F475102

General Info

Members Datasets Scaffolds Average Seq Length
685 320 672 890

Family's Representative Sequence

Representative Sequence 3300005289|Ga0065704_10070145|Ga0065704_10070145142
Length 1054
Sequence MTNRQTKEEIRLANPEFRRWGPYLGERQWATVREDYSHDGDAWSDFPFDHSQSRAYRWGEDGLAGVSDDKQLINFSMGLWNSKDDILKEKAFGVTNSQGNHGEDVKELYYYLDNTPSHSYMKYLYKYPQGKFPYKELIEENDRRSRLEQEFEITDTDLFKENKYFDVVFEMAKGDNDSEELLFRITAYNRSGEVAPLHILPHVVLRNTWAWGNENGAKKPKLKAVNDHTIEIDHEKFGKRNLIFAPAPGCSDDSPDVEPQLLFTENETNTQKLYNQPNKYKYVKDAFHNYIIDEEDEKVNPDQVGTKACAWFAFDENGGVQPGDYVTIRYKLSRKLEDIDEYEHDQIFSRRQDEADAFYWRVSPLPISDNLRQVQRQAFAGLLWTKQFYHFVHNNWSKGDPNTPQPPMNRANGRNKDWKHLYIDDVLSLPDKWEYPFFAAWDTAFHCIPLAMIDPEFAKNQIDLLLREWYQHPNGQIPAYEWNFSDVNPPVHAWSAYRIFKIEKKMYGREDIDFLERVFHKLLLNFSWWVNRKDQDGNNVFEGGFLGLDNIGVFNRSEDLPTGGNLEQADSTGWMAFFSLQMLNIALELAKTRPVYQDIASKFFEHFIIIAEAMSYRGADKDDVETTEESLWDEKDGFYYDAIRYGQGNTQSLPVRSLVGLIPLYASLTLEPEILDKFPAFKQRLEWFIEKRSGMAGRNIASMETRGVGERLLLALVNKDRLIAILDKMLNEDEFLSPYGIRSLSKFHKDNPFKMDVNGEKFVVEYLPGESDSGMFGGNSNWRGPIWFPVNFLLVEALQRFYLYYGPDLKVECPKGSGDFLNLAQCAQEIQHRLMHLFIPDEDGNRACNGDDELTNKDPLFKDYVPFYEYFDADTGRGLGASHQCGWTAVVAKWIHDNGVSCRLPKTPXXXRARGSSIFLHNSETPTDENDDVRQYFPKSGPFPGRLSRRKSGKSLLNLTVNSLDMDEEETENHSKLSAARKCTDMYDDTNVTHDMLQEDLQDLTPTLSRGSFDSNPAVDDDLLDQIKDAFKKYKLKGDEEDEVSGDEFETRKN

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
3 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
4 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
5 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
6 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
7 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
8 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
9 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
10 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
11 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
12 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
13 2989392574 Methylomonas rhizoryzae GJ1 Isolate Unclassified
14 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
15 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
16 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
17 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
18 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
19 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
20 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
21 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
22 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
23 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
24 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
25 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
26 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
27 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
28 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
29 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
30 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
31 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
32 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
33 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
34 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
35 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
36 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
37 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
38 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
39 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
40 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
41 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
42 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
43 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
44 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
45 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
46 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
47 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
48 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
53 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
54 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
55 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
56 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
57 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
58 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
59 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
60 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
61 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
62 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
63 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
64 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
65 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
66 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
67 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
68 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
69 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
73 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
74 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
75 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
76 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
77 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
78 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
79 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
80 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
81 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
82 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
83 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
84 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
85 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
86 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
89 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
90 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
91 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
92 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
93 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
94 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
95 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
96 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
97 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
99 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
100 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
101 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
103 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
105 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
106 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
107 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
108 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
109 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
110 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
111 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
112 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
113 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
114 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
115 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
116 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
117 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
118 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
119 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
120 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
121 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
122 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
123 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
124 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
125 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
126 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
127 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
128 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
129 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
130 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
182 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
183 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
187 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
188 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
189 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
190 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
191 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
192 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
193 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
195 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
196 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
197 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
198 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
199 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
200 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
201 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
202 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
203 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
204 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
205 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
206 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
207 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
208 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
209 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
210 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
211 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
212 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
213 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
214 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
215 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
216 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
217 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
218 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
219 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
220 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
221 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
222 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
223 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
224 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
225 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
226 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
227 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
228 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
229 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
230 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
231 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
232 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
233 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
234 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
235 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
236 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
237 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
238 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
239 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
240 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
241 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
242 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
243 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
244 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
245 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
246 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
247 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
248 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
249 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
250 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
251 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
252 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
253 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
254 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
255 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
256 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
257 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
258 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
259 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
260 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
261 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
262 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
263 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
264 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
265 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
266 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
267 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
268 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
269 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
270 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
271 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
272 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
273 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
274 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
275 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
276 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
277 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
278 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
279 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
280 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
281 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
285 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
288 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
290 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
291 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
292 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
293 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
294 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
295 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
296 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
297 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
298 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
299 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
300 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
301 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
302 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
303 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
304 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
305 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
306 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
307 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
308 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
309 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
310 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
311 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
312 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
313 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
314 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
315 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
316 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
317 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
318 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
319 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
320 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.96
Metatranscriptomes 0.15
Isolates 1.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.09
Nodule 0.15
Rhizoplane 2.63
Rhizosphere 86.86
Stem 0
Stem Tuber 0
Unclassified 6.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1480143 2162886007 Eukaryota 14209
2 JGI24739J22299_10005528 3300001989 Bacteria 4793
3 JGI24737J22298_10001133 3300001990 Bacteria 9381
4 JGI24737J22298_10004156 3300001990 Bacteria 5059
5 JGI24735J21928_10000002 3300002067 Bacteria 624895
6 JGI25162J39368_1000024 3300002737 Bacteria 229507
7 rootH2_10001891 3300003320 Bacteria 464318
8 Ga0055536_1000004 3300003781 Bacteria 411108
9 Ga0055530_10001262 3300003791 Bacteria 19164
10 Ga0065165_1000037 3300005262 Bacteria 212166
11 Ga0065703_1003925 3300005272 Eukaryota 3769
12 Ga0065714_10004171 3300005288 Bacteria 5987
13 Ga0065704_10070145 3300005289 Eukaryota 329528
14 Ga0065707_10082117 3300005295 Eukaryota 21431
15 Ga0070658_10005434 3300005327 Bacteria 10338
16 Ga0070676_10000160 3300005328 Bacteria 27029
17 Ga0070676_10018176 3300005328 Bacteria 3893
18 Ga0070683_100005599 3300005329 Bacteria 10492
19 Ga0070683_100020924 3300005329 Bacteria 5833
20 Ga0070690_100000702 3300005330 Bacteria 17165
21 Ga0070690_100007338 3300005330 Bacteria 6308
22 Ga0070690_100011943 3300005330 Bacteria 5097
23 Ga0070690_100016864 3300005330 Bacteria 4385
24 Ga0070670_100009602 3300005331 Bacteria 8257
25 Ga0070670_100010551 3300005331 Bacteria 7888
26 Ga0070670_100014933 3300005331 Bacteria 6664
27 Ga0070670_100026904 3300005331 Bacteria 4948
28 Ga0068869_100003675 3300005334 Bacteria 9429
29 Ga0070666_10000854 3300005335 Bacteria 18462
30 Ga0070666_10001111 3300005335 Bacteria 16438
31 Ga0068868_100026670 3300005338 Bacteria 4406
32 Ga0068868_100029360 3300005338 Bacteria 4210
33 Ga0070660_100013779 3300005339 Bacteria 5816
34 Ga0070689_100009825 3300005340 Bacteria 6801
35 Ga0070661_100009103 3300005344 Bacteria 6866
36 Ga0070668_100052062 3300005347 Bacteria 3156
37 Ga0070669_100012476 3300005353 Bacteria 6029
38 Ga0070669_100016039 3300005353 Bacteria 5345
39 Ga0070669_100019301 3300005353 Bacteria 4869
40 Ga0070675_100001610 3300005354 Bacteria 16638
41 Ga0070675_100005707 3300005354 Bacteria 9525
42 Ga0070671_100005720 3300005355 Bacteria 9900
43 Ga0070674_100000862 3300005356 Bacteria 15764
44 Ga0070673_100000282 3300005364 Bacteria 26333
45 Ga0070673_100000903 3300005364 Bacteria 16778
46 Ga0070673_100014179 3300005364 Bacteria 5539
47 Ga0070659_100013242 3300005366 Bacteria 6133
48 Ga0070667_100012467 3300005367 Bacteria 7033
49 Ga0070714_100000274 3300005435 Bacteria 39436
50 Ga0070713_100000293 3300005436 Bacteria 33052
51 Ga0070713_100019246 3300005436 Bacteria 5207
52 Ga0070694_100002857 3300005444 Bacteria 10255
53 Ga0070663_100004792 3300005455 Bacteria 7979
54 Ga0070678_100003462 3300005456 Bacteria 8799
55 Ga0070678_100010911 3300005456 Bacteria 5575
56 Ga0070662_100000019 3300005457 Bacteria 101983
57 Ga0070681_10002224 3300005458 Bacteria 17676
58 Ga0070681_10017958 3300005458 Bacteria 7070
59 Ga0068867_100000157 3300005459 Bacteria 43891
60 Ga0068867_100001826 3300005459 Bacteria 14834
61 Ga0068867_100004091 3300005459 Bacteria 10255
62 Ga0070685_10005598 3300005466 Bacteria 6373
63 Ga0070685_10008680 3300005466 Bacteria 5233
64 Ga0070706_100004648 3300005467 Bacteria 13181
65 Ga0070706_100015645 3300005467 Bacteria 7008
66 Ga0070706_100049068 3300005467 Bacteria 3896
67 Ga0070707_100012674 3300005468 Bacteria 7874
68 Ga0070698_100001047 3300005471 Bacteria 30453
69 Ga0070698_100021884 3300005471 Bacteria 6693
70 Ga0070699_100000127 3300005518 Bacteria 70260
71 Ga0070699_100001378 3300005518 Bacteria 22316
72 Ga0070699_100023859 3300005518 Bacteria 5272
73 Ga0070699_100025408 3300005518 Bacteria 5106
74 Ga0070699_100063898 3300005518 Bacteria 3192
75 Ga0070679_100015481 3300005530 Bacteria 7330
76 Ga0070679_100024392 3300005530 Bacteria 5925
77 Ga0070684_100023895 3300005535 Bacteria 5121
78 Ga0070684_100024882 3300005535 Bacteria 5025
79 Ga0070684_100054813 3300005535 Bacteria 3474
80 Ga0070697_100000001 3300005536 Bacteria 662298
81 Ga0068853_100003128 3300005539 Bacteria 12654
82 Ga0068853_100005775 3300005539 Bacteria 9746
83 Ga0068853_100005891 3300005539 Bacteria 9666
84 Ga0068853_100013349 3300005539 Bacteria 6706
85 Ga0068853_100016874 3300005539 Bacteria 6017
86 Ga0068853_100045928 3300005539 Bacteria 3743
87 Ga0070672_100000046 3300005543 Bacteria 52932
88 Ga0070672_100001000 3300005543 Bacteria 17119
89 Ga0070672_100026834 3300005543 Bacteria 4292
90 Ga0070686_100001060 3300005544 Bacteria 15853
91 Ga0070686_100003156 3300005544 Bacteria 9018
92 Ga0070686_100003394 3300005544 Bacteria 8730
93 Ga0070665_100000020 3300005548 Bacteria 389687
94 Ga0070665_100000875 3300005548 Bacteria 38817
95 Ga0070665_100098526 3300005548 Bacteria 2928
96 Ga0070704_100010558 3300005549 Bacteria 5624
97 Ga0068855_100000404 3300005563 Bacteria 53353
98 Ga0068855_100051595 3300005563 Bacteria 4845
99 Ga0070664_100000421 3300005564 Bacteria 31658
100 Ga0070664_100005325 3300005564 Bacteria 10324
101 Ga0068856_100006981 3300005614 Bacteria 11031
102 Ga0068856_100021007 3300005614 Bacteria 6345
103 Ga0068856_100025995 3300005614 Bacteria 5709
104 Ga0068856_100039844 3300005614 Bacteria 4613
105 Ga0068856_100060389 3300005614 Bacteria 3745
106 Ga0068852_100000401 3300005616 Bacteria 29051
107 Ga0068852_100006163 3300005616 Bacteria 8649
108 Ga0068859_100009684 3300005617 Bacteria 9728
109 Ga0068859_100024372 3300005617 Bacteria 6070
110 Ga0068864_100013029 3300005618 Bacteria 6885
111 Ga0068866_10015501 3300005718 Bacteria 3387
112 Ga0068861_100000695 3300005719 Bacteria 20151
113 Ga0068851_10008019 3300005834 Bacteria 4872
114 Ga0068863_100009166 3300005841 Bacteria 9655
115 Ga0068858_100014974 3300005842 Bacteria 7297
116 Ga0068860_100002752 3300005843 Bacteria 18298
117 Ga0068860_100069025 3300005843 Bacteria 3358
118 Ga0081455_10000767 3300005937 Bacteria 41642
119 Ga0081455_10004662 3300005937 Bacteria 15265
120 Ga0081455_10007638 3300005937 Bacteria 11357
121 Ga0081455_10008430 3300005937 Bacteria 10723
122 Ga0081538_10000014 3300005981 Bacteria 151008
123 Ga0081538_10001734 3300005981 Bacteria 22156
124 Ga0081540_1003073 3300005983 Bacteria 13374
125 Ga0081540_1006684 3300005983 Bacteria 8341
126 Ga0081540_1008337 3300005983 Bacteria 7247
127 Ga0081540_1012506 3300005983 Bacteria 5580
128 Ga0081539_10004447 3300005985 Bacteria 15477
129 Ga0081539_10010566 3300005985 Bacteria 7468
130 Ga0070717_10001566 3300006028 Bacteria 15843
131 Ga0070717_10013887 3300006028 Bacteria 6185
132 Ga0075364_10004697 3300006051 Bacteria 7882
133 Ga0075367_10000361 3300006178 Bacteria 16346
134 Ga0075367_10002404 3300006178 Bacteria 8546
135 Ga0075366_10001320 3300006195 Bacteria 12374
136 Ga0075366_10001384 3300006195 Bacteria 12141
137 Ga0075366_10008593 3300006195 Bacteria 5685
138 Ga0097621_100000124 3300006237 Bacteria 44451
139 Ga0097621_100002950 3300006237 Bacteria 11688
140 Ga0097621_100005963 3300006237 Bacteria 8613
141 Ga0097621_100017727 3300006237 Bacteria 5417
142 Ga0097621_100023180 3300006237 Bacteria 4830
143 Ga0068871_100000160 3300006358 Bacteria 44466
144 Ga0068871_100002195 3300006358 Bacteria 13263
145 Ga0068871_100006247 3300006358 Bacteria 8402
146 Ga0075428_100002510 3300006844 Bacteria 19936
147 Ga0075428_100017570 3300006844 Bacteria 7901
148 Ga0075428_100019879 3300006844 Bacteria 7435
149 Ga0075428_100034759 3300006844 Bacteria 5558
150 Ga0075430_100002055 3300006846 Bacteria 16586
151 Ga0075430_100006605 3300006846 Bacteria 9774
152 Ga0075430_100031761 3300006846 Bacteria 4481
153 Ga0075430_100038235 3300006846 Bacteria 4066
154 Ga0075431_100000709 3300006847 Bacteria 28714
155 Ga0075433_10000186 3300006852 Bacteria 34901
156 Ga0075433_10002084 3300006852 Bacteria 15125
157 Ga0075433_10029559 3300006852 Bacteria 4671
158 Ga0075434_100000802 3300006871 Bacteria 24877
159 Ga0075434_100004024 3300006871 Bacteria 13175
160 Ga0075434_100005613 3300006871 Bacteria 11434
161 Ga0075434_100009429 3300006871 Bacteria 9099
162 Ga0075434_100029103 3300006871 Bacteria 5432
163 Ga0075434_100050482 3300006871 Bacteria 4132
164 Ga0075429_100001356 3300006880 Bacteria 20008
165 Ga0075429_100002113 3300006880 Bacteria 16586
166 Ga0075429_100003581 3300006880 Bacteria 13237
167 Ga0075429_100056605 3300006880 Bacteria 3413
168 Ga0068865_100001563 3300006881 Bacteria 13386
169 Ga0068865_100012442 3300006881 Bacteria 5356
170 Ga0075436_100000550 3300006914 Bacteria 24478
171 Ga0075436_100005582 3300006914 Bacteria 8635
172 Ga0097620_100009683 3300006931 Bacteria 9728
173 Ga0097620_100024372 3300006931 Bacteria 6070
174 Ga0075435_100004510 3300007076 Bacteria 9572
175 Ga0075435_100020123 3300007076 Bacteria 5106
176 Ga0075435_100035510 3300007076 Bacteria 3956
177 Ga0105251_10014719 3300009011 Bacteria 4310
178 Ga0105240_10000029 3300009093 Bacteria 325471
179 Ga0105240_10001462 3300009093 Bacteria 40375
180 Ga0105240_10013815 3300009093 Bacteria 11060
181 Ga0105240_10027916 3300009093 Bacteria 7383
182 Ga0105240_10089131 3300009093 Bacteria 3774
183 Ga0105240_10111460 3300009093 Bacteria 3310
184 Ga0111539_10000059 3300009094 Bacteria 113645
185 Ga0111539_10000298 3300009094 Bacteria 60092
186 Ga0111539_10000763 3300009094 Bacteria 41920
187 Ga0111539_10001199 3300009094 Bacteria 34503
188 Ga0111539_10004669 3300009094 Bacteria 17906
189 Ga0111539_10022794 3300009094 Bacteria 7691
190 Ga0111539_10022882 3300009094 Bacteria 7674
191 Ga0105245_10003376 3300009098 Bacteria 14305
192 Ga0105245_10004148 3300009098 Bacteria 12871
193 Ga0105245_10058315 3300009098 Bacteria 3475
194 Ga0114129_10002822 3300009147 Bacteria 24241
195 Ga0114129_10005228 3300009147 Bacteria 18287
196 Ga0114129_10023218 3300009147 Bacteria 8798
197 Ga0114129_10025822 3300009147 Bacteria 8321
198 Ga0114129_10038787 3300009147 Bacteria 6715
199 Ga0114129_10043075 3300009147 Bacteria 6353
200 Ga0114129_10114403 3300009147 Bacteria 3720
201 Ga0105243_10027406 3300009148 Bacteria 4366
202 Ga0105241_10000323 3300009174 Bacteria 36153
203 Ga0105241_10001215 3300009174 Bacteria 19707
204 Ga0105241_10021637 3300009174 Bacteria 4756
205 Ga0105242_10019792 3300009176 Bacteria 5273
206 Ga0105248_10004221 3300009177 Bacteria 15895
207 Ga0105248_10012046 3300009177 Bacteria 9538
208 Ga0105248_10016499 3300009177 Bacteria 8131
209 Ga0105248_10030054 3300009177 Bacteria 6063
210 Ga0105248_10049754 3300009177 Bacteria 4700
211 Ga0105237_10000062 3300009545 Bacteria 144236
212 Ga0105237_10000219 3300009545 Bacteria 80715
213 Ga0105237_10002584 3300009545 Bacteria 22322
214 Ga0105237_10002998 3300009545 Bacteria 20402
215 Ga0105237_10005656 3300009545 Bacteria 14064
216 Ga0105237_10005711 3300009545 Bacteria 13991
217 Ga0105237_10015601 3300009545 Bacteria 7902
218 Ga0105237_10021799 3300009545 Eukaryota 6580
219 Ga0105237_10024243 3300009545 Bacteria 6208
220 Ga0105238_10000714 3300009551 Bacteria 34756
221 Ga0105238_10030659 3300009551 Bacteria 5473
222 Ga0105238_10033754 3300009551 Bacteria 5207
223 Ga0105238_10087738 3300009551 Bacteria 3098
224 Ga0105239_10000062 3300010375 Bacteria 153782
225 Ga0105239_10001911 3300010375 Eukaryota 27138
226 Ga0105239_10009207 3300010375 Bacteria 11168
227 Ga0157373_10004651 3300013100 Bacteria 10331
228 Ga0157373_10025398 3300013100 Bacteria 4285
229 Ga0157371_10000250 3300013102 Bacteria 75550
230 Ga0157371_10008880 3300013102 Bacteria 7959
231 Ga0157371_10019548 3300013102 Bacteria 4992
232 Ga0157371_10025064 3300013102 Bacteria 4351
233 Ga0157371_10034029 3300013102 Bacteria 3658
234 Ga0157370_10015449 3300013104 Bacteria 7761
235 Ga0157370_10015939 3300013104 Bacteria 7625
236 Ga0157370_10030331 3300013104 Bacteria 5299
237 Ga0157369_10001633 3300013105 Bacteria 27410
238 Ga0157369_10025494 3300013105 Bacteria 6565
239 Ga0157369_10045208 3300013105 Bacteria 4791
240 Ga0157369_10046209 3300013105 Bacteria 4732
241 Ga0157369_10071901 3300013105 Bacteria 3712
242 Ga0157369_10085262 3300013105 Bacteria 3376
243 Ga0157374_10000746 3300013296 Bacteria 28337
244 Ga0157374_10001502 3300013296 Bacteria 19653
245 Ga0157374_10027248 3300013296 Bacteria 5152
246 Ga0157374_10041996 3300013296 Bacteria 4217
247 Ga0157378_10000103 3300013297 Bacteria 80099
248 Ga0157378_10000578 3300013297 Bacteria 34492
249 Ga0157378_10001933 3300013297 Bacteria 18577
250 Ga0157378_10002021 3300013297 Bacteria 18141
251 Ga0157378_10012406 3300013297 Bacteria 7461
252 Ga0157378_10012886 3300013297 Bacteria 7321
253 Ga0157378_10014126 3300013297 Bacteria 6988
254 Ga0163162_10000083 3300013306 Bacteria 86303
255 Ga0163162_10013909 3300013306 Bacteria 7861
256 Ga0163162_10026296 3300013306 Bacteria 5751
257 Ga0163162_10067945 3300013306 Bacteria 3615
258 Ga0157372_10002437 3300013307 Bacteria 20152
259 Ga0157372_10003802 3300013307 Bacteria 16210
260 Ga0157372_10028804 3300013307 Bacteria 6061
261 Ga0157372_10082344 3300013307 Bacteria 3643
262 Ga0157375_10002741 3300013308 Bacteria 15224
263 Ga0163163_10000022 3300014325 Bacteria 187289
264 Ga0163163_10022617 3300014325 Bacteria 5958
265 Ga0163163_10065412 3300014325 Bacteria 3609
266 Ga0157380_10001679 3300014326 Bacteria 14618
267 Ga0157380_10020389 3300014326 Bacteria 4955
268 Ga0157379_10014452 3300014968 Bacteria 6928
269 Ga0157376_10004159 3300014969 Bacteria 10033
270 Ga0157376_10019391 3300014969 Bacteria 5242
271 Ga0163161_10003396 3300017792 Bacteria 11175
272 Ga0163161_10013161 3300017792 Bacteria 5751
273 Ga0213872_10010134 3300021361 Bacteria 4495
274 Ga0213874_10000160 3300021377 Bacteria 11888
275 Ga0213874_10001399 3300021377 Bacteria 4987
276 Ga0213876_10000716 3300021384 Bacteria 23196
277 Ga0213876_10017469 3300021384 Bacteria 3787
278 Ga0213875_10000008 3300021388 Bacteria 533344
279 Ga0213875_10000575 3300021388 Bacteria 29979
280 Ga0213875_10004666 3300021388 Bacteria 7466
281 Ga0213875_10016306 3300021388 Bacteria 3605
282 Ga0209437_100017 3300025233 Bacteria 694471
283 Ga0209676_1000009 3300025292 Bacteria 981719
284 Ga0209676_1001142 3300025292 Bacteria 29031
285 Ga0209050_1000048 3300025298 Bacteria 371553
286 Ga0207697_10001618 3300025315 Bacteria 12158
287 Ga0207655_1000006 3300025728 Bacteria 861092
288 Ga0207682_10000683 3300025893 Bacteria 15756
289 Ga0207642_10004342 3300025899 Bacteria 4571
290 Ga0207647_10001006 3300025904 Bacteria 21888
291 Ga0207647_10005268 3300025904 Bacteria 9517
292 Ga0207645_10001043 3300025907 Bacteria 22916
293 Ga0207645_10001053 3300025907 Bacteria 22848
294 Ga0207645_10005809 3300025907 Bacteria 8897
295 Ga0207643_10004136 3300025908 Bacteria 7816
296 Ga0207705_10008618 3300025909 Bacteria 7434
297 Ga0207684_10013251 3300025910 Bacteria 7135
298 Ga0207684_10034071 3300025910 Bacteria 4328
299 Ga0207684_10042077 3300025910 Bacteria 3872
300 Ga0207684_10048083 3300025910 Bacteria 3618
301 Ga0207654_10000217 3300025911 Bacteria 35359
302 Ga0207654_10019976 3300025911 Bacteria 3544
303 Ga0207695_10000034 3300025913 Bacteria 496728
304 Ga0207695_10001628 3300025913 Bacteria 36329
305 Ga0207695_10013733 3300025913 Bacteria 9636
306 Ga0207671_10000140 3300025914 Bacteria 111643
307 Ga0207671_10000250 3300025914 Bacteria 80704
308 Ga0207671_10000951 3300025914 Bacteria 35984
309 Ga0207671_10001128 3300025914 Bacteria 32167
310 Ga0207671_10005846 3300025914 Bacteria 11176
311 Ga0207671_10013546 3300025914 Eukaryota 6492
312 Ga0207671_10014302 3300025914 Bacteria 6278
313 Ga0207693_10003151 3300025915 Bacteria 14182
314 Ga0207663_10020792 3300025916 Bacteria 3724
315 Ga0207662_10009849 3300025918 Bacteria 5273
316 Ga0207657_10011844 3300025919 Bacteria 8634
317 Ga0207657_10049712 3300025919 Bacteria 3651
318 Ga0207652_10011392 3300025921 Bacteria 7167
319 Ga0207646_10014010 3300025922 Bacteria 7633
320 Ga0207694_10000201 3300025924 Bacteria 59771
321 Ga0207694_10009343 3300025924 Bacteria 7397
322 Ga0207694_10033150 3300025924 Bacteria 3956
323 Ga0207650_10006006 3300025925 Bacteria 8284
324 Ga0207650_10022164 3300025925 Bacteria 4496
325 Ga0207659_10015019 3300025926 Bacteria 5007
326 Ga0207659_10025073 3300025926 Bacteria 4003
327 Ga0207687_10020397 3300025927 Bacteria 4396
328 Ga0207700_10009430 3300025928 Bacteria 6096
329 Ga0207644_10007547 3300025931 Bacteria 7091
330 Ga0207644_10021060 3300025931 Bacteria 4439
331 Ga0207644_10035215 3300025931 Bacteria 3506
332 Ga0207706_10000058 3300025933 Bacteria 112367
333 Ga0207706_10000968 3300025933 Bacteria 29344
334 Ga0207706_10008173 3300025933 Bacteria 9653
335 Ga0207706_10017962 3300025933 Bacteria 6366
336 Ga0207709_10025704 3300025935 Bacteria 3373
337 Ga0207704_10000135 3300025938 Bacteria 40033
338 Ga0207691_10000274 3300025940 Bacteria 51054
339 Ga0207711_10004963 3300025941 Bacteria 11292
340 Ga0207711_10010971 3300025941 Bacteria 7526
341 Ga0207711_10013816 3300025941 Bacteria 6703
342 Ga0207689_10000460 3300025942 Bacteria 38128
343 Ga0207689_10007207 3300025942 Bacteria 9768
344 Ga0207661_10023531 3300025944 Bacteria 4656
345 Ga0207661_10035690 3300025944 Bacteria 3877
346 Ga0207679_10006255 3300025945 Bacteria 7513
347 Ga0207667_10000474 3300025949 Bacteria 53654
348 Ga0207667_10007872 3300025949 Bacteria 12727
349 Ga0207667_10016629 3300025949 Bacteria 8305
350 Ga0207667_10034268 3300025949 Bacteria 5453
351 Ga0207667_10049699 3300025949 Bacteria 4427
352 Ga0207667_10066274 3300025949 Bacteria 3764
353 Ga0207651_10000435 3300025960 Bacteria 17629
354 Ga0207651_10004269 3300025960 Bacteria 7170
355 Ga0207640_10016744 3300025981 Bacteria 4272
356 Ga0207658_10008617 3300025986 Bacteria 6937
357 Ga0207677_10011615 3300026023 Bacteria 5027
358 Ga0207703_10036818 3300026035 Bacteria 3896
359 Ga0207639_10000059 3300026041 Bacteria 108373
360 Ga0207639_10003795 3300026041 Bacteria 10170
361 Ga0207639_10007316 3300026041 Bacteria 7520
362 Ga0207639_10023757 3300026041 Bacteria 4428
363 Ga0207678_10003949 3300026067 Bacteria 13344
364 Ga0207708_10006550 3300026075 Bacteria 8616
365 Ga0207708_10035161 3300026075 Bacteria 3813
366 Ga0207702_10002237 3300026078 Bacteria 18564
367 Ga0207702_10012718 3300026078 Bacteria 7003
368 Ga0207702_10017513 3300026078 Bacteria 5927
369 Ga0207641_10009835 3300026088 Bacteria 7875
370 Ga0207641_10028103 3300026088 Bacteria 4645
371 Ga0207648_10000275 3300026089 Bacteria 55875
372 Ga0207648_10003356 3300026089 Bacteria 16833
373 Ga0207648_10005143 3300026089 Bacteria 13243
374 Ga0207648_10006458 3300026089 Bacteria 11646
375 Ga0207676_10014130 3300026095 Bacteria 5735
376 Ga0207674_10000413 3300026116 Bacteria 55635
377 Ga0207674_10023660 3300026116 Bacteria 6576
378 Ga0207675_100002914 3300026118 Bacteria 16825
379 Ga0207683_10000078 3300026121 Bacteria 77219
380 Ga0207698_10000202 3300026142 Bacteria 37470
381 Ga0207698_10005206 3300026142 Bacteria 7998
382 Ga0207428_10000066 3300027907 Bacteria 150622
383 Ga0207428_10000253 3300027907 Bacteria 73122
384 Ga0207428_10000753 3300027907 Bacteria 37020
385 Ga0207428_10001158 3300027907 Bacteria 28488
386 Ga0207428_10002348 3300027907 Bacteria 18901
387 Ga0207428_10012489 3300027907 Bacteria 7460
388 Ga0265356_1000878 3300028017 Bacteria 4923
389 Ga0268266_10000018 3300028379 Bacteria 569141
390 Ga0268266_10001104 3300028379 Bacteria 33828
391 Ga0268266_10003557 3300028379 Bacteria 15449
392 Ga0268265_10007215 3300028380 Bacteria 7511
393 Ga0268264_10023900 3300028381 Bacteria 4985
394 Ga0268264_10033961 3300028381 Bacteria 4193
395 Ga0265319_1000568 3300028563 Bacteria 24914
396 Ga0265319_1001513 3300028563 Bacteria 13799
397 Ga0265334_10002734 3300028573 Bacteria 8155
398 Ga0265318_10000177 3300028577 Bacteria 56517
399 Ga0265318_10009320 3300028577 Bacteria 4320
400 Ga0307517_10020409 3300028786 Bacteria 8440
401 Ga0307515_10000432 3300028794 Bacteria 100348
402 Ga0307515_10002380 3300028794 Eukaryota 41028
403 Ga0307515_10009167 3300028794 Bacteria 19183
404 Ga0265338_10000064 3300028800 Bacteria 190219
405 Ga0265338_10001461 3300028800 Bacteria 38300
406 Ga0265338_10007889 3300028800 Bacteria 13059
407 Ga0265338_10018515 3300028800 Bacteria 7452
408 Ga0265338_10031787 3300028800 Bacteria 5166
409 Ga0265324_10000700 3300029957 Bacteria 22374
410 Ga0265760_10000709 3300031090 Bacteria 9490
411 Ga0265330_10000905 3300031235 Bacteria 18342
412 Ga0265332_10000169 3300031238 Bacteria 53146
413 Ga0265332_10000386 3300031238 Bacteria 32118
414 Ga0265332_10005881 3300031238 Bacteria 5612
415 Ga0265328_10007617 3300031239 Bacteria 4504
416 Ga0265320_10001302 3300031240 Bacteria 18219
417 Ga0265320_10016372 3300031240 Bacteria 4157
418 Ga0265329_10000042 3300031242 Bacteria 53592
419 Ga0265340_10003855 3300031247 Bacteria 8449
420 Ga0265339_10001025 3300031249 Bacteria 21308
421 Ga0265331_10000117 3300031250 Bacteria 104134
422 Ga0265331_10001952 3300031250 Bacteria 14414
423 Ga0265316_10000031 3300031344 Bacteria 161451
424 Ga0265316_10003028 3300031344 Bacteria 17172
425 Ga0265316_10049735 3300031344 Bacteria 3300
426 Ga0307509_10012358 3300031507 Bacteria 10222
427 Ga0307408_100004766 3300031548 Bacteria 9145
428 Ga0265313_10001541 3300031595 Bacteria 21408
429 Ga0265313_10002676 3300031595 Bacteria 15100
430 Ga0265313_10013040 3300031595 Bacteria 5023
431 Ga0265313_10020776 3300031595 Bacteria 3613
432 Ga0307508_10003774 3300031616 Bacteria 15133
433 Ga0316575_10002167 3300031665 Bacteria 6550
434 Ga0265314_10000183 3300031711 Bacteria 92559
435 Ga0265314_10003487 3300031711 Bacteria 15188
436 Ga0265314_10004880 3300031711 Bacteria 12262
437 Ga0265342_10000199 3300031712 Bacteria 67101
438 Ga0265342_10000869 3300031712 Bacteria 30180
439 Ga0316576_10006030 3300031727 Bacteria 7490
440 Ga0316576_10043509 3300031727 Bacteria 3240
441 Ga0316578_10007781 3300031728 Bacteria 5407
442 Ga0307516_10006229 3300031730 Bacteria 14036
443 Ga0307409_100027562 3300031995 Bacteria 4028
444 Ga0307416_100021502 3300032002 Bacteria 4633
445 Ga0316585_10006113 3300032137 Bacteria 3430
446 Ga0307507_10001092 3300033179 Bacteria 60190
447 Ga0307507_10002761 3300033179 Eukaryota 35894
448 Ga0307510_10001317 3300033180 Bacteria 27057
449 Ga0373926_0000012 3300035083 Bacteria 31305
450 Ga0373926_0000044 3300035083 Bacteria 20723
451 Ga0373926_0000807 3300035083 Bacteria 8852
452 Ga0373949_0000055 3300035090 Bacteria 42961
453 Ga0373943_0000147 3300035170 Bacteria 27190
454 Ga0373943_0000950 3300035170 Bacteria 12834
455 Ga0373955_0025808 3300035172 Bacteria 3021
456 Ga0316574_0000052 3300035398 Bacteria 29685
457 Ga0373935_0003782 3300035692 Bacteria 8837
458 Ga0373927_0000302 3300035695 Bacteria 38848
459 Ga0373927_0000357 3300035695 Bacteria 35562
460 Ga0373927_0002350 3300035695 Bacteria 13792
461 Ga0373947_0000283 3300035725 Bacteria 28730
462 Ga0373947_0005503 3300035725 Bacteria 7389
463 Ga0373937_0000117 3300036401 Bacteria 75969
464 Ga0373937_0017949 3300036401 Bacteria 6312
465 Ga0373937_0036587 3300036401 Bacteria 4474
466 Ga0373937_0067782 3300036401 Bacteria 3289
467 Ga0316582_0000166 3300036647 Bacteria 20311
468 Ga0316584_0007826 3300036712 Bacteria 7331
469 Ga0373925_0000225 3300037068 Bacteria 60424
470 Ga0373925_0001747 3300037068 Bacteria 18178
471 Ga0373925_0012787 3300037068 Bacteria 6079
472 Ga0395899_0000001 3300037312 Bacteria 1750322
473 Ga0395899_0000232 3300037312 Bacteria 75259
474 Ga0395899_0001442 3300037312 Bacteria 20302
475 Ga0395900_0000517 3300037418 Bacteria 54614
476 Ga0395900_0001891 3300037418 Bacteria 23809
477 Ga0395900_0078499 3300037418 Bacteria 3392
478 Ga0395898_0008170 3300037466 Bacteria 11078
479 Ga0395905_0008935 3300037471 Bacteria 9838
480 Ga0395905_0015572 3300037471 Bacteria 7226
481 Ga0316581_0004132 3300037588 Bacteria 3673
482 Ga0436364_0719353 3300037853 Bacteria 4009
483 Ga0436364_0909399 3300037853 Bacteria 4447
484 Ga0436364_1008502 3300037853 Bacteria 66010
485 Ga0436364_1259742 3300037853 Bacteria 7800
486 Ga0436364_1310913 3300037853 Bacteria 5425
487 Ga0436364_1393295 3300037853 Bacteria 9285
488 Ga0436364_1415525 3300037853 Bacteria 425173
489 Ga0436364_1421630 3300037853 Bacteria 2993
490 Ga0395901_0001035 3300038443 Bacteria 30039
491 Ga0400488_59865 3300038741 Bacteria 3211
492 Ga0436365_0042253 3300039437 Bacteria 6291
493 Ga0436365_0292949 3300039437 Bacteria 9608
494 Ga0436365_0886091 3300039437 Bacteria 43353
495 Ga0436365_0957937 3300039437 Bacteria 2797
496 Ga0436360_0213572 3300039438 Bacteria 12542
497 Ga0436360_1078765 3300039438 Bacteria 3031
498 Ga0436361_0046678 3300039447 Bacteria 18062
499 Ga0436361_0403733 3300039447 Bacteria 6876
500 Ga0436361_0738714 3300039447 Bacteria 102195
501 Ga0436361_1164749 3300039447 Bacteria 25165
502 Ga0436363_0172570 3300039450 Bacteria 47063
503 Ga0436363_0507032 3300039450 Bacteria 7511
504 Ga0436363_0573267 3300039450 Bacteria 6006
505 Ga0436363_1495906 3300039450 Bacteria 5761
506 Ga0436362_0555205 3300039453 Bacteria 4175
507 Ga0436362_0688989 3300039453 Bacteria 6117
508 Ga0451577_0000583 3300042876 Bacteria 58778
509 Ga0451577_0003269 3300042876 Bacteria 18241
510 Ga0451577_0033220 3300042876 Bacteria 4651
511 Ga0453684_0000841 3300044712 Bacteria 103501
512 Ga0453684_0002278 3300044712 Bacteria 47319
513 Ga0453684_0009932 3300044712 Bacteria 16422
514 Ga0453684_0075714 3300044712 Bacteria 4228
515 Ga0451576_0000191 3300045051 Bacteria 154184
516 Ga0451576_0003755 3300045051 Bacteria 20494
517 Ga0451576_0005819 3300045051 Bacteria 15325
518 Ga0495650_0000003 3300046471 Bacteria 900730
519 Ga0495580_0003375 3300046472 Bacteria 13646
520 Ga0495580_0026941 3300046472 Bacteria 4186
521 Ga0495582_0004962 3300046473 Bacteria 7454
522 Ga0495582_0029851 3300046473 Bacteria 2993
523 Ga0495585_0000470 3300046492 Bacteria 38600
524 Ga0495585_0001492 3300046492 Bacteria 18281
525 Ga0495585_0013845 3300046492 Bacteria 4713
526 Ga0495594_0002318 3300046499 Bacteria 9912
527 Ga0495606_0002345 3300046507 Bacteria 22272
528 Ga0495606_0018132 3300046507 Bacteria 5291
529 Ga0495606_0052490 3300046507 Bacteria 2651
530 Ga0495610_0002357 3300046512 Bacteria 15964
531 Ga0495610_0002626 3300046512 Bacteria 14866
532 Ga0495610_0003108 3300046512 Bacteria 13229
533 Ga0495628_0025165 3300046516 Bacteria 4864
534 Ga0495630_0000583 3300046517 Bacteria 26620
535 Ga0495630_0002677 3300046517 Bacteria 12350
536 Ga0495630_0028069 3300046517 Bacteria 4181
537 Ga0495631_0007485 3300046518 Bacteria 5549
538 Ga0495637_0018362 3300046520 Bacteria 3245
539 Ga0495644_0000055 3300046523 Bacteria 55317
540 Ga0495652_0049119 3300046529 Bacteria 3613
541 Ga0495609_0012695 3300046538 Bacteria 3994
542 Ga0495633_0000014 3300046558 Bacteria 261742
543 Ga0495633_0004016 3300046558 Bacteria 9522
544 Ga0495668_0000003 3300046616 Bacteria 695023
545 Ga0495625_0000219 3300046660 Bacteria 90690
546 Ga0495625_0000248 3300046660 Bacteria 84339
547 Ga0495625_0004001 3300046660 Bacteria 14116
548 Ga0495661_0001961 3300046665 Bacteria 16336
549 Ga0495661_0035364 3300046665 Bacteria 3135
550 Ga0495588_0000001 3300046674 Eukaryota 1451569
551 Ga0495649_0000037 3300046694 Bacteria 133848
552 Ga0495660_0007425 3300046810 Bacteria 6436
553 Ga0495687_000942 3300047443 Bacteria 30043
554 Ga0495687_018101 3300047443 Bacteria 3491
555 Ga0495684_0001768 3300047471 Bacteria 17334
556 Ga0495686_0000264 3300047472 Bacteria 93838
557 Ga0495602_0007513 3300048088 Bacteria 11398
558 Ga0496101_0016026 3300048904 Bacteria 5059
559 Ga0496102_0004825 3300048905 Bacteria 11401
560 Ga0496104_0002107 3300048907 Bacteria 17270
561 Ga0496104_0004026 3300048907 Bacteria 12740
562 Ga0496104_0009366 3300048907 Bacteria 8708
563 Ga0496106_0025262 3300048909 Bacteria 4420
564 Ga0496110_0065775 3300048913 Bacteria 3205
565 Ga0496111_0002881 3300048914 Bacteria 10508
566 Ga0496111_0005566 3300048914 Bacteria 8095
567 Ga0496112_0049285 3300048915 Bacteria 4128
568 Ga0496112_0096597 3300048915 Bacteria 2925
569 Ga0496112_0119973 3300048915 Bacteria 2600
570 Ga0496113_0001502 3300048916 Bacteria 13057
571 Ga0496114_0002337 3300048917 Bacteria 14432
572 Ga0496114_0018040 3300048917 Bacteria 5702
573 Ga0496115_0011538 3300048918 Bacteria 6624
574 Ga0496115_0022588 3300048918 Bacteria 4877
575 Ga0501032_0039727 3300049569 Bacteria 3200
576 Ga0501033_0025418 3300049570 Bacteria 4462
577 Ga0501034_0007570 3300049571 Bacteria 11555
578 Ga0501036_0000593 3300049572 Bacteria 26259
579 Ga0501038_0002658 3300049574 Bacteria 16701
580 Ga0501041_0006893 3300049577 Bacteria 6661
581 Ga0501041_0010676 3300049577 Bacteria 5418
582 Ga0501042_0003168 3300049578 Bacteria 10254
583 Ga0501042_0005677 3300049578 Bacteria 8053
584 Ga0501042_0034052 3300049578 Bacteria 3613
585 Ga0501047_0013859 3300049581 Bacteria 7655
586 Ga0501047_0017503 3300049581 Bacteria 6865
587 Ga0501068_0005764 3300049584 Bacteria 6792
588 Ga0501070_0007263 3300049586 Bacteria 9406
589 Ga0501072_0000549 3300049588 Bacteria 26969
590 Ga0501072_0008834 3300049588 Bacteria 7655
591 Ga0501073_0021126 3300049589 Bacteria 4695
592 Ga0501075_0000014 3300049591 Bacteria 77078
593 Ga0501075_0000136 3300049591 Bacteria 36442
594 Ga0501075_0026732 3300049591 Bacteria 4250
595 Ga0501076_0000016 3300049592 Bacteria 94865
596 Ga0501076_0000072 3300049592 Bacteria 50636
597 Ga0501076_0013423 3300049592 Bacteria 6143
598 Ga0501079_0001520 3300049741 Bacteria 16418
599 Ga0501079_0005299 3300049741 Bacteria 9594
600 Ga0501080_0006644 3300049742 Bacteria 10404
601 Ga0501080_0020084 3300049742 Bacteria 6183
602 Ga0501080_0025090 3300049742 Bacteria 5532
603 Ga0501081_0026494 3300049743 Bacteria 3910
604 Ga0501083_0001033 3300049744 Bacteria 18569
605 Ga0501083_0029764 3300049744 Bacteria 3753
606 Ga0501044_0000235 3300049823 Bacteria 69800
607 Ga0501044_0002405 3300049823 Bacteria 21347
608 Ga0501044_0022588 3300049823 Bacteria 6703
609 nmdc:mga00v17_2275_c1 3300050491 Bacteria 9851
610 nmdc:mga00v17_2693_c1 3300050491 Bacteria 9116
611 nmdc:mga0k408_1228_c1 3300050493 Bacteria 14040
612 nmdc:mga0k408_1402_c1 3300050493 Bacteria 13042
613 nmdc:mga0k408_19032_c1 3300050493 Bacteria 3834
614 nmdc:mga0k408_9140_c1 3300050493 Bacteria 4420
615 nmdc:mga06z11_739_c1 3300050494 Bacteria 11950
616 nmdc:mga06z11_7621_c1 3300050494 Bacteria 4468
617 nmdc:mga05p37_19278_c1 3300050507 Bacteria 8251
618 nmdc:mga05p37_27947_c1 3300050507 Bacteria 6872
619 nmdc:mga05p37_2963_c1 3300050507 Bacteria 19704
620 nmdc:mga05p37_29951_c1 3300050507 Bacteria 6643
621 nmdc:mga05p37_3891_c1 3300050507 Bacteria 17465
622 nmdc:mga05p37_46198_c1 3300050507 Bacteria 5355
623 nmdc:mga05p37_8551_c1 3300050507 Bacteria 12099
624 nmdc:mga05p37_99468_c1 3300050507 Bacteria 3582
625 nmdc:mga09592_1969_c1 3300050508 Bacteria 16568
626 nmdc:mga09592_37019_c1 3300050508 Bacteria 4090
627 nmdc:mga09592_534_c2 3300050508 Bacteria 20140
628 nmdc:mga09592_6313_c1 3300050508 Bacteria 9659
629 nmdc:mga09592_6474_c1 3300050508 Bacteria 9538
630 nmdc:mga09592_868_c1 3300050508 Bacteria 23666
631 nmdc:mga0qj67_1220_c1 3300050509 Bacteria 17900
632 nmdc:mga0qj67_15_c3 3300050509 Bacteria 20140
633 nmdc:mga0qj67_20011_c1 3300050509 Bacteria 5121
634 nmdc:mga0qj67_21054_c1 3300050509 Bacteria 4999
635 nmdc:mga0qj67_531_c1 3300050509 Bacteria 25967
636 nmdc:mga06r32_2168_c1 3300050510 Bacteria 17570
637 nmdc:mga06r32_222_c1 3300050510 Bacteria 46046
638 nmdc:mga06r32_447_c1 3300050510 Bacteria 28100
639 nmdc:mga08y16_1066_c1 3300050511 Bacteria 26995
640 nmdc:mga08y16_150_c1 3300050511 Bacteria 60170
641 nmdc:mga08y16_252_c1 3300050511 Bacteria 48080
642 nmdc:mga08y16_3079_c1 3300050511 Bacteria 17242
643 nmdc:mga08y16_340_c1 3300050511 Bacteria 42385
644 nmdc:mga08y16_4051_c1 3300050511 Bacteria 15292
645 nmdc:mga0n895_11451_c1 3300050512 Bacteria 7914
646 nmdc:mga0n895_54365_c1 3300050512 Bacteria 3938
647 nmdc:mga0n895_783_c1 3300050512 Bacteria 22639
648 nmdc:mga0rr50_320_c1 3300050513 Bacteria 26011
649 nmdc:mga0rr50_3738_c1 3300050513 Bacteria 8818
650 nmdc:mga0rr50_42643_c1 3300050513 Bacteria 3315
651 nmdc:mga0rr50_6553_c1 3300050513 Bacteria 7105
652 nmdc:mga08x19_2334_c1 3300050514 Bacteria 11514
653 nmdc:mga08x19_516_c1 3300050514 Bacteria 25703
654 nmdc:mga0a205_22694_c1 3300050515 Bacteria 5949
655 nmdc:mga0a205_73076_c1 3300050515 Bacteria 3314
656 nmdc:mga0a205_8671_c1 3300050515 Bacteria 9257
657 Ga0500555_000008 3300053103 Bacteria 282333
658 Ga0500595_000061 3300053119 Bacteria 78756
659 Ga0500608_000370 3300053122 Bacteria 17462
660 Ga0500618_000002 3300053125 Bacteria 370822
661 Ga0500616_0006347 3300053153 Bacteria 7758
662 Ga0500624_000418 3300053157 Bacteria 13022
663 Ga0501084_0000930 3300054114 Bacteria 22664
664 Ga0501084_0008554 3300054114 Bacteria 8464
665 Ga0501084_0023579 3300054114 Bacteria 5132
666 Ga0501082_0004179 3300060353 Bacteria 12621
667 Ga0501082_0019166 3300060353 Bacteria 5895
668 Ga0501082_0039599 3300060353 Bacteria 4066
669 Ga0530510_0000153 3300061734 Bacteria 41115
670 Ga0530510_0000214 3300061734 Bacteria 35923
671 Ga0530510_0007034 3300061734 Bacteria 7835
672 Ga0530510_0013872 3300061734 Bacteria 5674

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053122 Ga0500608_000370 Ga0500608_000370_11645_13762 692
2 3300046507 Ga0495606_0052490 Ga0495606_0052490_37_2286 723
3 3300050493 nmdc:mga0k408_19032_c1 nmdc:mga0k408_19032_c1_30_2342 751
4 3300048915 Ga0496112_0119973 Ga0496112_0119973_225_2576 753
5 3300009177 Ga0105248_10016499 Ga0105248_100164991 761
6 3300049577 Ga0501041_0010676 Ga0501041_0010676_3035_5389 765
7 3300028794 Ga0307515_10002380 Ga0307515_1000238038 766
8 3300033179 Ga0307507_10002761 Ga0307507_1000276119 767
9 3300046674 Ga0495588_0000001 Ga0495588_0000001_244473_246821 780
10 3300005983 Ga0081540_1012506 Ga0081540_10125061 790
11 3300039447 Ga0436361_0403733 Ga0436361_0403733_4423_6855 794
12 3300046473 Ga0495582_0029851 Ga0495582_0029851_503_2935 794
13 3300046558 Ga0495633_0000014 Ga0495633_0000014_80724_83186 796
14 3300005272 Ga0065703_1003925 Ga0065703_10039252 804
15 3300037853 Ga0436364_1421630 Ga0436364_1421630_40_2520 813
16 3300009551 Ga0105238_10087738 Ga0105238_100877382 821
17 3300013104 Ga0157370_10015939 Ga0157370_100159393 825
18 3300005288 Ga0065714_10004171 Ga0065714_100041713 829
19 3300013102 Ga0157371_10000250 Ga0157371_1000025018 829
20 3300039437 Ga0436365_0957937 Ga0436365_0957937_13_2574 831
21 3300013105 Ga0157369_10085262 Ga0157369_100852622 833
22 3300025944 Ga0207661_10023531 Ga0207661_100235313 833
23 3300050515 nmdc:mga0a205_22694_c1 nmdc:mga0a205_22694_c1_2888_5440 833
24 3300006195 Ga0075366_10001320 Ga0075366_100013205 835
25 3300028794 Ga0307515_10000432 Ga0307515_1000043249 835
26 3300046660 Ga0495625_0004001 Ga0495625_0004001_7900_10497 835
27 3300050493 nmdc:mga0k408_1228_c1 nmdc:mga0k408_1228_c1_8634_11231 835
28 3300009545 Ga0105237_10002998 Ga0105237_100029981 836
29 3300009545 Ga0105237_10005711 Ga0105237_100057115 836
30 3300013102 Ga0157371_10034029 Ga0157371_100340292 836
31 3300013297 Ga0157378_10000578 Ga0157378_1000057820 836
32 3300025914 Ga0207671_10001128 Ga0207671_100011281 836
33 3300025914 Ga0207671_10014302 Ga0207671_100143021 836
34 3300046492 Ga0495585_0001492 Ga0495585_0001492_9586_12183 836
35 3300046616 Ga0495668_0000003 Ga0495668_0000003_327930_330527 836
36 3300046660 Ga0495625_0000248 Ga0495625_0000248_3461_6058 836
37 3300048917 Ga0496114_0002337 Ga0496114_0002337_4440_7010 836
38 3300050511 nmdc:mga08y16_1066_c1 nmdc:mga08y16_1066_c1_24299_26869 836
39 3300031507 Ga0307509_10012358 Ga0307509_100123584 837
40 3300005536 Ga0070697_100000001 Ga0070697_100000001184 838
41 3300001989 JGI24739J22299_10005528 JGI24739J22299_100055281 839
42 3300001990 JGI24737J22298_10001133 JGI24737J22298_100011335 839
43 3300001990 JGI24737J22298_10004156 JGI24737J22298_100041561 839
44 3300002067 JGI24735J21928_10000002 JGI24735J21928_10000002406 839
45 3300006195 Ga0075366_10008593 Ga0075366_100085932 839
46 3300013102 Ga0157371_10008880 Ga0157371_100088803 839
47 3300025904 Ga0207647_10001006 Ga0207647_1000100623 839
48 3300025949 Ga0207667_10049699 Ga0207667_100496993 839
49 3300047443 Ga0495687_018101 Ga0495687_018101_854_3454 839
50 3300013306 Ga0163162_10026296 Ga0163162_100262964 840
51 3300039438 Ga0436360_1078765 Ga0436360_1078765_101_2671 840
52 3300046471 Ga0495650_0000003 Ga0495650_0000003_848976_851576 840
53 3300046492 Ga0495585_0000470 Ga0495585_0000470_25295_27895 840
54 3300046507 Ga0495606_0002345 Ga0495606_0002345_9149_11749 840
55 3300046512 Ga0495610_0002357 Ga0495610_0002357_5138_7738 840
56 3300046558 Ga0495633_0004016 Ga0495633_0004016_3630_6230 840
57 3300046660 Ga0495625_0000219 Ga0495625_0000219_84529_87129 840
58 3300046665 Ga0495661_0001961 Ga0495661_0001961_8560_11160 840
59 3300046665 Ga0495661_0035364 Ga0495661_0035364_245_2845 840
60 3300046694 Ga0495649_0000037 Ga0495649_0000037_84328_86928 840
61 3300005459 Ga0068867_100000157 Ga0068867_1000001573 841
62 3300025910 Ga0207684_10034071 Ga0207684_100340712 841
63 3300046810 Ga0495660_0007425 Ga0495660_0007425_847_3447 842
64 3300005981 Ga0081538_10000014 Ga0081538_1000001458 843
65 3300009174 Ga0105241_10021637 Ga0105241_100216373 843
66 3300039437 Ga0436365_0042253 Ga0436365_0042253_841_3501 843
67 3300039453 Ga0436362_0555205 Ga0436362_0555205_1331_3913 843
68 3300048917 Ga0496114_0018040 Ga0496114_0018040_3076_5685 844
69 3300038741 Ga0400488_59865 Ga0400488_59865_321_3023 845
70 3300006847 Ga0075431_100000709 Ga0075431_10000070917 846
71 3300006880 Ga0075429_100001356 Ga0075429_1000013565 846
72 3300050508 nmdc:mga09592_1969_c1 nmdc:mga09592_1969_c1_5326_8037 846
73 3300050510 nmdc:mga06r32_222_c1 nmdc:mga06r32_222_c1_22210_24921 846
74 3300053119 Ga0500595_000061 Ga0500595_000061_17812_20451 846
75 3300005614 Ga0068856_100039844 Ga0068856_1000398443 847
76 3300026078 Ga0207702_10012718 Ga0207702_100127182 847
77 3300049584 Ga0501068_0005764 Ga0501068_0005764_1607_4294 847
78 3300049589 Ga0501073_0021126 Ga0501073_0021126_1958_4645 847
79 3300006051 Ga0075364_10004697 Ga0075364_100046974 848
80 3300014969 Ga0157376_10019391 Ga0157376_100193912 848
81 3300028563 Ga0265319_1000568 Ga0265319_100056811 848
82 3300028577 Ga0265318_10000177 Ga0265318_1000017714 848
83 3300031235 Ga0265330_10000905 Ga0265330_1000090518 848
84 3300031238 Ga0265332_10000386 Ga0265332_1000038618 848
85 3300031240 Ga0265320_10001302 Ga0265320_100013024 848
86 3300031242 Ga0265329_10000042 Ga0265329_1000004218 848
87 3300031250 Ga0265331_10001952 Ga0265331_1000195214 848
88 3300031344 Ga0265316_10003028 Ga0265316_1000302816 848
89 3300031595 Ga0265313_10001541 Ga0265313_1000154119 848
90 3300031711 Ga0265314_10003487 Ga0265314_1000348715 848
91 3300031712 Ga0265342_10000199 Ga0265342_1000019918 848
92 3300039437 Ga0436365_0292949 Ga0436365_0292949_5856_8573 848
93 3300046529 Ga0495652_0049119 Ga0495652_0049119_569_3259 848
94 3300050491 nmdc:mga00v17_2693_c1 nmdc:mga00v17_2693_c1_2501_5197 848
95 3300050507 nmdc:mga05p37_46198_c1 nmdc:mga05p37_46198_c1_2678_5275 848
96 iso_pu_bacteria 2919437846 2919441241 848
97 3300028800 Ga0265338_10000064 Ga0265338_1000006496 849
98 3300028800 Ga0265338_10001461 Ga0265338_1000146133 849
99 3300029957 Ga0265324_10000700 Ga0265324_1000070013 849
100 iso_pu_bacteria 2599185184 2599478547 849
101 iso_pu_bacteria 2928078545 2928080399 849
102 iso_pu_bacteria 2928147474 2928149428 849
103 iso_pu_bacteria 2932082852 2932083258 849
104 3300005455 Ga0070663_100004792 Ga0070663_1000047927 850
105 3300005518 Ga0070699_100001378 Ga0070699_10000137810 850
106 3300021384 Ga0213876_10017469 Ga0213876_100174692 850
107 3300028800 Ga0265338_10007889 Ga0265338_100078893 850
108 3300037312 Ga0395899_0000232 Ga0395899_0000232_70025_72616 850
109 3300003320 rootH2_10001891 rootH2_1000189160 851
110 3300005328 Ga0070676_10000160 Ga0070676_1000016017 851
111 3300005457 Ga0070662_100000019 Ga0070662_1000000197 851
112 3300005539 Ga0068853_100003128 Ga0068853_1000031286 851
113 3300005539 Ga0068853_100013349 Ga0068853_1000133495 851
114 3300005548 Ga0070665_100000020 Ga0070665_10000002044 851
115 3300005614 Ga0068856_100006981 Ga0068856_1000069816 851
116 3300005616 Ga0068852_100006163 Ga0068852_1000061637 851
117 3300006237 Ga0097621_100000124 Ga0097621_10000012426 851
118 3300006358 Ga0068871_100000160 Ga0068871_10000016026 851
119 3300006881 Ga0068865_100001563 Ga0068865_1000015637 851
120 3300009098 Ga0105245_10058315 Ga0105245_100583152 851
121 3300009174 Ga0105241_10001215 Ga0105241_100012157 851
122 3300009545 Ga0105237_10002584 Ga0105237_1000258415 851
123 3300009545 Ga0105237_10015601 Ga0105237_100156015 851
124 3300009551 Ga0105238_10030659 Ga0105238_100306593 851
125 3300013102 Ga0157371_10025064 Ga0157371_100250642 851
126 3300013296 Ga0157374_10000746 Ga0157374_1000074618 851
127 3300013296 Ga0157374_10001502 Ga0157374_100015027 851
128 3300013306 Ga0163162_10000083 Ga0163162_100000837 851
129 3300025904 Ga0207647_10005268 Ga0207647_100052684 851
130 3300025907 Ga0207645_10001043 Ga0207645_100010437 851
131 3300025914 Ga0207671_10005846 Ga0207671_100058468 851
132 3300025919 Ga0207657_10049712 Ga0207657_100497122 851
133 3300025924 Ga0207694_10033150 Ga0207694_100331501 851
134 3300025933 Ga0207706_10000058 Ga0207706_100000587 851
135 3300025938 Ga0207704_10000135 Ga0207704_100001357 851
136 3300026041 Ga0207639_10003795 Ga0207639_100037956 851
137 3300026041 Ga0207639_10023757 Ga0207639_100237572 851
138 3300026078 Ga0207702_10017513 Ga0207702_100175132 851
139 3300026089 Ga0207648_10005143 Ga0207648_100051438 851
140 3300026142 Ga0207698_10005206 Ga0207698_100052066 851
141 3300028379 Ga0268266_10000018 Ga0268266_10000018129 851
142 3300028786 Ga0307517_10020409 Ga0307517_100204095 851
143 3300031727 Ga0316576_10006030 Ga0316576_100060303 851
144 3300033180 Ga0307510_10001317 Ga0307510_100013173 851
145 3300037312 Ga0395899_0001442 Ga0395899_0001442_5101_7695 851
146 3300037418 Ga0395900_0000517 Ga0395900_0000517_7833_10424 851
147 3300037418 Ga0395900_0001891 Ga0395900_0001891_163_2757 851
148 3300037466 Ga0395898_0008170 Ga0395898_0008170_2688_5282 851
149 3300037471 Ga0395905_0008935 Ga0395905_0008935_5101_7695 851
150 3300038443 Ga0395901_0001035 Ga0395901_0001035_22345_24939 851
151 3300039447 Ga0436361_0046678 Ga0436361_0046678_5283_7877 851
152 3300046518 Ga0495631_0007485 Ga0495631_0007485_1533_4127 851
153 3300047443 Ga0495687_000942 Ga0495687_000942_24428_27022 851
154 3300049578 Ga0501042_0034052 Ga0501042_0034052_879_3503 851
155 3300049588 Ga0501072_0008834 Ga0501072_0008834_1837_4461 851
156 3300049592 Ga0501076_0013423 Ga0501076_0013423_2187_4811 851
157 3300049741 Ga0501079_0005299 Ga0501079_0005299_5716_8340 851
158 3300053103 Ga0500555_000008 Ga0500555_000008_186045_188681 851
159 3300054114 Ga0501084_0008554 Ga0501084_0008554_2183_4807 851
160 3300060353 Ga0501082_0019166 Ga0501082_0019166_2067_4691 851
161 3300061734 Ga0530510_0013872 Ga0530510_0013872_196_2820 851
162 3300002737 JGI25162J39368_1000024 JGI25162J39368_100002460 852
163 3300005329 Ga0070683_100005599 Ga0070683_1000055993 852
164 3300005329 Ga0070683_100020924 Ga0070683_1000209243 852
165 3300005535 Ga0070684_100024882 Ga0070684_1000248823 852
166 3300005539 Ga0068853_100016874 Ga0068853_1000168743 852
167 3300005539 Ga0068853_100045928 Ga0068853_1000459282 852
168 3300005563 Ga0068855_100051595 Ga0068855_1000515952 852
169 3300005614 Ga0068856_100025995 Ga0068856_1000259954 852
170 3300005616 Ga0068852_100000401 Ga0068852_10000040114 852
171 3300009093 Ga0105240_10111460 Ga0105240_101114601 852
172 3300009174 Ga0105241_10000323 Ga0105241_100003233 852
173 3300009545 Ga0105237_10005656 Ga0105237_100056568 852
174 3300009551 Ga0105238_10000714 Ga0105238_1000071421 852
175 3300010375 Ga0105239_10000062 Ga0105239_1000006262 852
176 3300013307 Ga0157372_10082344 Ga0157372_100823442 852
177 3300025233 Ga0209437_100017 Ga0209437_10001761 852
178 3300025911 Ga0207654_10000217 Ga0207654_100002173 852
179 3300025913 Ga0207695_10001628 Ga0207695_100016282 852
180 3300025914 Ga0207671_10000951 Ga0207671_1000095122 852
181 3300025924 Ga0207694_10000201 Ga0207694_1000020122 852
182 3300025944 Ga0207661_10035690 Ga0207661_100356902 852
183 3300025949 Ga0207667_10007872 Ga0207667_100078722 852
184 3300025981 Ga0207640_10016744 Ga0207640_100167441 852
185 3300026041 Ga0207639_10000059 Ga0207639_1000005942 852
186 3300026078 Ga0207702_10002237 Ga0207702_100022372 852
187 3300026142 Ga0207698_10000202 Ga0207698_1000020225 852
188 3300028794 Ga0307515_10009167 Ga0307515_100091677 852
189 3300046507 Ga0495606_0018132 Ga0495606_0018132_2296_4893 852
190 3300047472 Ga0495686_0000264 Ga0495686_0000264_73562_76159 852
191 3300053157 Ga0500624_000418 Ga0500624_000418_6959_9556 852
192 3300003781 Ga0055536_1000004 Ga0055536_100000483 853
193 3300003791 Ga0055530_10001262 Ga0055530_1000126213 853
194 3300005937 Ga0081455_10000767 Ga0081455_1000076740 853
195 3300009177 Ga0105248_10049754 Ga0105248_100497542 853
196 3300013104 Ga0157370_10015449 Ga0157370_100154494 853
197 3300014325 Ga0163163_10065412 Ga0163163_100654122 853
198 3300014968 Ga0157379_10014452 Ga0157379_100144526 853
199 3300025292 Ga0209676_1000009 Ga0209676_1000009469 853
200 3300025298 Ga0209050_1000048 Ga0209050_1000048265 853
201 3300036401 Ga0373937_0000117 Ga0373937_0000117_45426_48035 853
202 3300046512 Ga0495610_0002626 Ga0495610_0002626_5314_7923 853
203 3300046512 Ga0495610_0003108 Ga0495610_0003108_5313_7922 853
204 3300046520 Ga0495637_0018362 Ga0495637_0018362_138_2747 853
205 3300048904 Ga0496101_0016026 Ga0496101_0016026_1688_4357 853
206 3300053125 Ga0500618_000002 Ga0500618_000002_312357_314957 853
207 3300005985 Ga0081539_10004447 Ga0081539_100044472 854
208 3300006178 Ga0075367_10002404 Ga0075367_100024044 854
209 3300006844 Ga0075428_100002510 Ga0075428_10000251017 854
210 3300006846 Ga0075430_100002055 Ga0075430_1000020553 854
211 3300006880 Ga0075429_100002113 Ga0075429_10000211313 854
212 3300009147 Ga0114129_10002822 Ga0114129_1000282216 854
213 3300013105 Ga0157369_10001633 Ga0157369_100016337 854
214 3300013296 Ga0157374_10027248 Ga0157374_100272482 854
215 3300021384 Ga0213876_10000716 Ga0213876_100007165 854
216 3300031249 Ga0265339_10001025 Ga0265339_100010253 854
217 3300035172 Ga0373955_0025808 Ga0373955_0025808_56_2665 854
218 3300039437 Ga0436365_0886091 Ga0436365_0886091_15179_17857 854
219 3300039450 Ga0436363_0573267 Ga0436363_0573267_1633_4311 854
220 3300050507 nmdc:mga05p37_3891_c1 nmdc:mga05p37_3891_c1_2935_5607 854
221 3300050508 nmdc:mga09592_534_c2 nmdc:mga09592_534_c2_2693_5365 854
222 3300050509 nmdc:mga0qj67_15_c3 nmdc:mga0qj67_15_c3_14776_17448 854
223 3300050510 nmdc:mga06r32_447_c1 nmdc:mga06r32_447_c1_10468_13140 854
224 3300005330 Ga0070690_100007338 Ga0070690_1000073383 855
225 3300005364 Ga0070673_100000903 Ga0070673_1000009037 855
226 3300005471 Ga0070698_100021884 Ga0070698_1000218845 855
227 3300005544 Ga0070686_100003156 Ga0070686_1000031563 855
228 3300007076 Ga0075435_100020123 Ga0075435_1000201231 855
229 3300009177 Ga0105248_10004221 Ga0105248_100042217 855
230 3300013100 Ga0157373_10004651 Ga0157373_100046514 855
231 3300025931 Ga0207644_10021060 Ga0207644_100210602 855
232 3300025941 Ga0207711_10010971 Ga0207711_100109712 855
233 3300026089 Ga0207648_10003356 Ga0207648_1000335610 855
234 3300033179 Ga0307507_10001092 Ga0307507_100010921 855
235 3300050512 nmdc:mga0n895_54365_c1 nmdc:mga0n895_54365_c1_102_2729 855
236 3300050513 nmdc:mga0rr50_42643_c1 nmdc:mga0rr50_42643_c1_465_3092 855
237 iso_pu_bacteria 2989392574 2989395000 855
238 3300005563 Ga0068855_100000404 Ga0068855_10000040440 856
239 3300014325 Ga0163163_10000022 Ga0163163_1000002249 856
240 3300025949 Ga0207667_10000474 Ga0207667_1000047411 856
241 3300028017 Ga0265356_1000878 Ga0265356_10008782 856
242 3300031730 Ga0307516_10006229 Ga0307516_100062294 856
243 3300049569 Ga0501032_0039727 Ga0501032_0039727_145_2763 856
244 3300049574 Ga0501038_0002658 Ga0501038_0002658_710_3352 856
245 3300049577 Ga0501041_0006893 Ga0501041_0006893_1352_3994 856
246 3300049578 Ga0501042_0003168 Ga0501042_0003168_1733_4375 856
247 3300049586 Ga0501070_0007263 Ga0501070_0007263_5122_7740 856
248 3300049588 Ga0501072_0000549 Ga0501072_0000549_14452_17094 856
249 3300049591 Ga0501075_0000014 Ga0501075_0000014_29971_32613 856
250 3300049592 Ga0501076_0000072 Ga0501076_0000072_39092_41734 856
251 3300049742 Ga0501080_0025090 Ga0501080_0025090_2223_4865 856
252 3300049744 Ga0501083_0029764 Ga0501083_0029764_1100_3742 856
253 3300054114 Ga0501084_0000930 Ga0501084_0000930_10539_13181 856
254 3300060353 Ga0501082_0004179 Ga0501082_0004179_7526_10168 856
255 3300061734 Ga0530510_0000153 Ga0530510_0000153_888_3530 856
256 3300005459 Ga0068867_100004091 Ga0068867_1000040916 857
257 3300005548 Ga0070665_100098526 Ga0070665_1000985262 857
258 3300009011 Ga0105251_10014719 Ga0105251_100147192 857
259 3300009147 Ga0114129_10025822 Ga0114129_100258227 857
260 3300009177 Ga0105248_10030054 Ga0105248_100300541 857
261 3300013297 Ga0157378_10000103 Ga0157378_1000010328 857
262 3300013297 Ga0157378_10001933 Ga0157378_1000193313 857
263 3300025728 Ga0207655_1000006 Ga0207655_1000006243 857
264 3300025914 Ga0207671_10000250 Ga0207671_1000025027 857
265 3300028563 Ga0265319_1001513 Ga0265319_10015135 857
266 3300028573 Ga0265334_10002734 Ga0265334_100027344 857
267 3300028577 Ga0265318_10009320 Ga0265318_100093201 857
268 3300028800 Ga0265338_10018515 Ga0265338_100185151 857
269 3300031238 Ga0265332_10005881 Ga0265332_100058812 857
270 3300031247 Ga0265340_10003855 Ga0265340_100038551 857
271 3300031595 Ga0265313_10020776 Ga0265313_100207761 857
272 3300031711 Ga0265314_10004880 Ga0265314_100048801 857
273 3300042876 Ga0451577_0033220 Ga0451577_0033220_477_3095 857
274 3300048905 Ga0496102_0004825 Ga0496102_0004825_3619_6342 857
275 3300048907 Ga0496104_0004026 Ga0496104_0004026_962_3643 857
276 3300048909 Ga0496106_0025262 Ga0496106_0025262_490_3171 857
277 3300049744 Ga0501083_0001033 Ga0501083_0001033_3147_5786 857
278 3300050507 nmdc:mga05p37_8551_c1 nmdc:mga05p37_8551_c1_5231_7867 857
279 3300053153 Ga0500616_0006347 Ga0500616_0006347_4424_7060 857
280 3300009545 Ga0105237_10000062 Ga0105237_1000006268 858
281 3300009545 Ga0105237_10024243 Ga0105237_100242432 858
282 3300021388 Ga0213875_10000008 Ga0213875_10000008225 858
283 3300025914 Ga0207671_10000140 Ga0207671_1000014032 858
284 3300028379 Ga0268266_10003557 Ga0268266_100035577 858
285 3300028800 Ga0265338_10031787 Ga0265338_100317872 858
286 3300031090 Ga0265760_10000709 Ga0265760_100007092 858
287 3300037853 Ga0436364_1415525 Ga0436364_1415525_164765_167401 858
288 3300039450 Ga0436363_0507032 Ga0436363_0507032_45_2687 858
289 3300049823 Ga0501044_0002405 Ga0501044_0002405_4858_7482 858
290 3300005466 Ga0070685_10005598 Ga0070685_100055984 859
291 3300005548 Ga0070665_100000875 Ga0070665_10000087515 859
292 3300005618 Ga0068864_100013029 Ga0068864_1000130295 859
293 3300025916 Ga0207663_10020792 Ga0207663_100207921 859
294 3300028379 Ga0268266_10001104 Ga0268266_1000110413 859
295 3300035090 Ga0373949_0000055 Ga0373949_0000055_4359_7013 859
296 3300037312 Ga0395899_0000001 Ga0395899_0000001_1407979_1410603 859
297 3300048907 Ga0496104_0002107 Ga0496104_0002107_12360_14987 859
298 3300048918 Ga0496115_0011538 Ga0496115_0011538_1642_4269 859
299 3300049581 Ga0501047_0013859 Ga0501047_0013859_62_2707 859
300 3300061734 Ga0530510_0007034 Ga0530510_0007034_4512_7169 859
301 3300005327 Ga0070658_10005434 Ga0070658_100054346 860
302 3300005518 Ga0070699_100000127 Ga0070699_10000012766 860
303 3300005518 Ga0070699_100063898 Ga0070699_1000638982 860
304 3300005564 Ga0070664_100000421 Ga0070664_1000004216 860
305 3300005937 Ga0081455_10008430 Ga0081455_100084305 860
306 3300006914 Ga0075436_100005582 Ga0075436_1000055825 860
307 3300009093 Ga0105240_10000029 Ga0105240_10000029112 860
308 3300009551 Ga0105238_10033754 Ga0105238_100337542 860
309 3300010375 Ga0105239_10009207 Ga0105239_100092078 860
310 3300021388 Ga0213875_10004666 Ga0213875_100046662 860
311 3300025913 Ga0207695_10000034 Ga0207695_10000034181 860
312 3300035083 Ga0373926_0000044 Ga0373926_0000044_13362_16097 860
313 3300035695 Ga0373927_0000357 Ga0373927_0000357_6090_8825 860
314 3300035725 Ga0373947_0005503 Ga0373947_0005503_24_2759 860
315 3300036401 Ga0373937_0036587 Ga0373937_0036587_577_3228 860
316 3300037068 Ga0373925_0000225 Ga0373925_0000225_6494_9229 860
317 3300037853 Ga0436364_1259742 Ga0436364_1259742_4429_7065 860
318 3300037853 Ga0436364_1310913 Ga0436364_1310913_2061_4697 860
319 3300039447 Ga0436361_0738714 Ga0436361_0738714_31787_34459 860
320 3300045051 Ga0451576_0005819 Ga0451576_0005819_1654_4350 860
321 3300046517 Ga0495630_0000583 Ga0495630_0000583_23744_26479 860
322 3300050514 nmdc:mga08x19_2334_c1 nmdc:mga08x19_2334_c1_3825_6560 860
323 iso_pu_bacteria 2842333319 2842336997 860
324 3300006852 Ga0075433_10000186 Ga0075433_1000018624 861
325 3300009545 Ga0105237_10000219 Ga0105237_1000021927 861
326 3300021377 Ga0213874_10001399 Ga0213874_100013992 861
327 3300039438 Ga0436360_0213572 Ga0436360_0213572_3570_6215 861
328 3300039450 Ga0436363_1495906 Ga0436363_1495906_428_3106 861
329 3300039453 Ga0436362_0688989 Ga0436362_0688989_966_3644 861
330 3300048918 Ga0496115_0022588 Ga0496115_0022588_1098_3842 861
331 3300050493 nmdc:mga0k408_9140_c1 nmdc:mga0k408_9140_c1_428_3085 861
332 3300005331 Ga0070670_100026904 Ga0070670_1000269042 862
333 3300005539 Ga0068853_100005891 Ga0068853_1000058915 862
334 3300009093 Ga0105240_10001462 Ga0105240_1000146234 862
335 3300013297 Ga0157378_10012886 Ga0157378_100128862 862
336 3300021388 Ga0213875_10000575 Ga0213875_100005756 862
337 3300021388 Ga0213875_10016306 Ga0213875_100163062 862
338 3300025911 Ga0207654_10019976 Ga0207654_100199762 862
339 3300025913 Ga0207695_10013733 Ga0207695_100137337 862
340 3300026041 Ga0207639_10007316 Ga0207639_100073165 862
341 3300031344 Ga0265316_10049735 Ga0265316_100497352 862
342 3300031595 Ga0265313_10013040 Ga0265313_100130402 862
343 3300037853 Ga0436364_0719353 Ga0436364_0719353_687_3335 862
344 3300037853 Ga0436364_0909399 Ga0436364_0909399_1241_3889 862
345 3300037853 Ga0436364_1008502 Ga0436364_1008502_42460_45102 862
346 3300037853 Ga0436364_1393295 Ga0436364_1393295_1244_3892 862
347 3300049581 Ga0501047_0017503 Ga0501047_0017503_1285_3975 862
348 3300005456 Ga0070678_100003462 Ga0070678_1000034625 863
349 3300021377 Ga0213874_10000160 Ga0213874_100001604 863
350 3300039450 Ga0436363_0172570 Ga0436363_0172570_5767_8454 863
351 3300044712 Ga0453684_0000841 Ga0453684_0000841_73546_76194 863
352 3300060353 Ga0501082_0039599 Ga0501082_0039599_89_2782 863
353 iso_pu_bacteria 2895427314 2895430460 863
354 3300005331 Ga0070670_100010551 Ga0070670_1000105513 864
355 3300014325 Ga0163163_10022617 Ga0163163_100226172 864
356 3300025909 Ga0207705_10008618 Ga0207705_100086184 864
357 3300025925 Ga0207650_10022164 Ga0207650_100221641 864
358 3300031238 Ga0265332_10000169 Ga0265332_1000016914 864
359 3300031239 Ga0265328_10007617 Ga0265328_100076172 864
360 3300031250 Ga0265331_10000117 Ga0265331_1000011750 864
361 3300031344 Ga0265316_10000031 Ga0265316_10000031104 864
362 3300031711 Ga0265314_10000183 Ga0265314_1000018316 864
363 3300031712 Ga0265342_10000869 Ga0265342_100008699 864
364 3300050507 nmdc:mga05p37_99468_c1 nmdc:mga05p37_99468_c1_903_3560 864
365 3300005518 Ga0070699_100023859 Ga0070699_1000238592 865
366 3300005617 Ga0068859_100024372 Ga0068859_1000243724 865
367 3300005937 Ga0081455_10007638 Ga0081455_1000763811 865
368 3300006931 Ga0097620_100024372 Ga0097620_1000243724 865
369 3300031616 Ga0307508_10003774 Ga0307508_1000377412 865
370 3300042876 Ga0451577_0000583 Ga0451577_0000583_30516_33275 865
371 3300044712 Ga0453684_0075714 Ga0453684_0075714_1406_4165 865
372 3300005328 Ga0070676_10018176 Ga0070676_100181762 867
373 3300005331 Ga0070670_100014933 Ga0070670_1000149334 867
374 3300005335 Ga0070666_10000854 Ga0070666_100008548 867
375 3300005338 Ga0068868_100029360 Ga0068868_1000293602 867
376 3300005355 Ga0070671_100005720 Ga0070671_1000057203 867
377 3300005356 Ga0070674_100000862 Ga0070674_1000008628 867
378 3300005364 Ga0070673_100000282 Ga0070673_10000028213 867
379 3300005456 Ga0070678_100010911 Ga0070678_1000109112 867
380 3300005543 Ga0070672_100000046 Ga0070672_10000004652 867
381 3300009094 Ga0111539_10000059 Ga0111539_1000005957 867
382 3300013308 Ga0157375_10002741 Ga0157375_1000274114 867
383 3300014969 Ga0157376_10004159 Ga0157376_100041597 867
384 3300025907 Ga0207645_10005809 Ga0207645_100058094 867
385 3300025933 Ga0207706_10008173 Ga0207706_100081735 867
386 3300025940 Ga0207691_10000274 Ga0207691_1000027446 867
387 3300025960 Ga0207651_10000435 Ga0207651_1000043512 867
388 3300027907 Ga0207428_10001158 Ga0207428_100011584 867
389 3300049823 Ga0501044_0000235 Ga0501044_0000235_46863_49652 867
390 3300050494 nmdc:mga06z11_7621_c1 nmdc:mga06z11_7621_c1_440_3133 867
391 3300005471 Ga0070698_100001047 Ga0070698_1000010477 868
392 3300049591 Ga0501075_0026732 Ga0501075_0026732_180_2951 868
393 3300005719 Ga0068861_100000695 Ga0068861_1000006958 869
394 3300026067 Ga0207678_10003949 Ga0207678_100039498 869
395 3300026118 Ga0207675_100002914 Ga0207675_1000029148 869
396 3300049743 Ga0501081_0026494 Ga0501081_0026494_1192_3864 869
397 iso_pu_bacteria 3003665799 3003671422 870
398 3300005353 Ga0070669_100012476 Ga0070669_1000124762 871
399 3300044712 Ga0453684_0002278 Ga0453684_0002278_42106_44823 871
400 iso_pu_bacteria 2911138879 2911140936 871
401 3300005544 Ga0070686_100003394 Ga0070686_1000033949 872
402 3300006871 Ga0075434_100000802 Ga0075434_10000080220 872
403 3300006871 Ga0075434_100009429 Ga0075434_1000094293 872
404 3300006914 Ga0075436_100000550 Ga0075436_1000005508 872
405 3300009147 Ga0114129_10023218 Ga0114129_100232183 872
406 3300025949 Ga0207667_10016629 Ga0207667_100166294 872
407 3300037418 Ga0395900_0078499 Ga0395900_0078499_221_2902 872
408 3300050512 nmdc:mga0n895_11451_c1 nmdc:mga0n895_11451_c1_4084_6762 872
409 3300050512 nmdc:mga0n895_783_c1 nmdc:mga0n895_783_c1_1356_4037 872
410 3300050513 nmdc:mga0rr50_320_c1 nmdc:mga0rr50_320_c1_18602_21283 872
411 3300050514 nmdc:mga08x19_516_c1 nmdc:mga08x19_516_c1_4487_7168 872
412 3300005535 Ga0070684_100023895 Ga0070684_1000238952 873
413 3300005614 Ga0068856_100021007 Ga0068856_1000210073 873
414 3300006871 Ga0075434_100050482 Ga0075434_1000504822 873
415 3300009093 Ga0105240_10027916 Ga0105240_100279165 873
416 3300009147 Ga0114129_10005228 Ga0114129_1000522813 873
417 3300013306 Ga0163162_10067945 Ga0163162_100679452 873
418 3300025910 Ga0207684_10042077 Ga0207684_100420773 873
419 3300031665 Ga0316575_10002167 Ga0316575_100021676 873
420 3300031727 Ga0316576_10043509 Ga0316576_100435091 873
421 3300031728 Ga0316578_10007781 Ga0316578_100077813 873
422 3300031995 Ga0307409_100027562 Ga0307409_1000275621 873
423 3300032002 Ga0307416_100021502 Ga0307416_1000215022 873
424 3300032137 Ga0316585_10006113 Ga0316585_100061133 873
425 3300035398 Ga0316574_0000052 Ga0316574_0000052_12991_15690 873
426 3300036647 Ga0316582_0000166 Ga0316582_0000166_3462_6161 873
427 3300036712 Ga0316584_0007826 Ga0316584_0007826_4097_6796 873
428 3300037471 Ga0395905_0015572 Ga0395905_0015572_4388_7075 873
429 3300037588 Ga0316581_0004132 Ga0316581_0004132_719_3418 873
430 3300050507 nmdc:mga05p37_27947_c1 nmdc:mga05p37_27947_c1_679_3363 873
431 3300005330 Ga0070690_100000702 Ga0070690_1000007026 874
432 3300005544 Ga0070686_100001060 Ga0070686_1000010605 874
433 3300005981 Ga0081538_10001734 Ga0081538_100017348 874
434 3300006237 Ga0097621_100017727 Ga0097621_1000177274 874
435 3300006852 Ga0075433_10002084 Ga0075433_100020845 874
436 3300007076 Ga0075435_100004510 Ga0075435_1000045105 874
437 3300009147 Ga0114129_10038787 Ga0114129_100387873 874
438 3300036401 Ga0373937_0067782 Ga0373937_0067782_371_3058 874
439 3300050507 nmdc:mga05p37_29951_c1 nmdc:mga05p37_29951_c1_1582_4311 874
440 3300050508 nmdc:mga09592_6474_c1 nmdc:mga09592_6474_c1_5041_7770 874
441 3300050513 nmdc:mga0rr50_6553_c1 nmdc:mga0rr50_6553_c1_1612_4299 874
442 iso_pu_bacteria 2522125168 2522550013 874
443 3300006846 Ga0075430_100038235 Ga0075430_1000382352 875
444 3300006880 Ga0075429_100056605 Ga0075429_1000566051 875
445 3300009094 Ga0111539_10022794 Ga0111539_100227945 875
446 3300014326 Ga0157380_10001679 Ga0157380_1000167910 875
447 3300027907 Ga0207428_10012489 Ga0207428_100124895 875
448 3300048915 Ga0496112_0096597 Ga0496112_0096597_99_2786 875
449 3300005366 Ga0070659_100013242 Ga0070659_1000132423 876
450 3300005458 Ga0070681_10017958 Ga0070681_100179585 876
451 3300005467 Ga0070706_100015645 Ga0070706_1000156458 876
452 3300005468 Ga0070707_100012674 Ga0070707_1000126745 876
453 3300005530 Ga0070679_100015481 Ga0070679_1000154814 876
454 3300005834 Ga0068851_10008019 Ga0068851_100080192 876
455 3300006871 Ga0075434_100005613 Ga0075434_1000056134 876
456 3300013105 Ga0157369_10045208 Ga0157369_100452082 876
457 3300025945 Ga0207679_10006255 Ga0207679_100062552 876
458 3300026116 Ga0207674_10000413 Ga0207674_1000041334 876
459 3300035083 Ga0373926_0000012 Ga0373926_0000012_13721_16414 876
460 3300035170 Ga0373943_0000147 Ga0373943_0000147_20974_23667 876
461 3300035695 Ga0373927_0000302 Ga0373927_0000302_22567_25260 876
462 3300035725 Ga0373947_0000283 Ga0373947_0000283_12180_14873 876
463 3300037068 Ga0373925_0001747 Ga0373925_0001747_5857_8550 876
464 3300005353 Ga0070669_100019301 Ga0070669_1000193012 877
465 3300005367 Ga0070667_100012467 Ga0070667_1000124672 877
466 3300005444 Ga0070694_100002857 Ga0070694_1000028576 877
467 3300005530 Ga0070679_100024392 Ga0070679_1000243923 877
468 3300005549 Ga0070704_100010558 Ga0070704_1000105582 877
469 3300009177 Ga0105248_10012046 Ga0105248_100120463 877
470 3300025918 Ga0207662_10009849 Ga0207662_100098493 877
471 3300025921 Ga0207652_10011392 Ga0207652_100113923 877
472 3300025931 Ga0207644_10007547 Ga0207644_100075473 877
473 3300025941 Ga0207711_10013816 Ga0207711_100138165 877
474 3300025960 Ga0207651_10004269 Ga0207651_100042692 877
475 3300025986 Ga0207658_10008617 Ga0207658_100086172 877
476 3300026075 Ga0207708_10006550 Ga0207708_100065505 877
477 3300026088 Ga0207641_10028103 Ga0207641_100281033 877
478 3300026089 Ga0207648_10006458 Ga0207648_100064588 877
479 3300028381 Ga0268264_10023900 Ga0268264_100239002 877
480 3300046472 Ga0495580_0026941 Ga0495580_0026941_294_3032 877
481 3300046492 Ga0495585_0013845 Ga0495585_0013845_599_3337 877
482 3300046499 Ga0495594_0002318 Ga0495594_0002318_3163_5901 877
483 3300046523 Ga0495644_0000055 Ga0495644_0000055_36005_38743 877
484 3300046538 Ga0495609_0012695 Ga0495609_0012695_592_3330 877
485 3300048914 Ga0496111_0005566 Ga0496111_0005566_2691_5426 877
486 3300050513 nmdc:mga0rr50_3738_c1 nmdc:mga0rr50_3738_c1_1228_3960 877
487 iso_pu_bacteria 2597490356 2599103852 877
488 iso_pu_bacteria 2846952575 2846957540 877
489 3300005262 Ga0065165_1000037 Ga0065165_1000037135 878
490 3300005985 Ga0081539_10010566 Ga0081539_100105666 878
491 3300013102 Ga0157371_10019548 Ga0157371_100195483 878
492 3300013307 Ga0157372_10028804 Ga0157372_100288045 878
493 3300025292 Ga0209676_1001142 Ga0209676_10011428 878
494 3300048907 Ga0496104_0009366 Ga0496104_0009366_4469_7453 878
495 3300048914 Ga0496111_0002881 Ga0496111_0002881_7785_10484 878
496 3300006844 Ga0075428_100019879 Ga0075428_1000198792 879
497 3300006846 Ga0075430_100006605 Ga0075430_1000066057 879
498 3300009094 Ga0111539_10022882 Ga0111539_100228826 879
499 3300021361 Ga0213872_10010134 Ga0213872_100101341 879
500 3300031548 Ga0307408_100004766 Ga0307408_1000047663 879
501 3300039447 Ga0436361_1164749 Ga0436361_1164749_9719_12460 879
502 3300049571 Ga0501034_0007570 Ga0501034_0007570_3994_6687 879
503 3300050508 nmdc:mga09592_868_c1 nmdc:mga09592_868_c1_3224_6217 879
504 3300050509 nmdc:mga0qj67_1220_c1 nmdc:mga0qj67_1220_c1_5493_8486 879
505 3300050510 nmdc:mga06r32_2168_c1 nmdc:mga06r32_2168_c1_4089_7082 879
506 3300005331 Ga0070670_100009602 Ga0070670_1000096026 880
507 3300005347 Ga0070668_100052062 Ga0070668_1000520621 880
508 3300005364 Ga0070673_100014179 Ga0070673_1000141792 880
509 3300005435 Ga0070714_100000274 Ga0070714_10000027435 880
510 3300005436 Ga0070713_100000293 Ga0070713_1000002936 880
511 3300005436 Ga0070713_100019246 Ga0070713_1000192463 880
512 3300005535 Ga0070684_100054813 Ga0070684_1000548132 880
513 3300005543 Ga0070672_100026834 Ga0070672_1000268342 880
514 3300005614 Ga0068856_100060389 Ga0068856_1000603892 880
515 3300005841 Ga0068863_100009166 Ga0068863_1000091663 880
516 3300005842 Ga0068858_100014974 Ga0068858_1000149743 880
517 3300005843 Ga0068860_100069025 Ga0068860_1000690251 880
518 3300006178 Ga0075367_10000361 Ga0075367_1000036110 880
519 3300006195 Ga0075366_10001384 Ga0075366_1000138410 880
520 3300006237 Ga0097621_100005963 Ga0097621_1000059634 880
521 3300006237 Ga0097621_100023180 Ga0097621_1000231802 880
522 3300006358 Ga0068871_100006247 Ga0068871_1000062476 880
523 3300006844 Ga0075428_100017570 Ga0075428_1000175706 880
524 3300006846 Ga0075430_100031761 Ga0075430_1000317612 880
525 3300006871 Ga0075434_100029103 Ga0075434_1000291032 880
526 3300006880 Ga0075429_100003581 Ga0075429_10000358110 880
527 3300006881 Ga0068865_100012442 Ga0068865_1000124424 880
528 3300009094 Ga0111539_10000298 Ga0111539_1000029841 880
529 3300009094 Ga0111539_10000763 Ga0111539_1000076311 880
530 3300009098 Ga0105245_10004148 Ga0105245_100041482 880
531 3300009147 Ga0114129_10043075 Ga0114129_100430756 880
532 3300013105 Ga0157369_10025494 Ga0157369_100254943 880
533 3300013296 Ga0157374_10041996 Ga0157374_100419963 880
534 3300013297 Ga0157378_10012406 Ga0157378_100124063 880
535 3300013297 Ga0157378_10014126 Ga0157378_100141263 880
536 3300013307 Ga0157372_10002437 Ga0157372_100024376 880
537 3300025915 Ga0207693_10003151 Ga0207693_1000315111 880
538 3300025925 Ga0207650_10006006 Ga0207650_100060063 880
539 3300025928 Ga0207700_10009430 Ga0207700_100094304 880
540 3300025931 Ga0207644_10035215 Ga0207644_100352151 880
541 3300025933 Ga0207706_10000968 Ga0207706_100009688 880
542 3300025942 Ga0207689_10007207 Ga0207689_100072076 880
543 3300025949 Ga0207667_10034268 Ga0207667_100342682 880
544 3300026035 Ga0207703_10036818 Ga0207703_100368182 880
545 3300026121 Ga0207683_10000078 Ga0207683_100000785 880
546 3300027907 Ga0207428_10000066 Ga0207428_10000066131 880
547 3300027907 Ga0207428_10002348 Ga0207428_1000234811 880
548 3300028380 Ga0268265_10007215 Ga0268265_100072153 880
549 3300035083 Ga0373926_0000807 Ga0373926_0000807_132_2837 880
550 3300035170 Ga0373943_0000950 Ga0373943_0000950_9431_12136 880
551 3300035695 Ga0373927_0002350 Ga0373927_0002350_10588_13293 880
552 3300036401 Ga0373937_0017949 Ga0373937_0017949_3246_5978 880
553 3300046472 Ga0495580_0003375 Ga0495580_0003375_4811_7549 880
554 3300046473 Ga0495582_0004962 Ga0495582_0004962_364_3093 880
555 3300048088 Ga0495602_0007513 Ga0495602_0007513_476_3208 880
556 3300048913 Ga0496110_0065775 Ga0496110_0065775_161_2878 880
557 3300048915 Ga0496112_0049285 Ga0496112_0049285_96_2801 880
558 3300048916 Ga0496113_0001502 Ga0496113_0001502_8462_11167 880
559 3300050491 nmdc:mga00v17_2275_c1 nmdc:mga00v17_2275_c1_346_3084 880
560 3300050493 nmdc:mga0k408_1402_c1 nmdc:mga0k408_1402_c1_6751_9489 880
561 3300050494 nmdc:mga06z11_739_c1 nmdc:mga06z11_739_c1_5724_8462 880
562 3300050507 nmdc:mga05p37_19278_c1 nmdc:mga05p37_19278_c1_579_3287 880
563 3300050507 nmdc:mga05p37_2963_c1 nmdc:mga05p37_2963_c1_14257_16989 880
564 3300050508 nmdc:mga09592_37019_c1 nmdc:mga09592_37019_c1_1016_3748 880
565 3300050508 nmdc:mga09592_6313_c1 nmdc:mga09592_6313_c1_3014_5722 880
566 3300050509 nmdc:mga0qj67_21054_c1 nmdc:mga0qj67_21054_c1_326_3034 880
567 3300050509 nmdc:mga0qj67_531_c1 nmdc:mga0qj67_531_c1_15249_17981 880
568 3300050511 nmdc:mga08y16_150_c1 nmdc:mga08y16_150_c1_34225_36960 880
569 3300050511 nmdc:mga08y16_340_c1 nmdc:mga08y16_340_c1_782_3520 880
570 3300050511 nmdc:mga08y16_4051_c1 nmdc:mga08y16_4051_c1_12057_14765 880
571 3300050515 nmdc:mga0a205_73076_c1 nmdc:mga0a205_73076_c1_319_3069 880
572 3300005354 Ga0070675_100001610 Ga0070675_1000016105 881
573 3300005459 Ga0068867_100001826 Ga0068867_1000018268 881
574 3300005467 Ga0070706_100049068 Ga0070706_1000490682 881
575 3300005543 Ga0070672_100001000 Ga0070672_1000010009 881
576 3300005718 Ga0068866_10015501 Ga0068866_100155012 881
577 3300006028 Ga0070717_10013887 Ga0070717_100138872 881
578 3300009094 Ga0111539_10001199 Ga0111539_100011994 881
579 3300009147 Ga0114129_10114403 Ga0114129_101144031 881
580 3300009148 Ga0105243_10027406 Ga0105243_100274063 881
581 3300025899 Ga0207642_10004342 Ga0207642_100043421 881
582 3300025910 Ga0207684_10048083 Ga0207684_100480832 881
583 3300025935 Ga0207709_10025704 Ga0207709_100257042 881
584 3300025942 Ga0207689_10000460 Ga0207689_1000046030 881
585 3300026089 Ga0207648_10000275 Ga0207648_1000027520 881
586 3300027907 Ga0207428_10000253 Ga0207428_1000025333 881
587 3300035692 Ga0373935_0003782 Ga0373935_0003782_876_3584 881
588 3300050511 nmdc:mga08y16_252_c1 nmdc:mga08y16_252_c1_39206_41923 881
589 3300005338 Ga0068868_100026670 Ga0068868_1000266702 882
590 3300005983 Ga0081540_1003073 Ga0081540_10030733 882
591 3300006028 Ga0070717_10001566 Ga0070717_100015666 882
592 3300006237 Ga0097621_100002950 Ga0097621_10000295010 882
593 3300006358 Ga0068871_100002195 Ga0068871_1000021956 882
594 3300009093 Ga0105240_10013815 Ga0105240_100138154 882
595 3300009098 Ga0105245_10003376 Ga0105245_1000337611 882
596 3300013297 Ga0157378_10002021 Ga0157378_1000202114 882
597 3300025927 Ga0207687_10020397 Ga0207687_100203972 882
598 3300026023 Ga0207677_10011615 Ga0207677_100116152 882
599 3300031240 Ga0265320_10016372 Ga0265320_100163721 882
600 3300031595 Ga0265313_10002676 Ga0265313_100026762 882
601 3300005334 Ga0068869_100003675 Ga0068869_1000036756 883
602 3300005518 Ga0070699_100025408 Ga0070699_1000254082 883
603 3300025908 Ga0207643_10004136 Ga0207643_100041363 883
604 3300025910 Ga0207684_10013251 Ga0207684_100132515 883
605 3300025922 Ga0207646_10014010 Ga0207646_100140105 883
606 3300045051 Ga0451576_0000191 Ga0451576_0000191_28837_31716 883
607 3300050509 nmdc:mga0qj67_20011_c1 nmdc:mga0qj67_20011_c1_80_2824 883
608 3300005330 Ga0070690_100011943 Ga0070690_1000119434 884
609 3300005340 Ga0070689_100009825 Ga0070689_1000098254 884
610 3300005354 Ga0070675_100005707 Ga0070675_1000057074 884
611 3300006844 Ga0075428_100034759 Ga0075428_1000347592 884
612 3300006871 Ga0075434_100004024 Ga0075434_1000040243 884
613 3300025926 Ga0207659_10025073 Ga0207659_100250733 884
614 3300005330 Ga0070690_100016864 Ga0070690_1000168642 886
615 3300005983 Ga0081540_1008337 Ga0081540_10083375 886
616 3300017792 Ga0163161_10013161 Ga0163161_100131614 886
617 3300025315 Ga0207697_10001618 Ga0207697_100016182 886
618 3300025926 Ga0207659_10015019 Ga0207659_100150193 886
619 3300026075 Ga0207708_10035161 Ga0207708_100351612 886
620 3300046516 Ga0495628_0025165 Ga0495628_0025165_1216_3939 886
621 3300049572 Ga0501036_0000593 Ga0501036_0000593_18533_21520 886
622 3300049578 Ga0501042_0005677 Ga0501042_0005677_230_3217 886
623 3300049591 Ga0501075_0000136 Ga0501075_0000136_30266_33253 886
624 3300049592 Ga0501076_0000016 Ga0501076_0000016_10856_13843 886
625 3300049741 Ga0501079_0001520 Ga0501079_0001520_4809_7796 886
626 3300049742 Ga0501080_0020084 Ga0501080_0020084_357_3344 886
627 3300054114 Ga0501084_0023579 Ga0501084_0023579_1447_4434 886
628 3300061734 Ga0530510_0000214 Ga0530510_0000214_26932_29919 886
629 3300005937 Ga0081455_10004662 Ga0081455_100046629 887
630 3300005983 Ga0081540_1006684 Ga0081540_10066847 887
631 3300014326 Ga0157380_10020389 Ga0157380_100203893 887
632 3300037068 Ga0373925_0012787 Ga0373925_0012787_969_3770 887
633 3300046517 Ga0495630_0028069 Ga0495630_0028069_838_3639 887
634 3300009094 Ga0111539_10004669 Ga0111539_100046696 888
635 3300025924 Ga0207694_10009343 Ga0207694_100093434 888
636 3300027907 Ga0207428_10000753 Ga0207428_1000075321 888
637 3300050511 nmdc:mga08y16_3079_c1 nmdc:mga08y16_3079_c1_1301_4291 888
638 3300025933 Ga0207706_10017962 Ga0207706_100179622 889
639 3300042876 Ga0451577_0003269 Ga0451577_0003269_14026_16791 889
640 3300044712 Ga0453684_0009932 Ga0453684_0009932_5456_8221 889
641 3300046517 Ga0495630_0002677 Ga0495630_0002677_8681_11422 889
642 3300047471 Ga0495684_0001768 Ga0495684_0001768_3202_5943 889
643 3300049742 Ga0501080_0006644 Ga0501080_0006644_299_3055 889
644 3300005339 Ga0070660_100013779 Ga0070660_1000137792 890
645 3300005344 Ga0070661_100009103 Ga0070661_1000091032 890
646 3300005353 Ga0070669_100016039 Ga0070669_1000160392 890
647 3300005458 Ga0070681_10002224 Ga0070681_100022247 890
648 3300005467 Ga0070706_100004648 Ga0070706_1000046489 890
649 3300005539 Ga0068853_100005775 Ga0068853_1000057752 890
650 3300005564 Ga0070664_100005325 Ga0070664_1000053254 890
651 3300006852 Ga0075433_10029559 Ga0075433_100295592 890
652 3300013100 Ga0157373_10025398 Ga0157373_100253981 890
653 3300013104 Ga0157370_10030331 Ga0157370_100303312 890
654 3300013105 Ga0157369_10071901 Ga0157369_100719012 890
655 3300013307 Ga0157372_10003802 Ga0157372_100038026 890
656 3300025893 Ga0207682_10000683 Ga0207682_100006833 890
657 3300025907 Ga0207645_10001053 Ga0207645_100010535 890
658 3300025919 Ga0207657_10011844 Ga0207657_100118442 890
659 3300025949 Ga0207667_10066274 Ga0207667_100662742 890
660 3300026116 Ga0207674_10023660 Ga0207674_100236602 890
661 3300050515 nmdc:mga0a205_8671_c1 nmdc:mga0a205_8671_c1_5650_8637 890
662 3300049570 Ga0501033_0025418 Ga0501033_0025418_235_3003 891
663 3300049823 Ga0501044_0022588 Ga0501044_0022588_1712_4480 891
664 3300007076 Ga0075435_100035510 Ga0075435_1000355102 892
665 3300005617 Ga0068859_100009684 Ga0068859_1000096842 893
666 3300006931 Ga0097620_100009683 Ga0097620_1000096832 893
667 3300017792 Ga0163161_10003396 Ga0163161_100033964 893
668 3300025941 Ga0207711_10004963 Ga0207711_100049632 893
669 3300026088 Ga0207641_10009835 Ga0207641_100098352 893
670 3300026095 Ga0207676_10014130 Ga0207676_100141302 893
671 3300045051 Ga0451576_0003755 Ga0451576_0003755_8596_11394 893
672 3300009545 Ga0105237_10021799 Ga0105237_100217994 894
673 3300010375 Ga0105239_10001911 Ga0105239_1000191115 894
674 3300025914 Ga0207671_10013546 Ga0207671_100135464 894
675 3300005335 Ga0070666_10001111 Ga0070666_100011113 895
676 3300005466 Ga0070685_10008680 Ga0070685_100086802 895
677 3300005843 Ga0068860_100002752 Ga0068860_10000275211 895
678 3300009176 Ga0105242_10019792 Ga0105242_100197922 895
679 3300013306 Ga0163162_10013909 Ga0163162_100139092 895
680 3300028381 Ga0268264_10033961 Ga0268264_100339612 895
681 3300009093 Ga0105240_10089131 Ga0105240_100891311 904
682 3300013105 Ga0157369_10046209 Ga0157369_100462092 904
683 2162886007 SwRhRL2b_contig_1480143 SwRhRL2b_0400.00005730 1054
684 3300005289 Ga0065704_10070145 Ga0065704_10070145142 1054
685 3300005295 Ga0065707_10082117 Ga0065707_1008211720 1054

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22422

MGH1-like_GH

Mannosylglycerate hydrolase MGH1-like glycoside hydrolase domain

435

545

0.92

PF22422

MGH1-like_GH

Mannosylglycerate hydrolase MGH1-like glycoside hydrolase domain

681

888

0.79

PF03200

Glyco_hydro_63

Glycosyl hydrolase family 63 C-terminal domain

711

815

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ekn-assembly2.cif.gz_B co-crystal structure of chaetomium glucosidase with compound 15 0.6583 9 896
8ehp-assembly2.cif.gz_B co-crystal structure of chaetomium glucosidase with compound 13 0.6546 9 896
8egv-assembly1.cif.gz_A co-crystal structure of chaetomium glucosidase with compound 12 0.6545 9 896
8ekn-assembly2.cif.gz_B co-crystal structure of chaetomium glucosidase with compound 15 0.6511 9 896
8egv-assembly1.cif.gz_A co-crystal structure of chaetomium glucosidase with compound 12 0.649 9 896
ID Description Score Start End Superfamily
af_Q5AED0_9_368_2.70.98.40 Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5;Glycoside hydrolase, family 65, N-terminal domain 0.9898 9 369 2.70.98.40
af_Q5AED0_9_368_2.70.98.40 Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5;Glycoside hydrolase, family 65, N-terminal domain 0.9844 9 369 2.70.98.40
af_Q5AED0_433_891_1.50.10.10 Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase; 0.969 434 894 1.50.10.10
af_Q5AED0_433_891_1.50.10.10 Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase; 0.9669 434 894 1.50.10.10
af_Q04336_455_722_1.50.10.10 Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase; 0.9338 415 678 1.50.10.10
ID Description Score Start End GO Terms
AF-G1K036-F1-model_v4 Glycoside hydrolase family 63 protein 0.9933 385 504 GO:0004573
GO:0009311
AF-A0A0U5FN31-F1-model_v4 Mannosyl-oligosaccharide glucosidase (EC 3.2.1.106) (Glucosidase I) 0.991 6 524 GO:0004573
GO:0005789
GO:0006487
GO:0009311
AF-A0A7C1VH85-F1-model_v4 Glucosidase 0.9879 714 897 GO:0004573
GO:0009311
AF-C5M322-F1-model_v4 Mannosyl-oligosaccharide glucosidase (EC 3.2.1.106) (Glucosidase I) 0.9861 8 540 GO:0004573
GO:0005789
GO:0006487
GO:0009311
AF-A0A354BKL4-F1-model_v4 Glucosidase 0.9861 714 899 GO:0004573
GO:0009311

Feature Viewer

pLDDT pTM Quality
80.82 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map