ga0070664_100056457 3300005564 Bacteria 3336
157 Ga0070664_102201636 3300005564 Bacteria 523
158 Ga0068857_100001716 3300005577 Bacteria 17629
159 Ga0068857_100196354 3300005577 Bacteria 1839
160 Ga0068857_100342736 3300005577 Bacteria 1383
161 Ga0068857_100774592 3300005577 Unclassified 915
162 Ga0068857_102064063 3300005577 Bacteria 559
163 Ga0068854_100166429 3300005578 Bacteria 1712
164 Ga0068854_100411413 3300005578 Bacteria 1121
165 Ga0068856_100285973 3300005614 Bacteria 1666
166 Ga0068856_100419678 3300005614 Bacteria 1358
167 Ga0070702_100007150 3300005615 Bacteria 5332
168 Ga0070702_100249024 3300005615 Unclassified 1203
169 Ga0068852_100007485 3300005616 Bacteria 7971
170 Ga0068852_100033007 3300005616 Bacteria 4293
171 Ga0068852_100079407 3300005616 Bacteria 2906
172 Ga0068852_100130404 3300005616 Bacteria 2314
173 Ga0068852_100209319 3300005616 Bacteria 1849
174 Ga0068852_100302890 3300005616 Bacteria 1547
175 Ga0068852_100571807 3300005616 Bacteria 1132
176 Ga0068852_101940801 3300005616 Bacteria 611
177 Ga0068859_100016441 3300005617 Bacteria 7431
178 Ga0068859_100135963 3300005617 Bacteria 2531
179 Ga0068859_100389313 3300005617 Bacteria 1490
180 Ga0068859_100563242 3300005617 Bacteria 1234
181 Ga0068859_101442173 3300005617 Unclassified 759
182 Ga0068859_101599148 3300005617 Bacteria 720
183 Ga0068859_102410511 3300005617 Unclassified 580
184 Ga0068864_100222731 3300005618 Bacteria 1741
185 Ga0068864_100268024 3300005618 Bacteria 1590
186 Ga0068864_100384987 3300005618 Bacteria 1330
187 Ga0068864_100735807 3300005618 Bacteria 966
188 Ga0068864_100842891 3300005618 Unclassified 903
189 Ga0068864_100858915 3300005618 Bacteria 894
190 Ga0068866_10032849 3300005718 Bacteria 2512
191 Ga0068861_100100355 3300005719 Bacteria 2300
192 Ga0068861_100109099 3300005719 Bacteria 2215
193 Ga0068861_101774520 3300005719 Bacteria 611
194 Ga0068851_10000072 3300005834 Bacteria 57370
195 Ga0068851_10076116 3300005834 Bacteria 1745
196 Ga0068851_10171215 3300005834 Bacteria 1198
197 Ga0068851_10609589 3300005834 Bacteria 665
198 Ga0068870_10093875 3300005840 Bacteria 1683
199 Ga0068870_10101857 3300005840 Bacteria 1624
200 Ga0068870_10206300 3300005840 Bacteria 1194
201 Ga0068870_10238087 3300005840 Bacteria 1122
202 Ga0068870_10315638 3300005840 Bacteria 991
203 Ga0068863_100008733 3300005841 Bacteria 9895
204 Ga0068863_100293521 3300005841 Unclassified 1576
205 Ga0068863_100702162 3300005841 Bacteria 1005
206 Ga0068858_100075507 3300005842 Bacteria 3131
207 Ga0068858_100218978 3300005842 Bacteria 1802
208 Ga0068858_100520807 3300005842 Bacteria 1150
209 Ga0068860_100011727 3300005843 Bacteria 8637
210 Ga0068860_100054837 3300005843 Bacteria 3788
211 Ga0068860_100100474 3300005843 Bacteria 2760
212 Ga0068860_100288538 3300005843 Bacteria 1605
213 Ga0068860_100780097 3300005843 Bacteria 968
214 Ga0068862_100176021 3300005844 Bacteria 1918
215 Ga0068862_100394910 3300005844 Bacteria 1293
216 Ga0068862_101139270 3300005844 Bacteria 776
217 Ga0070717_10850484 3300006028 Bacteria 830
218 Ga0070715_10346453 3300006163 Bacteria 810
219 Ga0097621_100008970 3300006237 Bacteria 7234
220 Ga0097621_100061486 3300006237 Bacteria 3081
221 Ga0097621_100255991 3300006237 Bacteria 1534
222 Ga0068871_100093920 3300006358 Bacteria 2503
223 Ga0068871_100276881 3300006358 Bacteria 1467
224 Ga0068871_100341845 3300006358 Bacteria 1322
225 Ga0068871_100561723 3300006358 Bacteria 1034
226 Ga0075428_100928658 3300006844 Bacteria 922
227 Ga0075429_100441428 3300006880 Bacteria 1140
228 Ga0075429_100535334 3300006880 Bacteria 1027
229 Ga0068865_100291190 3300006881 Bacteria 1303
230 Ga0068865_100309166 3300006881 Bacteria 1268
231 Ga0068865_100491570 3300006881 Bacteria 1021
232 Ga0097620_100016441 3300006931 Bacteria 7431
233 Ga0097620_100135965 3300006931 Bacteria 2531
234 Ga0097620_100389319 3300006931 Bacteria 1490
235 Ga0097620_100563205 3300006931 Bacteria 1234
236 Ga0097620_101442215 3300006931 Unclassified 759
237 Ga0097620_101599154 3300006931 Bacteria 720
238 Ga0097620_102410578 3300006931 Unclassified 580
239 Ga0111539_10718755 3300009094 Bacteria 1163
240 Ga0105247_10004404 3300009101 Bacteria 8986
241 Ga0105247_10016725 3300009101 Bacteria 4398
242 Ga0105243_10398155 3300009148 Bacteria 1278
243 Ga0105241_10440903 3300009174 Bacteria 1150
244 Ga0105242_10499138 3300009176 Unclassified 1157
245 Ga0105242_10576529 3300009176 Bacteria 1083
246 Ga0105248_10153330 3300009177 Bacteria 2599
247 Ga0105237_10663394 3300009545 Bacteria 1050
248 Ga0105238_10409263 3300009551 Bacteria 1350
249 Ga0105249_10000762 3300009553 Bacteria 28926
250 Ga0105249_10053326 3300009553 Bacteria 3697
251 Ga0105249_10382863 3300009553 Bacteria 1433
252 Ga0105249_10922785 3300009553 Unclassified 940
253 Ga0105249_10981964 3300009553 Bacteria 913
254 Ga0105249_11521844 3300009553 Bacteria 741
255 Ga0105239_10662477 3300010375 Bacteria 1192
256 Ga0105239_10724578 3300010375 Bacteria 1138
257 Ga0105246_10276435 3300011119 Bacteria 1345
258 Ga0105246_11103996 3300011119 Bacteria 724
259 Ga0157373_10174789 3300013100 Unclassified 1511
260 Ga0157373_10252614 3300013100 Bacteria 1247
261 Ga0157371_10015329 3300013102 Bacteria 5753
262 Ga0157371_10176316 3300013102 Bacteria 1528
263 Ga0157370_10424994 3300013104 Bacteria 1222
264 Ga0157370_10475281 3300013104 Bacteria 1149
265 Ga0157370_10873099 3300013104 Bacteria 817
266 Ga0157369_10186796 3300013105 Bacteria 2179
267 Ga0157369_10410781 3300013105 Bacteria 1404
268 Ga0157374_10037538 3300013296 Bacteria 4447
269 Ga0157374_10166571 3300013296 Bacteria 2148
270 Ga0157374_10418726 3300013296 Bacteria 1338
271 Ga0157374_10913959 3300013296 Bacteria 895
272 Ga0157374_10989705 3300013296 Bacteria 860
273 Ga0157374_11608026 3300013296 Bacteria 674
274 Ga0157378_10000709 3300013297 Bacteria 31237
275 Ga0157378_10068340 3300013297 Bacteria 3186
276 Ga0157378_10137489 3300013297 Bacteria 2266
277 Ga0157378_10273642 3300013297 Bacteria 1625
278 Ga0157378_10290041 3300013297 Bacteria 1580
279 Ga0157378_10477167 3300013297 Bacteria 1242
280 Ga0157378_10761286 3300013297 Unclassified 992
281 Ga0157378_10913434 3300013297 Bacteria 909
282 Ga0163162_10061543 3300013306 Bacteria 3791
283 Ga0163162_10220927 3300013306 Bacteria 2025
284 Ga0163162_10284284 3300013306 Bacteria 1786
285 Ga0163162_10554883 3300013306 Bacteria 1277
286 Ga0163162_10579720 3300013306 Bacteria 1249
287 Ga0163162_10855707 3300013306 Bacteria 1024
288 Ga0157372_10044094 3300013307 Bacteria 4941
289 Ga0157372_10138196 3300013307 Bacteria 2807
290 Ga0157372_10244080 3300013307 Unclassified 2084
291 Ga0157372_10326210 3300013307 Bacteria 1787
292 Ga0157372_10428260 3300013307 Bacteria 1542
293 Ga0157372_10474095 3300013307 Bacteria 1459
294 Ga0157372_10517117 3300013307 Bacteria 1392
295 Ga0157372_10618753 3300013307 Bacteria 1262
296 Ga0157372_10757105 3300013307 Bacteria 1129
297 Ga0157372_10792845 3300013307 Bacteria 1101
298 Ga0157372_11045870 3300013307 Bacteria 945
299 Ga0157372_11110776 3300013307 Unclassified 914
300 Ga0157372_11227177 3300013307 Bacteria 866
301 Ga0157372_12699953 3300013307 Bacteria 570
302 Ga0157372_13011144 3300013307 Bacteria 539
303 Ga0157375_10029892 3300013308 Bacteria 5130
304 Ga0157375_10376446 3300013308 Bacteria 1586
305 Ga0157375_10872534 3300013308 Bacteria 1045
306 Ga0157375_11251820 3300013308 Bacteria 871
307 Ga0163163_10121634 3300014325 Bacteria 2644
308 Ga0163163_10194683 3300014325 Bacteria 2075
309 Ga0163163_10252665 3300014325 Bacteria 1813
310 Ga0163163_10262306 3300014325 Bacteria 1779
311 Ga0163163_10391609 3300014325 Bacteria 1447
312 Ga0163163_12588917 3300014325 Bacteria 565
313 Ga0157380_10000874 3300014326 Bacteria 18967
314 Ga0157380_10013298 3300014326 Bacteria 5995
315 Ga0157380_10257186 3300014326 Bacteria 1584
316 Ga0157380_10908337 3300014326 Bacteria 907
317 Ga0157380_11531965 3300014326 Bacteria 720
318 Ga0157377_10060773 3300014745 Bacteria 2158
319 Ga0157377_10202564 3300014745 Bacteria 1261
320 Ga0157377_10518518 3300014745 Bacteria 836
321 Ga0157379_10209045 3300014968 Bacteria 1766
322 Ga0157379_10258653 3300014968 Bacteria 1581
323 Ga0157379_10283108 3300014968 Bacteria 1509
324 Ga0157379_10285786 3300014968 Unclassified 1501
325 Ga0157379_11148254 3300014968 Unclassified 745
326 Ga0157376_10007683 3300014969 Bacteria 7723
327 Ga0157376_10102537 3300014969 Bacteria 2503
328 Ga0157376_10305732 3300014969 Bacteria 1507
329 Ga0157376_10597794 3300014969 Bacteria 1098
330 Ga0157376_11238256 3300014969 Bacteria 775
331 Ga0163161_10496688 3300017792 Bacteria 993
332 Ga0209646_1000005 3300025246 Bacteria 717627
333 Ga0209026_1000149 3300025250 Bacteria 111200
334 Ga0209758_1001581 3300025297 Bacteria 26032
335 Ga0207426_1000262 3300025302 Bacteria 111889
336 Ga0207697_10025736 3300025315 Bacteria 2405
337 Ga0207656_10000716 3300025321 Bacteria 10852
338 Ga0207656_10044821 3300025321 Bacteria 1890
339 Ga0207656_10187613 3300025321 Bacteria 994
340 Ga0207656_10236554 3300025321 Unclassified 891
341 Ga0207656_10649895 3300025321 Unclassified 539
342 Ga0207682_10240664 3300025893 Bacteria 841
343 Ga0207710_10021802 3300025900 Bacteria 2748
344 Ga0207688_10022908 3300025901 Bacteria 3419
345 Ga0207688_10078834 3300025901 Bacteria 1878
346 Ga0207680_10253374 3300025903 Bacteria 1216
347 Ga0207680_11280208 3300025903 Bacteria 522
348 Ga0207647_10000054 3300025904 Bacteria 86704
349 Ga0207645_10001414 3300025907 Bacteria 19668
350 Ga0207645_10024138 3300025907 Bacteria 3945
351 Ga0207645_10458274 3300025907 Bacteria 861
352 Ga0207643_10017772 3300025908 Bacteria 3893
353 Ga0207643_10380320 3300025908 Unclassified 890
354 Ga0207643_10781610 3300025908 Unclassified 618
355 Ga0207705_10017945 3300025909 Bacteria 5061
356 Ga0207705_10038550 3300025909 Bacteria 3422
357 Ga0207654_10165422 3300025911 Unclassified 1432
358 Ga0207695_11155231 3300025913 Bacteria 654
359 Ga0207660_10110671 3300025917 Bacteria 2066
360 Ga0207662_10014557 3300025918 Bacteria 4416
361 Ga0207662_10189665 3300025918 Bacteria 1326
362 Ga0207657_10090557 3300025919 Bacteria 2553
363 Ga0207657_10318804 3300025919 Bacteria 1229
364 Ga0207649_10012497 3300025920 Bacteria 4714
365 Ga0207649_11430612 3300025920 Bacteria 547
366 Ga0207652_10018316 3300025921 Bacteria 5743
367 Ga0207681_10247116 3300025923 Bacteria 1391
368 Ga0207681_10261038 3300025923 Bacteria 1356
369 Ga0207681_10323972 3300025923 Bacteria 1226
370 Ga0207681_10844281 3300025923 Bacteria 766
371 Ga0207681_11103113 3300025923 Bacteria 666
372 Ga0207650_10002829 3300025925 Bacteria 11981
373 Ga0207650_10052505 3300025925 Bacteria 3020
374 Ga0207650_10057904 3300025925 Bacteria 2883
375 Ga0207650_10062055 3300025925 Bacteria 2792
376 Ga0207650_10077427 3300025925 Bacteria 2514
377 Ga0207650_10303053 3300025925 Bacteria 1305
378 Ga0207650_10414595 3300025925 Bacteria 1117
379 Ga0207650_11656771 3300025925 Bacteria 542
380 Ga0207650_11908688 3300025925 Bacteria 502
381 Ga0207659_11335390 3300025926 Bacteria 615
382 Ga0207644_10010486 3300025931 Bacteria 6108
383 Ga0207644_10213757 3300025931 Bacteria 1526
384 Ga0207644_10247387 3300025931 Bacteria 1421
385 Ga0207644_10257732 3300025931 Bacteria 1394
386 Ga0207644_10363033 3300025931 Bacteria 1178
387 Ga0207644_10838977 3300025931 Unclassified 769
388 Ga0207690_10003583 3300025932 Bacteria 9247
389 Ga0207690_10121607 3300025932 Bacteria 1897
390 Ga0207690_10737211 3300025932 Bacteria 812
391 Ga0207706_10132112 3300025933 Bacteria 2196
392 Ga0207706_10207931 3300025933 Bacteria 1716
393 Ga0207706_10764544 3300025933 Bacteria 822
394 Ga0207686_10000863 3300025934 Bacteria 18417
395 Ga0207686_10302380 3300025934 Bacteria 1188
396 Ga0207686_10362798 3300025934 Bacteria 1094
397 Ga0207686_11096882 3300025934 Bacteria 649
398 Ga0207670_10593985 3300025936 Bacteria 908
399 Ga0207669_10216620 3300025937 Bacteria 1402
400 Ga0207669_10287032 3300025937 Bacteria 1244
401 Ga0207704_10433361 3300025938 Bacteria 1045
402 Ga0207691_10007955 3300025940 Bacteria 10200
403 Ga0207691_10089266 3300025940 Bacteria 2764
404 Ga0207691_10120619 3300025940 Bacteria 2324
405 Ga0207691_10771262 3300025940 Bacteria 809
406 Ga0207711_10110099 3300025941 Bacteria 2448
407 Ga0207689_10239230 3300025942 Bacteria 1501
408 Ga0207689_11465250 3300025942 Bacteria 571
409 Ga0207661_10006150 3300025944 Bacteria 8484
410 Ga0207661_10137810 3300025944 Bacteria 2097
411 Ga0207661_10847201 3300025944 Bacteria 842
412 Ga0207679_10000777 3300025945 Bacteria 20886
413 Ga0207679_10033880 3300025945 Bacteria 3598
414 Ga0207679_10363725 3300025945 Bacteria 1264
415 Ga0207651_10013586 3300025960 Bacteria 4666
416 Ga0207651_10023535 3300025960 Bacteria 3792
417 Ga0207651_10112459 3300025960 Bacteria 2047
418 Ga0207651_10165654 3300025960 Bacteria 1737
419 Ga0207651_10169433 3300025960 Bacteria 1721
420 Ga0207651_10305387 3300025960 Bacteria 1325
421 Ga0207651_10686151 3300025960 Bacteria 901
422 Ga0207651_10697672 3300025960 Bacteria 894
423 Ga0207712_10003245 3300025961 Bacteria 10332
424 Ga0207712_10131798 3300025961 Bacteria 1906
425 Ga0207712_10272490 3300025961 Bacteria 1378
426 Ga0207668_10142924 3300025972 Bacteria 1843
427 Ga0207668_10570103 3300025972 Bacteria 983
428 Ga0207668_10621375 3300025972 Bacteria 943
429 Ga0207640_10238928 3300025981 Bacteria 1403
430 Ga0207640_10396375 3300025981 Bacteria 1123
431 Ga0207658_10224740 3300025986 Bacteria 1581
432 Ga0207658_10429834 3300025986 Bacteria 1166
433 Ga0207658_10453946 3300025986 Bacteria 1135
434 Ga0207658_10616872 3300025986 Bacteria 975
435 Ga0207677_10009244 3300026023 Bacteria 5537
436 Ga0207677_10056668 3300026023 Bacteria 2686
437 Ga0207677_10300722 3300026023 Bacteria 1325
438 Ga0207677_11287624 3300026023 Bacteria 671
439 Ga0207703_10101147 3300026035 Bacteria 2444
440 Ga0207703_10225221 3300026035 Bacteria 1679
441 Ga0207639_10048916 3300026041 Bacteria 3203
442 Ga0207639_10100749 3300026041 Bacteria 2334
443 Ga0207639_10932318 3300026041 Bacteria 812
444 Ga0207639_11055454 3300026041 Bacteria 761
445 Ga0207639_11145788 3300026041 Bacteria 730
446 Ga0207639_11211482 3300026041 Bacteria 708
447 Ga0207678_10242081 3300026067 Bacteria 1545
448 Ga0207678_10878619 3300026067 Bacteria 792
449 Ga0207708_10233885 3300026075 Bacteria 1476
450 Ga0207708_11018375 3300026075 Bacteria 720
451 Ga0207641_10001211 3300026088 Bacteria 25807
452 Ga0207641_10019514 3300026088 Bacteria 5565
453 Ga0207641_10390897 3300026088 Unclassified 1334
454 Ga0207648_10003106 3300026089 Bacteria 17541
455 Ga0207648_10135503 3300026089 Bacteria 2169
456 Ga0207648_10258930 3300026089 Bacteria 1552
457 Ga0207676_10227994 3300026095 Bacteria 1663
458 Ga0207676_10355481 3300026095 Bacteria 1356
459 Ga0207676_10480386 3300026095 Bacteria 1177
460 Ga0207674_10003303 3300026116 Bacteria 19833
461 Ga0207674_10117029 3300026116 Bacteria 2636
462 Ga0207674_10212768 3300026116 Bacteria 1882
463 Ga0207674_10286027 3300026116 Bacteria 1597
464 Ga0207674_10488144 3300026116 Bacteria 1190
465 Ga0207675_100011319 3300026118 Bacteria 8350
466 Ga0207675_100034745 3300026118 Bacteria 4702
467 Ga0207675_100083149 3300026118 Bacteria 3002
468 Ga0207675_100136931 3300026118 Bacteria 2324
469 Ga0207675_100247006 3300026118 Bacteria 1726
470 Ga0207675_100390747 3300026118 Bacteria 1369
471 Ga0207675_101502595 3300026118 Bacteria 694
472 Ga0207683_10020343 3300026121 Bacteria 5674
473 Ga0207683_10052752 3300026121 Bacteria 3564
474 Ga0207683_10243714 3300026121 Bacteria 1640
475 Ga0207683_10324679 3300026121 Unclassified 1410
476 Ga0207683_11561917 3300026121 Bacteria 609
477 Ga0207698_10083962 3300026142 Bacteria 2580
478 Ga0207698_10808450 3300026142 Bacteria 940
479 Ga0207698_11066675 3300026142 Bacteria 820
480 Ga0207698_11349549 3300026142 Unclassified 728
481 Ga0207698_11807489 3300026142 Bacteria 626
482 Ga0209995_1014434 3300027471 Bacteria 1295
483 Ga0209999_1096173 3300027543 Bacteria 575
484 Ga0209983_1028476 3300027665 Bacteria 1185
485 Ga0209974_10016908 3300027876 Bacteria 2421
486 Ga0207428_10385848 3300027907 Bacteria 1027
487 Ga0268266_10459686 3300028379 Bacteria 1211
488 Ga0268264_10016695 3300028381 Bacteria 6010
489 Ga0268264_10017783 3300028381 Bacteria 5819
490 Ga0268264_10057876 3300028381 Bacteria 3243
491 Ga0268264_10148290 3300028381 Bacteria 2100
492 Ga0268264_11456281 3300028381 Bacteria 695
493 Ga0307515_10000107 3300028794 Bacteria 197046
494 Ga0307515_10542041 3300028794 Bacteria 773
495 Ga0307513_10335612 3300031456 Bacteria 1264
496 Ga0307513_11009219 3300031456 Bacteria 542
497 Ga0307508_10003038 3300031616 Bacteria 17271
498 Ga0307413_10219491 3300031824 Bacteria 1388
499 Ga0307413_11341476 3300031824 Bacteria 627
500 Ga0307410_10037090 3300031852 Bacteria 3181
501 Ga0307410_10770696 3300031852 Bacteria 816
502 Ga0307406_10261768 3300031901 Bacteria 1309
503 Ga0307406_10308655 3300031901 Bacteria 1219
504 Ga0307407_10997343 3300031903 Unclassified 647
505 Ga0307412_10105983 3300031911 Bacteria 1998
506 Ga0307412_10410821 3300031911 Bacteria 1105
507 Ga0307416_100422092 3300032002 Bacteria 1378
508 Ga0307416_101860172 3300032002 Bacteria 706
509 Ga0307414_10264235 3300032004 Bacteria 1438
510 Ga0307414_10264994 3300032004 Bacteria 1436
511 Ga0307414_10407248 3300032004 Bacteria 1183
512 Ga0307414_10578044 3300032004 Bacteria 1005
513 Ga0307411_10217493 3300032005 Bacteria 1480
514 Ga0307415_100745818 3300032126 Bacteria 888
515 Ga0307415_101605608 3300032126 Unclassified 625
516 Ga0316592_1055522 3300033524 Unclassified 886
517 Ga0373923_0269620 3300035111 Bacteria 800
518 Ga0373943_0285807 3300035170 Bacteria 934
519 Ga0373946_0047656 3300035171 Bacteria 1781
520 Ga0316574_0581976 3300035398 Unclassified 693
521 Ga0373937_0420990 3300036401 Bacteria 1268
522 Ga0373937_0597281 3300036401 Bacteria 1048
523 Ga0395899_0443656 3300037312 Bacteria 851
524 Ga0395900_0079402 3300037418 Bacteria 3372
525 Ga0395900_0430316 3300037418 Bacteria 1279
526 Ga0395900_0965694 3300037418 Bacteria 773
527 Ga0395898_0081787 3300037466 Bacteria 3114
528 Ga0395898_0194299 3300037466 Bacteria 1939
529 Ga0395905_0001345 3300037471 Bacteria 29943
530 Ga0395905_0037653 3300037471 Bacteria 4540
531 Ga0395905_0647072 3300037471 Bacteria 959
532 Ga0395901_0183308 3300038443 Bacteria 2196
533 Ga0395901_1211781 3300038443 Bacteria 720
534 Ga0436365_0430263 3300039437 Bacteria 1592
535 Ga0436365_1637134 3300039437 Bacteria 28226
536 Ga0436362_0581654 3300039453 Bacteria 1075
537 Ga0439439_0197426 3300041406 Bacteria 584
538 Ga0439465_0053797 3300041413 Bacteria 1323
539 Ga0439465_0212242 3300041413 Bacteria 708
540 Ga0451802_1114912 3300041460 Bacteria 683
541 Ga0439431_0001403 3300041997 Bacteria 5316
542 Ga0439431_0027658 3300041997 Bacteria 1394
543 Ga0439445_0092823 3300042004 Bacteria 851
544 Ga0439449_0005016 3300042007 Bacteria 5092
545 Ga0439452_091255 3300042010 Bacteria 658
546 Ga0439457_011115 3300042014 Bacteria 2055
547 Ga0450923_011615 3300042125 Bacteria 1587
548 Ga0450897_002854 3300042128 Bacteria 1338
549 Ga0450894_011226 3300042131 Bacteria 1165
550 Ga0450894_062496 3300042131 Bacteria 562
551 Ga0450895_019461 3300042132 Bacteria 624
552 Ga0450898_003372 3300042134 Bacteria 2293
553 Ga0450899_001053 3300042135 Bacteria 3129
554 Ga0439434_0257936 3300042435 Bacteria 597
555 Ga0451577_0039713 3300042876 Bacteria 4229
556 Ga0451577_0050025 3300042876 Bacteria 3731
557 Ga0451577_0147383 3300042876 Bacteria 2117
558 Ga0453684_0021943 3300044712 Bacteria 9502
559 Ga0453684_0047019 3300044712 Bacteria 5729
560 Ga0453684_0072019 3300044712 Bacteria 4365
561 Ga0466970_0477166 3300044765 Bacteria 717
562 Ga0466959_0047185 3300045049 Bacteria 3169
563 Ga0451576_0714991 3300045051 Bacteria 1052
564 Ga0451576_1311102 3300045051 Unclassified 755
565 Ga0466967_0403282 3300045976 Bacteria 1331
566 Ga0495629_0075510 3300046459 Bacteria 2354
567 Ga0495594_0084891 3300046499 Bacteria 1771
568 Ga0495663_0024713 3300046525 Bacteria 1748
569 Ga0495652_0479586 3300046529 Bacteria 866
570 Ga0495598_0146920 3300046537 Bacteria 820
571 Ga0495598_0163267 3300046537 Unclassified 785
572 Ga0495621_0052447 3300046539 Bacteria 1462
573 Ga0495656_0331411 3300046615 Bacteria 786
574 Ga0495625_0049951 3300046660 Bacteria 3004
575 Ga0495647_0181544 3300046681 Bacteria 916
576 Ga0495670_0042608 3300046691 Bacteria 2265
577 Ga0495649_0213035 3300046694 Bacteria 1001
578 Ga0495672_0082899 3300047320 Bacteria 1782
579 Ga0495615_0015991 3300048090 Bacteria 1612
580 Ga0496114_0197382 3300048917 Bacteria 1762
581 Ga0501306_062139 3300049127 Bacteria 617
582 Ga0501309_009493 3300049129 Bacteria 1242
583 Ga0501309_072973 3300049129 Bacteria 566
584 Ga0501309_083319 3300049129 Bacteria 538
585 Ga0501309_085695 3300049129 Bacteria 533
586 Ga0501305_011154 3300049161 Bacteria 1210
587 Ga0501305_065677 3300049161 Bacteria 631
588 Ga0501307_005180 3300049162 Bacteria 1365
589 Ga0501307_007686 3300049162 Bacteria 1194
590 Ga0501307_012219 3300049162 Bacteria 1019
591 Ga0501342_03950 3300049163 Bacteria 536
592 Ga0501292_033515 3300049515 Bacteria 870
593 Ga0501296_010317 3300049519 Bacteria 1106
594 Ga0501298_002358 3300049521 Bacteria 2851
595 Ga0501299_045504 3300049522 Unclassified 893
596 Ga0501311_007156 3300049527 Bacteria 1279
597 Ga0501311_030577 3300049527 Bacteria 778
598 Ga0501312_013093 3300049528 Bacteria 1149
599 Ga0501313_008796 3300049529 Bacteria 1130
600 Ga0501313_012655 3300049529 Bacteria 985
601 Ga0501313_029005 3300049529 Bacteria 712
602 Ga0501314_029912 3300049530 Bacteria 601
603 Ga0501315_008641 3300049531 Bacteria 1188
604 Ga0501315_009328 3300049531 Bacteria 1158
605 Ga0501315_016198 3300049531 Bacteria 963
606 Ga0501315_017676 3300049531 Bacteria 934
607 Ga0501315_085496 3300049531 Bacteria 541
608 Ga0501316_005577 3300049532 Bacteria 1310
609 Ga0501316_009012 3300049532 Bacteria 1112
610 Ga0501316_011551 3300049532 Bacteria 1020
611 Ga0501316_039908 3300049532 Bacteria 652
612 Ga0501317_054896 3300049533 Bacteria 641
613 Ga0501323_008601 3300049539 Bacteria 1188
614 Ga0501323_008879 3300049539 Bacteria 1175
615 Ga0501325_009730 3300049541 Bacteria 859
616 Ga0501330_016179 3300049546 Bacteria 572
617 Ga0501333_005926 3300049549 Bacteria 802
618 Ga0501335_005974 3300049551 Bacteria 1098
619 Ga0501335_006644 3300049551 Bacteria 1058
620 Ga0501335_009232 3300049551 Bacteria 938
621 Ga0501336_006843 3300049552 Bacteria 854
622 Ga0501033_0162329 3300049570 Unclassified 1608
623 Ga0501034_0008676 3300049571 Bacteria 10710
624 Ga0501034_0144438 3300049571 Bacteria 2357
625 Ga0501038_0908087 3300049574 Bacteria 650
626 Ga0501039_0969830 3300049575 Bacteria 661
627 Ga0501043_0058310 3300049579 Bacteria 3031
628 Ga0501070_0757822 3300049586 Bacteria 765
629 Ga0501198_001163 3300049649 Bacteria 3372
630 Ga0501201_034416 3300049651 Bacteria 589
631 Ga0501202_009450 3300049652 Bacteria 1793
632 Ga0501202_032440 3300049652 Bacteria 1096
633 Ga0501206_002023 3300049653 Bacteria 2558
634 Ga0501207_063747 3300049654 Bacteria 680
635 Ga0501207_142814 3300049654 Bacteria 511
636 Ga0501209_086777 3300049656 Bacteria 907
637 Ga0501217_000031 3300049661 Bacteria 15253
638 Ga0501217_011991 3300049661 Bacteria 1925
639 Ga0501217_145278 3300049661 Bacteria 705
640 Ga0501223_004205 3300049663 Bacteria 3101
641 Ga0501223_125109 3300049663 Bacteria 545
642 Ga0501224_013830 3300049664 Bacteria 1192
643 Ga0501227_079921 3300049665 Bacteria 856
644 Ga0501240_013770 3300049673 Bacteria 1127
645 Ga0501240_038286 3300049673 Bacteria 790
646 Ga0501242_006955 3300049674 Bacteria 1298
647 Ga0501243_001794 3300049675 Bacteria 3107
648 Ga0501243_086756 3300049675 Bacteria 616
649 Ga0501252_003521 3300049682 Bacteria 1618
650 Ga0501252_045311 3300049682 Unclassified 650
651 Ga0501257_007538 3300049686 Bacteria 2431
652 Ga0501259_030282 3300049688 Unclassified 1017
653 Ga0501259_037766 3300049688 Bacteria 938
654 Ga0501261_002234 3300049690 Bacteria 2377
655 Ga0501261_048851 3300049690 Unclassified 688
656 Ga0501221_000508 3300049704 Bacteria 6138
657 Ga0501221_044974 3300049704 Bacteria 977
658 Ga0501225_0022573 3300049705 Bacteria 1737
659 Ga0501225_0030890 3300049705 Bacteria 1474
660 Ga0501234_018179 3300049707 Bacteria 1112
661 Ga0501234_031464 3300049707 Bacteria 858
662 Ga0501245_007144 3300049708 Bacteria 1575
663 Ga0501245_034476 3300049708 Bacteria 849
664 Ga0501265_041518 3300049762 Bacteria 697
665 Ga0501266_000514 3300049763 Bacteria 5125
666 Ga0501272_020900 3300049769 Bacteria 786
667 Ga0501272_032026 3300049769 Bacteria 672
668 Ga0501035_0151808 3300049822 Bacteria 2010
669 Ga0501044_0079878 3300049823 Bacteria 3313
670 Ga0501044_0452746 3300049823 Unclassified 1190
671 Ga0501044_0457812 3300049823 Bacteria 1181
672 nmdc:mga07m45_155622_c1 3300050496 Bacteria 1326
673 nmdc:mga09592_416206_c1 3300050508 Bacteria 1161
674 nmdc:mga08y16_318686_c1 3300050511 Bacteria 1601
675 Ga0500646_0005972 3300053090 Bacteria 3089
676 Ga0500646_0010977 3300053090 Bacteria 2327
677 Ga0500658_0005944 3300053134 Bacteria 4539
678 Ga0500588_0011805 3300053146 Bacteria 2149
679 Ga0587073_0056738 3300059492 Bacteria 905
680 Ga0587090_128716 3300059510 Unclassified 556
681 Ga0587079_007677 3300059647 Bacteria 1622

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005293 Ga0065715_10151075 Ga0065715_101510752 119
2 3300005333 Ga0070677_10013175 Ga0070677_100131753 119
3 3300005347 Ga0070668_100175198 Ga0070668_1001751983 119
4 3300005354 Ga0070675_100027766 Ga0070675_1000277661 119
5 3300005356 Ga0070674_100158733 Ga0070674_1001587333 119
6 3300005364 Ga0070673_101063981 Ga0070673_1010639812 119
7 3300005459 Ga0068867_100109447 Ga0068867_1001094472 119
8 3300005543 Ga0070672_100030162 Ga0070672_1000301623 119
9 3300005618 Ga0068864_100384987 Ga0068864_1003849871 119
10 3300005719 Ga0068861_100109099 Ga0068861_1001090993 119
11 3300005840 Ga0068870_10093875 Ga0068870_100938752 119
12 3300013308 Ga0157375_10872534 Ga0157375_108725342 119
13 3300014326 Ga0157380_10908337 Ga0157380_109083372 119
14 3300025925 Ga0207650_10414595 Ga0207650_104145951 119
15 3300005355 Ga0070671_100705004 Ga0070671_1007050042 123
16 3300006237 Ga0097621_100061486 Ga0097621_1000614864 123
17 3300006358 Ga0068871_100341845 Ga0068871_1003418454 123
18 3300013297 Ga0157378_10290041 Ga0157378_102900413 123
19 3300025931 Ga0207644_10257732 Ga0207644_102577323 123
20 3300026121 Ga0207683_10243714 Ga0207683_102437143 123
21 3300049708 Ga0501245_007144 Ga0501245_007144_490_909 127
22 3300005436 Ga0070713_102208574 Ga0070713_1022085741 133
23 3300049531 Ga0501315_017676 Ga0501315_017676_313_726 133
24 3300025932 Ga0207690_10737211 Ga0207690_107372112 134
25 3300005290 Ga0065712_10022972 Ga0065712_100229722 135
26 3300005330 Ga0070690_100147837 Ga0070690_1001478371 135
27 3300005340 Ga0070689_100728765 Ga0070689_1007287651 135
28 3300005343 Ga0070687_100060322 Ga0070687_1000603222 135
29 3300005345 Ga0070692_10152686 Ga0070692_101526861 135
30 3300005364 Ga0070673_101037251 Ga0070673_1010372511 135
31 3300005365 Ga0070688_100411196 Ga0070688_1004111962 135
32 3300005466 Ga0070685_10240624 Ga0070685_102406243 135
33 3300005544 Ga0070686_100041373 Ga0070686_1000413731 135
34 3300005616 Ga0068852_100209319 Ga0068852_1002093191 135
35 3300005719 Ga0068861_101774520 Ga0068861_1017745201 135
36 3300005834 Ga0068851_10171215 Ga0068851_101712153 135
37 3300005841 Ga0068863_100702162 Ga0068863_1007021622 135
38 3300005842 Ga0068858_100218978 Ga0068858_1002189782 135
39 3300006237 Ga0097621_100255991 Ga0097621_1002559913 135
40 3300006358 Ga0068871_100093920 Ga0068871_1000939203 135
41 3300006844 Ga0075428_100928658 Ga0075428_1009286582 135
42 3300009177 Ga0105248_10153330 Ga0105248_101533303 135
43 3300009551 Ga0105238_10409263 Ga0105238_104092633 135
44 3300009553 Ga0105249_11521844 Ga0105249_115218441 135
45 3300013306 Ga0163162_10061543 Ga0163162_100615434 135
46 3300013306 Ga0163162_10554883 Ga0163162_105548833 135
47 3300013308 Ga0157375_10376446 Ga0157375_103764462 135
48 3300014325 Ga0163163_12588917 Ga0163163_125889171 135
49 3300014968 Ga0157379_10258653 Ga0157379_102586533 135
50 3300025321 Ga0207656_10044821 Ga0207656_100448212 135
51 3300025934 Ga0207686_10000863 Ga0207686_1000086319 135
52 3300025941 Ga0207711_10110099 Ga0207711_101100993 135
53 3300025961 Ga0207712_10131798 Ga0207712_101317983 135
54 3300026088 Ga0207641_10001211 Ga0207641_1000121123 135
55 3300026095 Ga0207676_10227994 Ga0207676_102279943 135
56 3300026118 Ga0207675_100034745 Ga0207675_1000347455 135
57 3300046459 Ga0495629_0075510 Ga0495629_0075510_865_1311 135
58 3300046499 Ga0495594_0084891 Ga0495594_0084891_1107_1553 135
59 3300046681 Ga0495647_0181544 Ga0495647_0181544_249_695 135
60 3300046694 Ga0495649_0213035 Ga0495649_0213035_202_648 135
61 3300014969 Ga0157376_10597794 Ga0157376_105977942 136
62 3300025903 Ga0207680_11280208 Ga0207680_112802081 136
63 3300046660 Ga0495625_0049951 Ga0495625_0049951_543_989 136
64 3300053146 Ga0500588_0011805 Ga0500588_0011805_248_694 136
65 3300006163 Ga0070715_10346453 Ga0070715_103464531 137
66 3300050496 nmdc:mga07m45_155622_c1 nmdc:mga07m45_155622_c1_308_754 137
67 3300014969 Ga0157376_10305732 Ga0157376_103057322 138
68 3300031616 Ga0307508_10003038 Ga0307508_100030382 138
69 3300005328 Ga0070676_10225049 Ga0070676_102250492 139
70 3300005330 Ga0070690_100228537 Ga0070690_1002285372 139
71 3300005331 Ga0070670_101002631 Ga0070670_1010026311 139
72 3300005333 Ga0070677_10018611 Ga0070677_100186111 139
73 3300005335 Ga0070666_10078433 Ga0070666_100784334 139
74 3300005337 Ga0070682_100706508 Ga0070682_1007065081 139
75 3300005338 Ga0068868_100070716 Ga0068868_1000707164 139
76 3300005343 Ga0070687_100000838 Ga0070687_1000008389 139
77 3300005347 Ga0070668_100483661 Ga0070668_1004836612 139
78 3300005353 Ga0070669_100238876 Ga0070669_1002388762 139
79 3300005353 Ga0070669_100726853 Ga0070669_1007268531 139
80 3300005355 Ga0070671_100018271 Ga0070671_1000182714 139
81 3300005356 Ga0070674_100056100 Ga0070674_1000561004 139
82 3300005364 Ga0070673_100005284 Ga0070673_1000052843 139
83 3300005364 Ga0070673_101832253 Ga0070673_1018322531 139
84 3300005365 Ga0070688_100273415 Ga0070688_1002734152 139
85 3300005366 Ga0070659_100664506 Ga0070659_1006645061 139
86 3300005367 Ga0070667_100255773 Ga0070667_1002557734 139
87 3300005455 Ga0070663_100189737 Ga0070663_1001897374 139
88 3300005456 Ga0070678_100058471 Ga0070678_1000584714 139
89 3300005457 Ga0070662_100169463 Ga0070662_1001694631 139
90 3300005459 Ga0068867_100077692 Ga0068867_1000776922 139
91 3300005459 Ga0068867_100508756 Ga0068867_1005087562 139
92 3300005543 Ga0070672_100083790 Ga0070672_1000837902 139
93 3300005543 Ga0070672_100135692 Ga0070672_1001356925 139
94 3300005544 Ga0070686_100037699 Ga0070686_1000376994 139
95 3300005564 Ga0070664_100003013 Ga0070664_1000030132 139
96 3300005615 Ga0070702_100007150 Ga0070702_1000071504 139
97 3300005616 Ga0068852_100079407 Ga0068852_1000794073 139
98 3300005617 Ga0068859_100135963 Ga0068859_1001359632 139
99 3300005618 Ga0068864_100222731 Ga0068864_1002227313 139
100 3300005618 Ga0068864_100842891 Ga0068864_1008428912 139
101 3300005840 Ga0068870_10206300 Ga0068870_102063002 139
102 3300005842 Ga0068858_100075507 Ga0068858_1000755074 139
103 3300005843 Ga0068860_100288538 Ga0068860_1002885382 139
104 3300006358 Ga0068871_100276881 Ga0068871_1002768813 139
105 3300006880 Ga0075429_100441428 Ga0075429_1004414282 139
106 3300006931 Ga0097620_100135965 Ga0097620_1001359652 139
107 3300009094 Ga0111539_10718755 Ga0111539_107187552 139
108 3300009148 Ga0105243_10398155 Ga0105243_103981553 139
109 3300009176 Ga0105242_10576529 Ga0105242_105765292 139
110 3300011119 Ga0105246_11103996 Ga0105246_111039961 139
111 3300013296 Ga0157374_10418726 Ga0157374_104187263 139
112 3300013297 Ga0157378_10000709 Ga0157378_1000070911 139
113 3300013306 Ga0163162_10220927 Ga0163162_102209272 139
114 3300013306 Ga0163162_10284284 Ga0163162_102842844 139
115 3300013306 Ga0163162_10579720 Ga0163162_105797203 139
116 3300013308 Ga0157375_10029892 Ga0157375_100298926 139
117 3300014326 Ga0157380_10257186 Ga0157380_102571862 139
118 3300014745 Ga0157377_10202564 Ga0157377_102025642 139
119 3300014968 Ga0157379_10209045 Ga0157379_102090453 139
120 3300014969 Ga0157376_10102537 Ga0157376_101025375 139
121 3300025321 Ga0207656_10236554 Ga0207656_102365542 139
122 3300025893 Ga0207682_10240664 Ga0207682_102406642 139
123 3300025901 Ga0207688_10022908 Ga0207688_100229084 139
124 3300025903 Ga0207680_10253374 Ga0207680_102533742 139
125 3300025907 Ga0207645_10024138 Ga0207645_100241385 139
126 3300025918 Ga0207662_10189665 Ga0207662_101896653 139
127 3300025923 Ga0207681_10323972 Ga0207681_103239722 139
128 3300025925 Ga0207650_11656771 Ga0207650_116567711 139
129 3300025931 Ga0207644_10010486 Ga0207644_100104863 139
130 3300025933 Ga0207706_10207931 Ga0207706_102079313 139
131 3300025934 Ga0207686_10302380 Ga0207686_103023802 139
132 3300025937 Ga0207669_10287032 Ga0207669_102870322 139
133 3300025940 Ga0207691_10007955 Ga0207691_100079555 139
134 3300025940 Ga0207691_10120619 Ga0207691_101206193 139
135 3300025945 Ga0207679_10033880 Ga0207679_100338802 139
136 3300025960 Ga0207651_10305387 Ga0207651_103053872 139
137 3300025972 Ga0207668_10621375 Ga0207668_106213752 139
138 3300025981 Ga0207640_10238928 Ga0207640_102389282 139
139 3300025986 Ga0207658_10429834 Ga0207658_104298341 139
140 3300026023 Ga0207677_10056668 Ga0207677_100566684 139
141 3300026035 Ga0207703_10101147 Ga0207703_101011472 139
142 3300026067 Ga0207678_10242081 Ga0207678_102420812 139
143 3300026089 Ga0207648_10135503 Ga0207648_101355033 139
144 3300026095 Ga0207676_10355481 Ga0207676_103554812 139
145 3300026118 Ga0207675_100136931 Ga0207675_1001369312 139
146 3300026121 Ga0207683_10020343 Ga0207683_100203435 139
147 3300026121 Ga0207683_10052752 Ga0207683_100527524 139
148 3300026142 Ga0207698_10808450 Ga0207698_108084501 139
149 3300027907 Ga0207428_10385848 Ga0207428_103858482 139
150 3300028381 Ga0268264_11456281 Ga0268264_114562811 139
151 3300031456 Ga0307513_10335612 Ga0307513_103356122 139
152 3300048917 Ga0496114_0197382 Ga0496114_0197382_593_1039 139
153 3300050508 nmdc:mga09592_416206_c1 nmdc:mga09592_416206_c1_676_1122 139
154 3300050511 nmdc:mga08y16_318686_c1 nmdc:mga08y16_318686_c1_437_883 139
155 3300005288 Ga0065714_10134545 Ga0065714_101345451 140
156 3300005616 Ga0068852_100571807 Ga0068852_1005718071 140
157 3300005834 Ga0068851_10000072 Ga0068851_100000729 140
158 3300009545 Ga0105237_10663394 Ga0105237_106633943 140
159 3300013297 Ga0157378_10761286 Ga0157378_107612861 140
160 3300013307 Ga0157372_10757105 Ga0157372_107571051 140
161 3300025321 Ga0207656_10000716 Ga0207656_100007169 140
162 3300026142 Ga0207698_11349549 Ga0207698_113495491 140
163 3300053134 Ga0500658_0005944 Ga0500658_0005944_2100_2522 140
164 3300005618 Ga0068864_100268024 Ga0068864_1002680242 141
165 3300025925 Ga0207650_11908688 Ga0207650_119086881 141
166 3300046529 Ga0495652_0479586 Ga0495652_0479586_106_552 141
167 3300002459 JGI24751J29686_10000815 JGI24751J29686_100008159 142
168 3300004803 Ga0058862_12224181 Ga0058862_122241812 142
169 3300005327 Ga0070658_10126296 Ga0070658_101262965 142
170 3300005331 Ga0070670_100008929 Ga0070670_1000089294 142
171 3300005336 Ga0070680_100035348 Ga0070680_1000353485 142
172 3300005337 Ga0070682_100045350 Ga0070682_1000453505 142
173 3300005339 Ga0070660_100020101 Ga0070660_1000201016 142
174 3300005436 Ga0070713_101913483 Ga0070713_1019134831 142
175 3300005458 Ga0070681_10678192 Ga0070681_106781922 142
176 3300005530 Ga0070679_100108447 Ga0070679_1001084472 142
177 3300005539 Ga0068853_101012795 Ga0068853_1010127951 142
178 3300005577 Ga0068857_100774592 Ga0068857_1007745922 142
179 3300005616 Ga0068852_100033007 Ga0068852_1000330073 142
180 3300009174 Ga0105241_10440903 Ga0105241_104409032 142
181 3300009553 Ga0105249_10000762 Ga0105249_1000076215 142
182 3300013102 Ga0157371_10176316 Ga0157371_101763162 142
183 3300013104 Ga0157370_10424994 Ga0157370_104249942 142
184 3300013105 Ga0157369_10186796 Ga0157369_101867961 142
185 3300014325 Ga0163163_10121634 Ga0163163_101216342 142
186 3300025909 Ga0207705_10017945 Ga0207705_100179454 142
187 3300025917 Ga0207660_10110671 Ga0207660_101106713 142
188 3300025919 Ga0207657_10090557 Ga0207657_100905573 142
189 3300025921 Ga0207652_10018316 Ga0207652_100183163 142
190 3300025925 Ga0207650_10062055 Ga0207650_100620552 142
191 3300025961 Ga0207712_10003245 Ga0207712_100032455 142
192 3300026041 Ga0207639_11055454 Ga0207639_110554542 142
193 3300026116 Ga0207674_10286027 Ga0207674_102860274 142
194 3300032004 Ga0307414_10264235 Ga0307414_102642352 142
195 3300049162 Ga0501307_005180 Ga0501307_005180_639_1085 142
196 3300053090 Ga0500646_0010977 Ga0500646_0010977_1317_1763 142
197 3300059647 Ga0587079_007677 Ga0587079_007677_29_475 142
198 iso_pu_bacteria 2883068021 2883073250 144
199 iso_pu_bacteria 2896085136 2896087353 144
200 iso_pu_bacteria 2896109856 2896114680 144
201 iso_pu_bacteria 2929154850 2929157760 144
202 3300049705 Ga0501225_0030890 Ga0501225_0030890_356_796 146
203 2162886011 MRS1b_contig_3199889 MRS1b_0148.00001430 148
204 3300001904 JGI24736J21556_1008031 JGI24736J21556_10080312 148
205 3300001979 JGI24740J21852_10005418 JGI24740J21852_100054186 148
206 3300002077 JGI24744J21845_10007602 JGI24744J21845_100076025 148
207 3300002738 JGI25154J39366_1000020 JGI25154J39366_100002058 148
208 3300002741 JGI25157J39369_1007886 JGI25157J39369_10078862 148
209 3300003215 JGI25153J46596_10000449 JGI25153J46596_1000044911 148
210 3300003320 rootH2_10078683 rootH2_100786832 148
211 3300003323 rootH1_10083371 rootH1_100833712 148
212 3300003354 JGI25160J50197_1010153 JGI25160J50197_10101534 148
213 3300003354 JGI25160J50197_1016700 JGI25160J50197_10167001 148
214 3300004801 Ga0058860_11988454 Ga0058860_119884543 148
215 3300005289 Ga0065704_10084334 Ga0065704_100843343 148
216 3300005289 Ga0065704_10488012 Ga0065704_104880121 148
217 3300005290 Ga0065712_10034732 Ga0065712_100347321 148
218 3300005290 Ga0065712_10099081 Ga0065712_100990811 148
219 3300005290 Ga0065712_10256583 Ga0065712_102565832 148
220 3300005293 Ga0065715_10727538 Ga0065715_107275381 148
221 3300005327 Ga0070658_10004004 Ga0070658_100040047 148
222 3300005327 Ga0070658_10965419 Ga0070658_109654191 148
223 3300005327 Ga0070658_11784040 Ga0070658_117840401 148
224 3300005328 Ga0070676_10922198 Ga0070676_109221981 148
225 3300005329 Ga0070683_100014181 Ga0070683_1000141818 148
226 3300005329 Ga0070683_100163407 Ga0070683_1001634071 148
227 3300005331 Ga0070670_100050094 Ga0070670_1000500944 148
228 3300005331 Ga0070670_100159846 Ga0070670_1001598463 148
229 3300005331 Ga0070670_100201020 Ga0070670_1002010201 148
230 3300005331 Ga0070670_100210533 Ga0070670_1002105331 148
231 3300005331 Ga0070670_100361455 Ga0070670_1003614553 148
232 3300005333 Ga0070677_10147990 Ga0070677_101479902 148
233 3300005334 Ga0068869_100203298 Ga0068869_1002032983 148
234 3300005334 Ga0068869_100306661 Ga0068869_1003066612 148
235 3300005337 Ga0070682_100272240 Ga0070682_1002722402 148
236 3300005337 Ga0070682_101239500 Ga0070682_1012395001 148
237 3300005337 Ga0070682_101983165 Ga0070682_1019831651 148
238 3300005338 Ga0068868_100015105 Ga0068868_1000151055 148
239 3300005338 Ga0068868_100731513 Ga0068868_1007315131 148
240 3300005338 Ga0068868_100766407 Ga0068868_1007664071 148
241 3300005339 Ga0070660_100300871 Ga0070660_1003008712 148
242 3300005340 Ga0070689_101003995 Ga0070689_1010039951 148
243 3300005343 Ga0070687_100263472 Ga0070687_1002634722 148
244 3300005343 Ga0070687_100329096 Ga0070687_1003290962 148
245 3300005344 Ga0070661_100001685 Ga0070661_10000168519 148
246 3300005344 Ga0070661_100836437 Ga0070661_1008364372 148
247 3300005347 Ga0070668_100502734 Ga0070668_1005027342 148
248 3300005347 Ga0070668_101054744 Ga0070668_1010547441 148
249 3300005353 Ga0070669_100102445 Ga0070669_1001024453 148
250 3300005353 Ga0070669_100169255 Ga0070669_1001692551 148
251 3300005353 Ga0070669_100851268 Ga0070669_1008512681 148
252 3300005353 Ga0070669_101206687 Ga0070669_1012066872 148
253 3300005354 Ga0070675_100028796 Ga0070675_1000287965 148
254 3300005354 Ga0070675_100056542 Ga0070675_1000565421 148
255 3300005354 Ga0070675_100085424 Ga0070675_1000854243 148
256 3300005354 Ga0070675_100271152 Ga0070675_1002711523 148
257 3300005355 Ga0070671_100037415 Ga0070671_1000374154 148
258 3300005355 Ga0070671_100683194 Ga0070671_1006831942 148
259 3300005356 Ga0070674_100451798 Ga0070674_1004517983 148
260 3300005356 Ga0070674_100552663 Ga0070674_1005526631 148
261 3300005364 Ga0070673_100009831 Ga0070673_1000098318 148
262 3300005364 Ga0070673_100368076 Ga0070673_1003680762 148
263 3300005364 Ga0070673_100771204 Ga0070673_1007712041 148
264 3300005364 Ga0070673_100779839 Ga0070673_1007798392 148
265 3300005364 Ga0070673_100801352 Ga0070673_1008013521 148
266 3300005364 Ga0070673_101051482 Ga0070673_1010514821 148
267 3300005365 Ga0070688_100188862 Ga0070688_1001888623 148
268 3300005365 Ga0070688_100362755 Ga0070688_1003627551 148
269 3300005366 Ga0070659_100004313 Ga0070659_1000043137 148
270 3300005366 Ga0070659_100371785 Ga0070659_1003717851 148
271 3300005367 Ga0070667_100181821 Ga0070667_1001818213 148
272 3300005367 Ga0070667_100262152 Ga0070667_1002621522 148
273 3300005367 Ga0070667_100496072 Ga0070667_1004960722 148
274 3300005436 Ga0070713_100924860 Ga0070713_1009248601 148
275 3300005456 Ga0070678_100784343 Ga0070678_1007843432 148
276 3300005456 Ga0070678_100883314 Ga0070678_1008833141 148
277 3300005457 Ga0070662_100091601 Ga0070662_1000916015 148
278 3300005458 Ga0070681_10890796 Ga0070681_108907961 148
279 3300005459 Ga0068867_100822316 Ga0068867_1008223162 148
280 3300005466 Ga0070685_10242637 Ga0070685_102426373 148
281 3300005466 Ga0070685_10757421 Ga0070685_107574211 148
282 3300005466 Ga0070685_10828157 Ga0070685_108281571 148
283 3300005535 Ga0070684_100001962 Ga0070684_1000019622 148
284 3300005535 Ga0070684_100560678 Ga0070684_1005606781 148
285 3300005535 Ga0070684_101072079 Ga0070684_1010720791 148
286 3300005539 Ga0068853_100002136 Ga0068853_1000021361 148
287 3300005539 Ga0068853_100304146 Ga0068853_1003041464 148
288 3300005539 Ga0068853_101879087 Ga0068853_1018790871 148
289 3300005543 Ga0070672_100164454 Ga0070672_1001644544 148
290 3300005543 Ga0070672_100381934 Ga0070672_1003819343 148
291 3300005543 Ga0070672_100715087 Ga0070672_1007150871 148
292 3300005548 Ga0070665_100289365 Ga0070665_1002893653 148
293 3300005548 Ga0070665_100983163 Ga0070665_1009831632 148
294 3300005548 Ga0070665_101296901 Ga0070665_1012969012 148
295 3300005549 Ga0070704_100460810 Ga0070704_1004608101 148
296 3300005549 Ga0070704_100815904 Ga0070704_1008159041 148
297 3300005563 Ga0068855_101071243 Ga0068855_1010712431 148
298 3300005563 Ga0068855_101073201 Ga0068855_1010732011 148
299 3300005564 Ga0070664_100001137 Ga0070664_1000011376 148
300 3300005564 Ga0070664_100056457 Ga0070664_1000564575 148
301 3300005564 Ga0070664_102201636 Ga0070664_1022016361 148
302 3300005577 Ga0068857_100001716 Ga0068857_10000171622 148
303 3300005577 Ga0068857_100196354 Ga0068857_1001963544 148
304 3300005577 Ga0068857_100342736 Ga0068857_1003427361 148
305 3300005577 Ga0068857_102064063 Ga0068857_1020640631 148
306 3300005578 Ga0068854_100166429 Ga0068854_1001664293 148
307 3300005578 Ga0068854_100411413 Ga0068854_1004114132 148
308 3300005614 Ga0068856_100285973 Ga0068856_1002859734 148
309 3300005614 Ga0068856_100419678 Ga0068856_1004196781 148
310 3300005615 Ga0070702_100249024 Ga0070702_1002490242 148
311 3300005616 Ga0068852_100007485 Ga0068852_1000074854 148
312 3300005616 Ga0068852_100130404 Ga0068852_1001304041 148
313 3300005616 Ga0068852_100302890 Ga0068852_1003028904 148
314 3300005616 Ga0068852_101940801 Ga0068852_1019408011 148
315 3300005617 Ga0068859_100016441 Ga0068859_1000164415 148
316 3300005617 Ga0068859_100389313 Ga0068859_1003893131 148
317 3300005617 Ga0068859_100563242 Ga0068859_1005632422 148
318 3300005617 Ga0068859_101442173 Ga0068859_1014421731 148
319 3300005617 Ga0068859_101599148 Ga0068859_1015991482 148
320 3300005617 Ga0068859_102410511 Ga0068859_1024105111 148
321 3300005618 Ga0068864_100735807 Ga0068864_1007358072 148
322 3300005618 Ga0068864_100858915 Ga0068864_1008589151 148
323 3300005718 Ga0068866_10032849 Ga0068866_100328493 148
324 3300005719 Ga0068861_100100355 Ga0068861_1001003554 148
325 3300005834 Ga0068851_10076116 Ga0068851_100761164 148
326 3300005834 Ga0068851_10609589 Ga0068851_106095891 148
327 3300005840 Ga0068870_10101857 Ga0068870_101018572 148
328 3300005840 Ga0068870_10238087 Ga0068870_102380872 148
329 3300005840 Ga0068870_10315638 Ga0068870_103156382 148
330 3300005841 Ga0068863_100008733 Ga0068863_1000087334 148
331 3300005841 Ga0068863_100293521 Ga0068863_1002935213 148
332 3300005842 Ga0068858_100520807 Ga0068858_1005208073 148
333 3300005843 Ga0068860_100011727 Ga0068860_1000117274 148
334 3300005843 Ga0068860_100054837 Ga0068860_1000548374 148
335 3300005843 Ga0068860_100100474 Ga0068860_1001004741 148
336 3300005843 Ga0068860_100780097 Ga0068860_1007800971 148
337 3300005844 Ga0068862_100176021 Ga0068862_1001760214 148
338 3300005844 Ga0068862_100394910 Ga0068862_1003949103 148
339 3300005844 Ga0068862_101139270 Ga0068862_1011392701 148
340 3300006028 Ga0070717_10850484 Ga0070717_108504842 148
341 3300006237 Ga0097621_100008970 Ga0097621_1000089703 148
342 3300006358 Ga0068871_100561723 Ga0068871_1005617232 148
343 3300006880 Ga0075429_100535334 Ga0075429_1005353341 148
344 3300006881 Ga0068865_100291190 Ga0068865_1002911901 148
345 3300006881 Ga0068865_100309166 Ga0068865_1003091662 148
346 3300006881 Ga0068865_100491570 Ga0068865_1004915701 148
347 3300006931 Ga0097620_100016441 Ga0097620_1000164415 148
348 3300006931 Ga0097620_100389319 Ga0097620_1003893194 148
349 3300006931 Ga0097620_100563205 Ga0097620_1005632052 148
350 3300006931 Ga0097620_101442215 Ga0097620_1014422151 148
351 3300006931 Ga0097620_101599154 Ga0097620_1015991542 148
352 3300006931 Ga0097620_102410578 Ga0097620_1024105781 148
353 3300009101 Ga0105247_10004404 Ga0105247_100044043 148
354 3300009101 Ga0105247_10016725 Ga0105247_100167253 148
355 3300009176 Ga0105242_10499138 Ga0105242_104991382 148
356 3300009553 Ga0105249_10053326 Ga0105249_100533264 148
357 3300009553 Ga0105249_10382863 Ga0105249_103828633 148
358 3300009553 Ga0105249_10922785 Ga0105249_109227853 148
359 3300009553 Ga0105249_10981964 Ga0105249_109819641 148
360 3300010375 Ga0105239_10662477 Ga0105239_106624772 148
361 3300010375 Ga0105239_10724578 Ga0105239_107245781 148
362 3300011119 Ga0105246_10276435 Ga0105246_102764352 148
363 3300013100 Ga0157373_10174789 Ga0157373_101747892 148
364 3300013100 Ga0157373_10252614 Ga0157373_102526142 148
365 3300013102 Ga0157371_10015329 Ga0157371_100153295 148
366 3300013104 Ga0157370_10475281 Ga0157370_104752812 148
367 3300013104 Ga0157370_10873099 Ga0157370_108730991 148
368 3300013105 Ga0157369_10410781 Ga0157369_104107813 148
369 3300013296 Ga0157374_10037538 Ga0157374_100375385 148
370 3300013296 Ga0157374_10166571 Ga0157374_101665714 148
371 3300013296 Ga0157374_10913959 Ga0157374_109139592 148
372 3300013296 Ga0157374_10989705 Ga0157374_109897052 148
373 3300013296 Ga0157374_11608026 Ga0157374_116080261 148
374 3300013297 Ga0157378_10068340 Ga0157378_100683402 148
375 3300013297 Ga0157378_10137489 Ga0157378_101374894 148
376 3300013297 Ga0157378_10273642 Ga0157378_102736421 148
377 3300013297 Ga0157378_10477167 Ga0157378_104771671 148
378 3300013297 Ga0157378_10913434 Ga0157378_109134342 148
379 3300013306 Ga0163162_10855707 Ga0163162_108557072 148
380 3300013307 Ga0157372_10044094 Ga0157372_100440942 148
381 3300013307 Ga0157372_10138196 Ga0157372_101381964 148
382 3300013307 Ga0157372_10244080 Ga0157372_102440801 148
383 3300013307 Ga0157372_10326210 Ga0157372_103262102 148
384 3300013307 Ga0157372_10428260 Ga0157372_104282602 148
385 3300013307 Ga0157372_10474095 Ga0157372_104740953 148
386 3300013307 Ga0157372_10517117 Ga0157372_105171173 148
387 3300013307 Ga0157372_10618753 Ga0157372_106187532 148
388 3300013307 Ga0157372_10792845 Ga0157372_107928451 148
389 3300013307 Ga0157372_11045870 Ga0157372_110458702 148
390 3300013307 Ga0157372_11110776 Ga0157372_111107763 148
391 3300013307 Ga0157372_11227177 Ga0157372_112271772 148
392 3300013307 Ga0157372_12699953 Ga0157372_126999532 148
393 3300013307 Ga0157372_13011144 Ga0157372_130111441 148
394 3300013308 Ga0157375_11251820 Ga0157375_112518201 148
395 3300014325 Ga0163163_10194683 Ga0163163_101946834 148
396 3300014325 Ga0163163_10252665 Ga0163163_102526652 148
397 3300014325 Ga0163163_10262306 Ga0163163_102623063 148
398 3300014325 Ga0163163_10391609 Ga0163163_103916093 148
399 3300014326 Ga0157380_10000874 Ga0157380_100008743 148
400 3300014326 Ga0157380_10013298 Ga0157380_100132981 148
401 3300014326 Ga0157380_11531965 Ga0157380_115319651 148
402 3300014745 Ga0157377_10060773 Ga0157377_100607734 148
403 3300014745 Ga0157377_10518518 Ga0157377_105185181 148
404 3300014968 Ga0157379_10283108 Ga0157379_102831082 148
405 3300014968 Ga0157379_10285786 Ga0157379_102857863 148
406 3300014968 Ga0157379_11148254 Ga0157379_111482541 148
407 3300014969 Ga0157376_10007683 Ga0157376_100076831 148
408 3300014969 Ga0157376_11238256 Ga0157376_112382562 148
409 3300017792 Ga0163161_10496688 Ga0163161_104966882 148
410 3300025246 Ga0209646_1000005 Ga0209646_1000005503 148
411 3300025250 Ga0209026_1000149 Ga0209026_10001494 148
412 3300025297 Ga0209758_1001581 Ga0209758_100158113 148
413 3300025302 Ga0207426_1000262 Ga0207426_100026229 148
414 3300025315 Ga0207697_10025736 Ga0207697_100257363 148
415 3300025321 Ga0207656_10187613 Ga0207656_101876131 148
416 3300025321 Ga0207656_10649895 Ga0207656_106498951 148
417 3300025900 Ga0207710_10021802 Ga0207710_100218023 148
418 3300025901 Ga0207688_10078834 Ga0207688_100788342 148
419 3300025904 Ga0207647_10000054 Ga0207647_100000547 148
420 3300025907 Ga0207645_10001414 Ga0207645_1000141418 148
421 3300025907 Ga0207645_10458274 Ga0207645_104582742 148
422 3300025908 Ga0207643_10017772 Ga0207643_100177723 148
423 3300025908 Ga0207643_10380320 Ga0207643_103803202 148
424 3300025908 Ga0207643_10781610 Ga0207643_107816101 148
425 3300025909 Ga0207705_10038550 Ga0207705_100385504 148
426 3300025911 Ga0207654_10165422 Ga0207654_101654222 148
427 3300025913 Ga0207695_11155231 Ga0207695_111552311 148
428 3300025918 Ga0207662_10014557 Ga0207662_100145574 148
429 3300025919 Ga0207657_10318804 Ga0207657_103188042 148
430 3300025920 Ga0207649_10012497 Ga0207649_100124972 148
431 3300025920 Ga0207649_11430612 Ga0207649_114306121 148
432 3300025923 Ga0207681_10247116 Ga0207681_102471163 148
433 3300025923 Ga0207681_10261038 Ga0207681_102610381 148
434 3300025923 Ga0207681_10844281 Ga0207681_108442811 148
435 3300025923 Ga0207681_11103113 Ga0207681_111031132 148
436 3300025925 Ga0207650_10002829 Ga0207650_1000282911 148
437 3300025925 Ga0207650_10052505 Ga0207650_100525053 148
438 3300025925 Ga0207650_10057904 Ga0207650_100579041 148
439 3300025925 Ga0207650_10077427 Ga0207650_100774273 148
440 3300025925 Ga0207650_10303053 Ga0207650_103030531 148
441 3300025926 Ga0207659_11335390 Ga0207659_113353901 148
442 3300025931 Ga0207644_10213757 Ga0207644_102137573 148
443 3300025931 Ga0207644_10247387 Ga0207644_102473874 148
444 3300025931 Ga0207644_10363033 Ga0207644_103630332 148
445 3300025931 Ga0207644_10838977 Ga0207644_108389771 148
446 3300025932 Ga0207690_10003583 Ga0207690_100035834 148
447 3300025932 Ga0207690_10121607 Ga0207690_101216073 148
448 3300025933 Ga0207706_10132112 Ga0207706_101321122 148
449 3300025933 Ga0207706_10764544 Ga0207706_107645441 148
450 3300025934 Ga0207686_10362798 Ga0207686_103627982 148
451 3300025934 Ga0207686_11096882 Ga0207686_110968821 148
452 3300025936 Ga0207670_10593985 Ga0207670_105939852 148
453 3300025937 Ga0207669_10216620 Ga0207669_102166201 148
454 3300025938 Ga0207704_10433361 Ga0207704_104333613 148
455 3300025940 Ga0207691_10089266 Ga0207691_100892665 148
456 3300025940 Ga0207691_10771262 Ga0207691_107712621 148
457 3300025942 Ga0207689_10239230 Ga0207689_102392302 148
458 3300025942 Ga0207689_11465250 Ga0207689_114652501 148
459 3300025944 Ga0207661_10006150 Ga0207661_100061506 148
460 3300025944 Ga0207661_10137810 Ga0207661_101378101 148
461 3300025944 Ga0207661_10847201 Ga0207661_108472011 148
462 3300025945 Ga0207679_10000777 Ga0207679_100007775 148
463 3300025945 Ga0207679_10363725 Ga0207679_103637251 148
464 3300025960 Ga0207651_10013586 Ga0207651_100135864 148
465 3300025960 Ga0207651_10023535 Ga0207651_100235355 148
466 3300025960 Ga0207651_10112459 Ga0207651_101124593 148
467 3300025960 Ga0207651_10165654 Ga0207651_101656542 148
468 3300025960 Ga0207651_10169433 Ga0207651_101694331 148
469 3300025960 Ga0207651_10686151 Ga0207651_106861512 148
470 3300025960 Ga0207651_10697672 Ga0207651_106976721 148
471 3300025961 Ga0207712_10272490 Ga0207712_102724902 148
472 3300025972 Ga0207668_10142924 Ga0207668_101429241 148
473 3300025972 Ga0207668_10570103 Ga0207668_105701031 148
474 3300025981 Ga0207640_10396375 Ga0207640_103963752 148
475 3300025986 Ga0207658_10224740 Ga0207658_102247403 148
476 3300025986 Ga0207658_10453946 Ga0207658_104539461 148
477 3300025986 Ga0207658_10616872 Ga0207658_106168722 148
478 3300026023 Ga0207677_10009244 Ga0207677_100092445 148
479 3300026023 Ga0207677_10300722 Ga0207677_103007224 148
480 3300026023 Ga0207677_11287624 Ga0207677_112876241 148
481 3300026035 Ga0207703_10225221 Ga0207703_102252213 148
482 3300026041 Ga0207639_10048916 Ga0207639_100489162 148
483 3300026041 Ga0207639_10100749 Ga0207639_101007493 148
484 3300026041 Ga0207639_10932318 Ga0207639_109323182 148
485 3300026041 Ga0207639_11145788 Ga0207639_111457882 148
486 3300026041 Ga0207639_11211482 Ga0207639_112114821 148
487 3300026067 Ga0207678_10878619 Ga0207678_108786191 148
488 3300026075 Ga0207708_10233885 Ga0207708_102338852 148
489 3300026075 Ga0207708_11018375 Ga0207708_110183752 148
490 3300026088 Ga0207641_10019514 Ga0207641_100195144 148
491 3300026088 Ga0207641_10390897 Ga0207641_103908971 148
492 3300026089 Ga0207648_10003106 Ga0207648_100031062 148
493 3300026089 Ga0207648_10258930 Ga0207648_102589303 148
494 3300026095 Ga0207676_10480386 Ga0207676_104803861 148
495 3300026116 Ga0207674_10003303 Ga0207674_100033034 148
496 3300026116 Ga0207674_10117029 Ga0207674_101170294 148
497 3300026116 Ga0207674_10212768 Ga0207674_102127682 148
498 3300026116 Ga0207674_10488144 Ga0207674_104881442 148
499 3300026118 Ga0207675_100011319 Ga0207675_1000113198 148
500 3300026118 Ga0207675_100083149 Ga0207675_1000831495 148
501 3300026118 Ga0207675_100247006 Ga0207675_1002470062 148
502 3300026118 Ga0207675_100390747 Ga0207675_1003907471 148
503 3300026118 Ga0207675_101502595 Ga0207675_1015025951 148
504 3300026121 Ga0207683_10324679 Ga0207683_103246792 148
505 3300026121 Ga0207683_11561917 Ga0207683_115619171 148
506 3300026142 Ga0207698_10083962 Ga0207698_100839624 148
507 3300026142 Ga0207698_11066675 Ga0207698_110666751 148
508 3300026142 Ga0207698_11807489 Ga0207698_118074891 148
509 3300027471 Ga0209995_1014434 Ga0209995_10144342 148
510 3300027543 Ga0209999_1096173 Ga0209999_10961732 148
511 3300027665 Ga0209983_1028476 Ga0209983_10284761 148
512 3300027876 Ga0209974_10016908 Ga0209974_100169084 148
513 3300028379 Ga0268266_10459686 Ga0268266_104596862 148
514 3300028381 Ga0268264_10016695 Ga0268264_100166955 148
515 3300028381 Ga0268264_10017783 Ga0268264_100177834 148
516 3300028381 Ga0268264_10057876 Ga0268264_100578762 148
517 3300028381 Ga0268264_10148290 Ga0268264_101482903 148
518 3300028794 Ga0307515_10000107 Ga0307515_1000010716 148
519 3300028794 Ga0307515_10542041 Ga0307515_105420411 148
520 3300031456 Ga0307513_11009219 Ga0307513_110092191 148
521 3300031824 Ga0307413_10219491 Ga0307413_102194912 148
522 3300031824 Ga0307413_11341476 Ga0307413_113414761 148
523 3300031852 Ga0307410_10037090 Ga0307410_100370901 148
524 3300031852 Ga0307410_10770696 Ga0307410_107706961 148
525 3300031901 Ga0307406_10261768 Ga0307406_102617682 148
526 3300031901 Ga0307406_10308655 Ga0307406_103086552 148
527 3300031903 Ga0307407_10997343 Ga0307407_109973431 148
528 3300031911 Ga0307412_10105983 Ga0307412_101059832 148
529 3300031911 Ga0307412_10410821 Ga0307412_104108212 148
530 3300032002 Ga0307416_100422092 Ga0307416_1004220923 148
531 3300032002 Ga0307416_101860172 Ga0307416_1018601721 148
532 3300032004 Ga0307414_10264994 Ga0307414_102649942 148
533 3300032004 Ga0307414_10407248 Ga0307414_104072481 148
534 3300032004 Ga0307414_10578044 Ga0307414_105780443 148
535 3300032005 Ga0307411_10217493 Ga0307411_102174933 148
536 3300032126 Ga0307415_100745818 Ga0307415_1007458181 148
537 3300032126 Ga0307415_101605608 Ga0307415_1016056081 148
538 3300033524 Ga0316592_1055522 Ga0316592_10555222 148
539 3300035111 Ga0373923_0269620 Ga0373923_0269620_121_567 148
540 3300035170 Ga0373943_0285807 Ga0373943_0285807_34_480 148
541 3300035171 Ga0373946_0047656 Ga0373946_0047656_519_965 148
542 3300035398 Ga0316574_0581976 Ga0316574_0581976_206_652 148
543 3300036401 Ga0373937_0420990 Ga0373937_0420990_521_967 148
544 3300036401 Ga0373937_0597281 Ga0373937_0597281_312_758 148
545 3300037312 Ga0395899_0443656 Ga0395899_0443656_180_626 148
546 3300037418 Ga0395900_0079402 Ga0395900_0079402_36_482 148
547 3300037418 Ga0395900_0430316 Ga0395900_0430316_613_1059 148
548 3300037418 Ga0395900_0965694 Ga0395900_0965694_234_680 148
549 3300037466 Ga0395898_0081787 Ga0395898_0081787_636_1082 148
550 3300037466 Ga0395898_0194299 Ga0395898_0194299_772_1218 148
551 3300037471 Ga0395905_0001345 Ga0395905_0001345_4163_4609 148
552 3300037471 Ga0395905_0037653 Ga0395905_0037653_3288_3785 148
553 3300037471 Ga0395905_0647072 Ga0395905_0647072_337_783 148
554 3300038443 Ga0395901_0183308 Ga0395901_0183308_570_1016 148
555 3300038443 Ga0395901_1211781 Ga0395901_1211781_84_530 148
556 3300039437 Ga0436365_0430263 Ga0436365_0430263_976_1422 148
557 3300039437 Ga0436365_1637134 Ga0436365_1637134_23787_24233 148
558 3300039453 Ga0436362_0581654 Ga0436362_0581654_48_494 148
559 3300041406 Ga0439439_0197426 Ga0439439_0197426_13_477 148
560 3300041413 Ga0439465_0053797 Ga0439465_0053797_570_1034 148
561 3300041413 Ga0439465_0212242 Ga0439465_0212242_36_482 148
562 3300041460 Ga0451802_1114912 Ga0451802_1114912_172_618 148
563 3300041997 Ga0439431_0001403 Ga0439431_0001403_4805_5251 148
564 3300041997 Ga0439431_0027658 Ga0439431_0027658_834_1298 148
565 3300042004 Ga0439445_0092823 Ga0439445_0092823_324_770 148
566 3300042007 Ga0439449_0005016 Ga0439449_0005016_2053_2499 148
567 3300042010 Ga0439452_091255 Ga0439452_091255_163_627 148
568 3300042014 Ga0439457_011115 Ga0439457_011115_879_1343 148
569 3300042125 Ga0450923_011615 Ga0450923_011615_560_1006 148
570 3300042128 Ga0450897_002854 Ga0450897_002854_554_1018 148
571 3300042131 Ga0450894_011226 Ga0450894_011226_670_1134 148
572 3300042131 Ga0450894_062496 Ga0450894_062496_24_470 148
573 3300042132 Ga0450895_019461 Ga0450895_019461_84_548 148
574 3300042134 Ga0450898_003372 Ga0450898_003372_989_1453 148
575 3300042135 Ga0450899_001053 Ga0450899_001053_1544_2008 148
576 3300042435 Ga0439434_0257936 Ga0439434_0257936_78_542 148
577 3300042876 Ga0451577_0039713 Ga0451577_0039713_22_468 148
578 3300042876 Ga0451577_0050025 Ga0451577_0050025_2235_2681 148
579 3300042876 Ga0451577_0147383 Ga0451577_0147383_774_1220 148
580 3300044712 Ga0453684_0021943 Ga0453684_0021943_8499_8945 148
581 3300044712 Ga0453684_0047019 Ga0453684_0047019_219_668 148
582 3300044712 Ga0453684_0072019 Ga0453684_0072019_881_1327 148
583 3300044765 Ga0466970_0477166 Ga0466970_0477166_146_592 148
584 3300045049 Ga0466959_0047185 Ga0466959_0047185_1661_2107 148
585 3300045051 Ga0451576_0714991 Ga0451576_0714991_483_929 148
586 3300045051 Ga0451576_1311102 Ga0451576_1311102_121_567 148
587 3300045976 Ga0466967_0403282 Ga0466967_0403282_294_740 148
588 3300046525 Ga0495663_0024713 Ga0495663_0024713_877_1323 148
589 3300046537 Ga0495598_0146920 Ga0495598_0146920_124_570 148
590 3300046537 Ga0495598_0163267 Ga0495598_0163267_83_529 148
591 3300046539 Ga0495621_0052447 Ga0495621_0052447_645_1091 148
592 3300046615 Ga0495656_0331411 Ga0495656_0331411_64_510 148
593 3300046691 Ga0495670_0042608 Ga0495670_0042608_859_1305 148
594 3300047320 Ga0495672_0082899 Ga0495672_0082899_934_1380 148
595 3300048090 Ga0495615_0015991 Ga0495615_0015991_275_721 148
596 3300049127 Ga0501306_062139 Ga0501306_062139_10_456 148
597 3300049129 Ga0501309_009493 Ga0501309_009493_729_1211 148
598 3300049129 Ga0501309_072973 Ga0501309_072973_11_457 148
599 3300049129 Ga0501309_083319 Ga0501309_083319_78_524 148
600 3300049129 Ga0501309_085695 Ga0501309_085695_30_476 148
601 3300049161 Ga0501305_011154 Ga0501305_011154_702_1184 148
602 3300049161 Ga0501305_065677 Ga0501305_065677_117_563 148
603 3300049162 Ga0501307_007686 Ga0501307_007686_720_1166 148
604 3300049162 Ga0501307_012219 Ga0501307_012219_30_512 148
605 3300049163 Ga0501342_03950 Ga0501342_03950_70_516 148
606 3300049515 Ga0501292_033515 Ga0501292_033515_268_732 148
607 3300049519 Ga0501296_010317 Ga0501296_010317_210_692 148
608 3300049521 Ga0501298_002358 Ga0501298_002358_579_1043 148
609 3300049522 Ga0501299_045504 Ga0501299_045504_433_879 148
610 3300049527 Ga0501311_007156 Ga0501311_007156_731_1213 148
611 3300049527 Ga0501311_030577 Ga0501311_030577_321_767 148
612 3300049528 Ga0501312_013093 Ga0501312_013093_683_1129 148
613 3300049529 Ga0501313_008796 Ga0501313_008796_657_1103 148
614 3300049529 Ga0501313_012655 Ga0501313_012655_473_955 148
615 3300049529 Ga0501313_029005 Ga0501313_029005_255_701 148
616 3300049530 Ga0501314_029912 Ga0501314_029912_87_572 148
617 3300049531 Ga0501315_008641 Ga0501315_008641_715_1161 148
618 3300049531 Ga0501315_009328 Ga0501315_009328_700_1146 148
619 3300049531 Ga0501315_016198 Ga0501315_016198_375_821 148
620 3300049531 Ga0501315_085496 Ga0501315_085496_26_472 148
621 3300049532 Ga0501316_005577 Ga0501316_005577_800_1282 148
622 3300049532 Ga0501316_009012 Ga0501316_009012_31_477 148
623 3300049532 Ga0501316_011551 Ga0501316_011551_563_1009 148
624 3300049532 Ga0501316_039908 Ga0501316_039908_180_626 148
625 3300049533 Ga0501317_054896 Ga0501317_054896_184_630 148
626 3300049539 Ga0501323_008601 Ga0501323_008601_31_513 148
627 3300049539 Ga0501323_008879 Ga0501323_008879_714_1160 148
628 3300049541 Ga0501325_009730 Ga0501325_009730_402_848 148
629 3300049546 Ga0501330_016179 Ga0501330_016179_29_475 148
630 3300049549 Ga0501333_005926 Ga0501333_005926_294_740 148
631 3300049551 Ga0501335_005974 Ga0501335_005974_641_1087 148
632 3300049551 Ga0501335_006644 Ga0501335_006644_524_970 148
633 3300049551 Ga0501335_009232 Ga0501335_009232_468_914 148
634 3300049552 Ga0501336_006843 Ga0501336_006843_397_843 148
635 3300049570 Ga0501033_0162329 Ga0501033_0162329_1113_1559 148
636 3300049571 Ga0501034_0008676 Ga0501034_0008676_336_782 148
637 3300049571 Ga0501034_0144438 Ga0501034_0144438_967_1413 148
638 3300049574 Ga0501038_0908087 Ga0501038_0908087_88_534 148
639 3300049575 Ga0501039_0969830 Ga0501039_0969830_120_566 148
640 3300049579 Ga0501043_0058310 Ga0501043_0058310_1508_1954 148
641 3300049586 Ga0501070_0757822 Ga0501070_0757822_68_514 148
642 3300049649 Ga0501198_001163 Ga0501198_001163_750_1214 148
643 3300049651 Ga0501201_034416 Ga0501201_034416_91_573 148
644 3300049652 Ga0501202_009450 Ga0501202_009450_638_1102 148
645 3300049652 Ga0501202_032440 Ga0501202_032440_600_1046 148
646 3300049653 Ga0501206_002023 Ga0501206_002023_1640_2104 148
647 3300049654 Ga0501207_063747 Ga0501207_063747_140_604 148
648 3300049654 Ga0501207_142814 Ga0501207_142814_37_483 148
649 3300049656 Ga0501209_086777 Ga0501209_086777_435_881 148
650 3300049661 Ga0501217_000031 Ga0501217_000031_5554_6018 148
651 3300049661 Ga0501217_011991 Ga0501217_011991_567_1013 148
652 3300049661 Ga0501217_145278 Ga0501217_145278_111_557 148
653 3300049663 Ga0501223_004205 Ga0501223_004205_650_1114 148
654 3300049663 Ga0501223_125109 Ga0501223_125109_19_465 148
655 3300049664 Ga0501224_013830 Ga0501224_013830_691_1137 148
656 3300049665 Ga0501227_079921 Ga0501227_079921_104_550 148
657 3300049673 Ga0501240_013770 Ga0501240_013770_444_908 148
658 3300049673 Ga0501240_038286 Ga0501240_038286_295_741 148
659 3300049674 Ga0501242_006955 Ga0501242_006955_389_853 148
660 3300049675 Ga0501243_001794 Ga0501243_001794_2547_3011 148
661 3300049675 Ga0501243_086756 Ga0501243_086756_90_536 148
662 3300049682 Ga0501252_003521 Ga0501252_003521_563_1027 148
663 3300049682 Ga0501252_045311 Ga0501252_045311_130_576 148
664 3300049686 Ga0501257_007538 Ga0501257_007538_1256_1702 148
665 3300049688 Ga0501259_030282 Ga0501259_030282_79_543 148
666 3300049688 Ga0501259_037766 Ga0501259_037766_430_912 148
667 3300049690 Ga0501261_002234 Ga0501261_002234_1399_1863 148
668 3300049690 Ga0501261_048851 Ga0501261_048851_44_490 148
669 3300049704 Ga0501221_000508 Ga0501221_000508_4600_5064 148
670 3300049704 Ga0501221_044974 Ga0501221_044974_409_855 148
671 3300049705 Ga0501225_0022573 Ga0501225_0022573_911_1357 148
672 3300049707 Ga0501234_018179 Ga0501234_018179_382_828 148
673 3300049707 Ga0501234_031464 Ga0501234_031464_80_526 148
674 3300049708 Ga0501245_034476 Ga0501245_034476_253_699 148
675 3300049762 Ga0501265_041518 Ga0501265_041518_72_536 148
676 3300049763 Ga0501266_000514 Ga0501266_000514_3963_4445 148
677 3300049769 Ga0501272_020900 Ga0501272_020900_261_707 148
678 3300049769 Ga0501272_032026 Ga0501272_032026_143_589 148
679 3300049822 Ga0501035_0151808 Ga0501035_0151808_828_1274 148
680 3300049823 Ga0501044_0079878 Ga0501044_0079878_266_712 148
681 3300049823 Ga0501044_0452746 Ga0501044_0452746_443_889 148
682 3300049823 Ga0501044_0457812 Ga0501044_0457812_498_944 148
683 3300053090 Ga0500646_0005972 Ga0500646_0005972_1298_1744 148
684 3300059492 Ga0587073_0056738 Ga0587073_0056738_447_893 148
685 3300059510 Ga0587090_128716 Ga0587090_128716_97_543 148

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01281

Ribosomal_L9_N

Ribosomal protein L9, N-terminal domain

19

65

0.99

PF03948

Ribosomal_L9_C

Ribosomal protein L9, C-terminal domain

81

165

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
8cgd-assembly1.cif.gz_h clindamycin bound to the 50s subunit 1.008 1 40
8ceu-assembly1.cif.gz_h retapamulin and capreomycin bound to the 50s subunit 1.002 1 40
8fto-assembly1.cif.gz_h e. coli 70s ribosome with an improved ms2 tag inserted in h98 1.002 1 40
8aye-assembly1.cif.gz_h e. coli 70s ribosome bound to thermorubin and fmet-trna 1 1 40
7y7e-assembly1.cif.gz_h structure of the bacterial ribosome with human trna asp(manq34) and mrna(gau) 0.9993 1 40
ID Description Score Start End Superfamily
4rbcI01 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L9; domain 1;Ribosomal protein L9, N-terminal domain 0.9875 1 57 3.40.5.10
af_Q2G2T3_1_54_3.40.5.10 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L9; domain 1;Ribosomal protein L9, N-terminal domain 0.9866 1 51 3.40.5.10
4qcvI01 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L9; domain 1;Ribosomal protein L9, N-terminal domain 0.9841 1 57 3.40.5.10
4qcxI01 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L9; domain 1;Ribosomal protein L9, N-terminal domain 0.9758 1 57 3.40.5.10
4l6lI01 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L9; domain 1;Ribosomal protein L9, N-terminal domain 0.974 1 57 3.40.5.10
ID Description Score Start End GO Terms
AF-A0A1F3P1U0-F1-model_v4 Large ribosomal subunit protein bL9 0.9776 1 148 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A5N8YDQ1-F1-model_v4 Large ribosomal subunit protein bL9 0.9683 1 147 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A7C4UT27-F1-model_v4 Large ribosomal subunit protein bL9 0.9676 1 148 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A7C4JUF5-F1-model_v4 Large ribosomal subunit protein bL9 0.9635 1 148 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A7V2RM38-F1-model_v4 Large ribosomal subunit protein bL9 0.9634 1 148 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904

Feature Viewer

pLDDT pTM Quality
87.33 0.6 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map