F475067
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 684 | 356 | 649 | 233 |
Family's Representative Sequence
| Representative Sequence | 3300037418|Ga0395900_0285532|Ga0395900_0285532_401_1246 |
| Length | 281 |
| Sequence | VKRIGTLRRGILALVARRSIAAGSVLDRSAAPTHFPSAGGIAGHQPMIDLYYWPTPNGHKITMFLEEAGLPYRIHPVNIGKGEQFNPDFLKIAPNNRMPAIVDDEPTGGGAPVSLFESGAILLYLAEKTGRFIPADLRGRAEVLQWLFWQMGGLGPMLGQNHHFSQYAPEKIDYAIKRYVNETNRLYGVLDRRLADRAFVAGPDYSIADMACYPWIVPWEKQGQNLDHHPNLKRWFTAIAERPATKAAYARAPEVNPDHGKTMSEEAKKVMFGQTANSTKR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231221 | Azospirillum lipoferum 4B | Isolate | Rhizosphere |
| 2 | 2513237087 | Azorhizobium doebereinerae UFLA1-100 | Isolate | Nodule |
| 3 | 2595698237 | Methylobacterium sp. UNCCL125 | Isolate | Unclassified |
| 4 | 2599185292 | Achromobacter sp. NFACC18-2 | Isolate | Rhizoplane |
| 5 | 2643221569 | Achromobacter sp. Root565 | Isolate | Unclassified |
| 6 | 2643221594 | Achromobacter sp. Root170 | Isolate | Unclassified |
| 7 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 8 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 9 | 2643221621 | Achromobacter sp. Root83 | Isolate | Unclassified |
| 10 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 11 | 2738541281 | Methylobacterium sp. GV094 | Isolate | Unclassified |
| 12 | 2738543032 | Methylobacterium sp. GV104 | Isolate | Unclassified |
| 13 | 2739367700 | Dyella sp. YR388 | Isolate | Unclassified |
| 14 | 2808606395 | Achromobacter sp. SLBN-14 | Isolate | Unclassified |
| 15 | 2829745981 | Methylorubrum rhodinum DSM 2163 | Isolate | Rhizosphere |
| 16 | 2842698319 | Methylobacterium sp. R-72139 | Isolate | Unclassified |
| 17 | 2842780639 | Pseudoxanthomonas sp. R-71986 | Isolate | Unclassified |
| 18 | 2857537821 | Achromobacter sp. R-71975 | Isolate | Unclassified |
| 19 | 2858950400 | Achromobacter sp. K91 | Isolate | Unclassified |
| 20 | 2861691609 | Methylorubrum thiocyanatum DSM 11490 | Isolate | Rhizosphere |
| 21 | 2884411467 | Dyella sp. AD56 | Isolate | Rhizosphere |
| 22 | 2887375801 | Parapusillimonas sp. SGNA-6 | Isolate | Rhizosphere |
| 23 | 2889306138 | Methylobacterium sp. PvR107 | Isolate | Rhizosphere |
| 24 | 2897803580 | Azospirillum doebereinerae GSF71 | Isolate | Unclassified |
| 25 | 2902330777 | Methylobacterium sp. 2A | Isolate | Unclassified |
| 26 | 2902405164 | Methylobacterium sp. P1-11 | Isolate | Unclassified |
| 27 | 2928125067 | Methylobacterium sp. 1973 | Isolate | Unclassified |
| 28 | 2928963466 | Dyella japonica 1073 | Isolate | Unclassified |
| 29 | 2946787523 | Sphingomonas faeni W4I17 | Isolate | Rhizosphere |
| 30 | 2990265787 | Sphingomonas sp. SORGH_AS802 | Isolate | Aerial Root |
| 31 | 2993693658 | Sphingomonas sp. SORGH_AS438 | Isolate | Aerial Root |
| 32 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 33 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 34 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 35 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 36 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 37 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 38 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 39 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 40 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 41 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 42 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 43 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 44 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 45 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 46 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 47 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 48 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 49 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 50 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 52 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 55 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 68 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 69 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 73 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 75 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 77 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 78 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 79 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 80 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 82 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 83 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 84 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 85 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 86 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 87 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 88 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 89 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 90 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 91 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 93 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 94 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 95 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 96 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 97 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 98 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 99 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009982 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG | Metagenome | Rhizosphere |
| 113 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 116 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 126 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 127 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 128 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 129 | 3300022734 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 | Metagenome | Rhizosphere |
| 130 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 131 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 141 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 142 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 145 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 146 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 186 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 190 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 191 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 192 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 193 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 194 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 195 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 196 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 197 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 198 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 199 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 200 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 201 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 202 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 203 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 204 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 205 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 206 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 207 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 208 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 209 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 210 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 211 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 212 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 213 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 214 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 215 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 216 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 217 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 218 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 219 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 220 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 221 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 222 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 223 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 224 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 225 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 226 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 227 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 228 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 229 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 230 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 231 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 232 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 233 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 234 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 235 | 3300044661 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COC2E | Metagenome | Unclassified |
| 236 | 3300044663 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E_TR | Metagenome | Unclassified |
| 237 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 238 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 239 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 240 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 241 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 242 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 243 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 244 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 245 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 246 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 247 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 248 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 249 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 250 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 251 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 252 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 289 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 290 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 291 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 292 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 293 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 294 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 295 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 296 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 297 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 298 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 299 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 300 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 301 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 302 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 303 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 304 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 305 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 306 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 307 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 308 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 309 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 310 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 335 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 336 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 337 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 338 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 339 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 340 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 342 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 343 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 345 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 346 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 347 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 348 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 349 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 350 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 353 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 354 | 643348564 | Methylobacterium nodulans ORS 2060 | Isolate | Nodule |
| 355 | 8054002106 | Azospirillum lipoferum 59b | Isolate | Unclassified |
| 356 | 8055225921 | Achromobacter panacis KCTC 42751 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.3 |
| Metatranscriptomes | 0.58 |
| Isolates | 5.12 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.29 |
| Bulb | 0 |
| Endosphere | 16.08 |
| Nodule | 0.29 |
| Rhizoplane | 3.36 |
| Rhizosphere | 64.04 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 15.94 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10017019 | 3300001989 | Bacteria | 2627 |
| 2 | JGI24737J22298_10005705 | 3300001990 | Bacteria | 4284 |
| 3 | JGI25156J39149_1000479 | 3300002705 | Bacteria | 24065 |
| 4 | JGI25156J39149_1008700 | 3300002705 | Bacteria | 2531 |
| 5 | JGI25156J39149_1020802 | 3300002705 | Bacteria | 1146 |
| 6 | JGI25162J39368_1001129 | 3300002737 | Bacteria | 16058 |
| 7 | JGI25162J39368_1002121 | 3300002737 | Bacteria | 8425 |
| 8 | JGI25162J39368_1002475 | 3300002737 | Bacteria | 7128 |
| 9 | JGI25162J39368_1003297 | 3300002737 | Bacteria | 4857 |
| 10 | JGI25162J39368_1003914 | 3300002737 | Bacteria | 3842 |
| 11 | JGI25157J39369_1000483 | 3300002741 | Bacteria | 24992 |
| 12 | JGI25157J39369_1000584 | 3300002741 | Bacteria | 21537 |
| 13 | JGI25157J39369_1003426 | 3300002741 | Bacteria | 3255 |
| 14 | JGI25163J39215_1000647 | 3300002771 | Bacteria | 9418 |
| 15 | JGI25164J39214_1000270 | 3300002772 | Bacteria | 38473 |
| 16 | JGI25164J39214_1000428 | 3300002772 | Bacteria | 23332 |
| 17 | JGI25165J46597_1000487 | 3300003214 | Bacteria | 38473 |
| 18 | JGI25165J46597_1000832 | 3300003214 | Bacteria | 22947 |
| 19 | JGI25153J46596_10001253 | 3300003215 | Bacteria | 15280 |
| 20 | JGI25153J46596_10009999 | 3300003215 | Bacteria | 4334 |
| 21 | rootH2_10006370 | 3300003320 | Bacteria | 27393 |
| 22 | rootL2_10007589 | 3300003322 | Bacteria | 2869 |
| 23 | Ga0055533_1000439 | 3300003756 | Bacteria | 15819 |
| 24 | Ga0055533_1001842 | 3300003756 | Bacteria | 5307 |
| 25 | Ga0055525_1000030 | 3300003759 | Bacteria | 318094 |
| 26 | Ga0055525_1000306 | 3300003759 | Bacteria | 40206 |
| 27 | Ga0055527_1000060 | 3300003760 | Bacteria | 92147 |
| 28 | Ga0055527_1000113 | 3300003760 | Bacteria | 57956 |
| 29 | Ga0055527_1000142 | 3300003760 | Bacteria | 50604 |
| 30 | Ga0055527_1000290 | 3300003760 | Bacteria | 29064 |
| 31 | Ga0055527_1000341 | 3300003760 | Bacteria | 23705 |
| 32 | Ga0055535_1000160 | 3300003761 | Bacteria | 72123 |
| 33 | Ga0055535_1000257 | 3300003761 | Bacteria | 55687 |
| 34 | Ga0055535_1000412 | 3300003761 | Bacteria | 40225 |
| 35 | Ga0055535_1000907 | 3300003761 | Bacteria | 20090 |
| 36 | Ga0055535_1001127 | 3300003761 | Bacteria | 15999 |
| 37 | Ga0055535_1001465 | 3300003761 | Bacteria | 11880 |
| 38 | Ga0055542_1000128 | 3300003762 | Bacteria | 99868 |
| 39 | Ga0055542_1000171 | 3300003762 | Bacteria | 80629 |
| 40 | Ga0055542_1000294 | 3300003762 | Bacteria | 55687 |
| 41 | Ga0055542_1000413 | 3300003762 | Bacteria | 41680 |
| 42 | Ga0055542_1000776 | 3300003762 | Bacteria | 24010 |
| 43 | Ga0055542_1001114 | 3300003762 | Bacteria | 16058 |
| 44 | Ga0055542_1001281 | 3300003762 | Bacteria | 13538 |
| 45 | Ga0055529_1000295 | 3300003763 | Bacteria | 57960 |
| 46 | Ga0055529_1000388 | 3300003763 | Bacteria | 47502 |
| 47 | Ga0055529_1000429 | 3300003763 | Bacteria | 42686 |
| 48 | Ga0055529_1000573 | 3300003763 | Bacteria | 29920 |
| 49 | Ga0055529_1000752 | 3300003763 | Bacteria | 20858 |
| 50 | Ga0055529_1000754 | 3300003763 | Bacteria | 20643 |
| 51 | Ga0065707_10100611 | 3300005295 | Bacteria | 2918 |
| 52 | Ga0070676_10108474 | 3300005328 | Bacteria | 1725 |
| 53 | Ga0070690_100012375 | 3300005330 | Bacteria | 5021 |
| 54 | Ga0070680_100184429 | 3300005336 | Bacteria | 1758 |
| 55 | Ga0070680_100197455 | 3300005336 | Bacteria | 1696 |
| 56 | Ga0070680_100197460 | 3300005336 | Bacteria | 1696 |
| 57 | Ga0070660_100218849 | 3300005339 | Bacteria | 1547 |
| 58 | Ga0070689_100001554 | 3300005340 | Bacteria | 14625 |
| 59 | Ga0070669_100237250 | 3300005353 | Bacteria | 1447 |
| 60 | Ga0070675_100050457 | 3300005354 | Bacteria | 3416 |
| 61 | Ga0070671_100228133 | 3300005355 | Bacteria | 1580 |
| 62 | Ga0070673_100101216 | 3300005364 | Bacteria | 2373 |
| 63 | Ga0070673_100163402 | 3300005364 | Bacteria | 1895 |
| 64 | Ga0070659_100073529 | 3300005366 | Bacteria | 2721 |
| 65 | Ga0070709_10013558 | 3300005434 | Bacteria | 4586 |
| 66 | Ga0070709_10214040 | 3300005434 | Bacteria | 1371 |
| 67 | Ga0070714_100004122 | 3300005435 | Bacteria | 10927 |
| 68 | Ga0070714_100012973 | 3300005435 | Bacteria | 6665 |
| 69 | Ga0070714_100028985 | 3300005435 | Bacteria | 4598 |
| 70 | Ga0070714_100171241 | 3300005435 | Bacteria | 1970 |
| 71 | Ga0070713_100001562 | 3300005436 | Bacteria | 14645 |
| 72 | Ga0070713_100042543 | 3300005436 | Bacteria | 3708 |
| 73 | Ga0070713_100277959 | 3300005436 | Bacteria | 1535 |
| 74 | Ga0070713_100324765 | 3300005436 | Bacteria | 1422 |
| 75 | Ga0070711_100073428 | 3300005439 | Bacteria | 2417 |
| 76 | Ga0070711_100236284 | 3300005439 | Bacteria | 1427 |
| 77 | Ga0070708_100009962 | 3300005445 | Bacteria | 7684 |
| 78 | Ga0070708_100135184 | 3300005445 | Bacteria | 2283 |
| 79 | Ga0070663_100028585 | 3300005455 | Bacteria | 3798 |
| 80 | Ga0070663_100075221 | 3300005455 | Bacteria | 2468 |
| 81 | Ga0070663_100102607 | 3300005455 | Bacteria | 2137 |
| 82 | Ga0070662_100355077 | 3300005457 | Bacteria | 1202 |
| 83 | Ga0070681_10035542 | 3300005458 | Bacteria | 5006 |
| 84 | Ga0070681_10139023 | 3300005458 | Bacteria | 2358 |
| 85 | Ga0070681_10157745 | 3300005458 | Bacteria | 2193 |
| 86 | Ga0070685_10027920 | 3300005466 | Bacteria | 3124 |
| 87 | Ga0070707_100017177 | 3300005468 | Bacteria | 6800 |
| 88 | Ga0070707_100230363 | 3300005468 | Bacteria | 1803 |
| 89 | Ga0070698_100050031 | 3300005471 | Bacteria | 4263 |
| 90 | Ga0070699_100073941 | 3300005518 | Bacteria | 2965 |
| 91 | Ga0070679_100017201 | 3300005530 | Bacteria | 6995 |
| 92 | Ga0070679_100030406 | 3300005530 | Bacteria | 5332 |
| 93 | Ga0070679_100330913 | 3300005530 | Bacteria | 1472 |
| 94 | Ga0070697_100133026 | 3300005536 | Bacteria | 2087 |
| 95 | Ga0070697_100298218 | 3300005536 | Bacteria | 1385 |
| 96 | Ga0070697_100419715 | 3300005536 | Bacteria | 1162 |
| 97 | Ga0068853_100110363 | 3300005539 | Bacteria | 2443 |
| 98 | Ga0068853_100337729 | 3300005539 | Bacteria | 1399 |
| 99 | Ga0070693_100012025 | 3300005547 | Bacteria | 4370 |
| 100 | Ga0068855_100020179 | 3300005563 | Bacteria | 8002 |
| 101 | Ga0068855_100042682 | 3300005563 | Bacteria | 5373 |
| 102 | Ga0068855_100108896 | 3300005563 | Bacteria | 3182 |
| 103 | Ga0068855_100142567 | 3300005563 | Bacteria | 2729 |
| 104 | Ga0068857_100002222 | 3300005577 | Bacteria | 15811 |
| 105 | Ga0068857_100056162 | 3300005577 | Bacteria | 3494 |
| 106 | Ga0068854_100002653 | 3300005578 | Bacteria | 11087 |
| 107 | Ga0068854_100015938 | 3300005578 | Bacteria | 4996 |
| 108 | Ga0068856_100001892 | 3300005614 | Bacteria | 21818 |
| 109 | Ga0068856_100069266 | 3300005614 | Bacteria | 3488 |
| 110 | Ga0068856_100297394 | 3300005614 | Bacteria | 1631 |
| 111 | Ga0070702_100253162 | 3300005615 | Bacteria | 1195 |
| 112 | Ga0068852_100137729 | 3300005616 | Bacteria | 2255 |
| 113 | Ga0068851_10000936 | 3300005834 | Bacteria | 12635 |
| 114 | Ga0068858_100144312 | 3300005842 | Bacteria | 2235 |
| 115 | Ga0068858_100698750 | 3300005842 | Bacteria | 987 |
| 116 | Ga0068860_100000548 | 3300005843 | Bacteria | 45747 |
| 117 | Ga0081455_10150107 | 3300005937 | Bacteria | 1798 |
| 118 | Ga0075364_10035088 | 3300006051 | Bacteria | 3240 |
| 119 | Ga0075364_10318975 | 3300006051 | Bacteria | 1058 |
| 120 | Ga0070716_100125424 | 3300006173 | Bacteria | 1614 |
| 121 | Ga0070716_100184583 | 3300006173 | Bacteria | 1373 |
| 122 | Ga0070712_100230697 | 3300006175 | Bacteria | 1470 |
| 123 | Ga0075369_10030921 | 3300006186 | Bacteria | 2256 |
| 124 | Ga0075366_10003143 | 3300006195 | Bacteria | 8641 |
| 125 | Ga0097621_100024293 | 3300006237 | Bacteria | 4731 |
| 126 | Ga0097621_100090181 | 3300006237 | Bacteria | 2564 |
| 127 | Ga0068871_100007696 | 3300006358 | Bacteria | 7708 |
| 128 | Ga0075431_100019988 | 3300006847 | Bacteria | 6838 |
| 129 | Ga0075431_100042754 | 3300006847 | Bacteria | 4674 |
| 130 | Ga0075433_10265919 | 3300006852 | Bacteria | 1520 |
| 131 | Ga0075433_10395832 | 3300006852 | Bacteria | 1219 |
| 132 | Ga0075434_100005412 | 3300006871 | Bacteria | 11616 |
| 133 | Ga0075434_100009536 | 3300006871 | Bacteria | 9059 |
| 134 | Ga0075434_100058711 | 3300006871 | Bacteria | 3824 |
| 135 | Ga0075429_100115587 | 3300006880 | Bacteria | 2345 |
| 136 | Ga0075429_100228905 | 3300006880 | Bacteria | 1628 |
| 137 | Ga0075436_100005990 | 3300006914 | Bacteria | 8350 |
| 138 | Ga0075435_100199657 | 3300007076 | Bacteria | 1694 |
| 139 | Ga0105251_10002726 | 3300009011 | Bacteria | 13539 |
| 140 | Ga0105244_10080285 | 3300009036 | Bacteria | 1615 |
| 141 | Ga0105240_10000197 | 3300009093 | Bacteria | 123221 |
| 142 | Ga0105240_10000199 | 3300009093 | Bacteria | 122191 |
| 143 | Ga0105240_10031713 | 3300009093 | Bacteria | 6848 |
| 144 | Ga0105240_10045931 | 3300009093 | Bacteria | 5538 |
| 145 | Ga0105240_10054121 | 3300009093 | Bacteria | 5031 |
| 146 | Ga0105240_10074999 | 3300009093 | Bacteria | 4173 |
| 147 | Ga0105240_10107999 | 3300009093 | Bacteria | 3372 |
| 148 | Ga0105240_10829593 | 3300009093 | Bacteria | 1000 |
| 149 | Ga0105245_10111298 | 3300009098 | Bacteria | 2546 |
| 150 | Ga0105247_10032660 | 3300009101 | Bacteria | 3162 |
| 151 | Ga0114129_10058975 | 3300009147 | Bacteria | 5367 |
| 152 | Ga0114129_10126778 | 3300009147 | Bacteria | 3509 |
| 153 | Ga0114129_10533595 | 3300009147 | Bacteria | 1528 |
| 154 | Ga0114129_10576911 | 3300009147 | Bacteria | 1460 |
| 155 | Ga0105243_10125125 | 3300009148 | Bacteria | 2173 |
| 156 | Ga0105241_10133884 | 3300009174 | Bacteria | 2010 |
| 157 | Ga0105242_10017145 | 3300009176 | Bacteria | 5639 |
| 158 | Ga0105242_10143183 | 3300009176 | Bacteria | 2077 |
| 159 | Ga0105242_10349991 | 3300009176 | Bacteria | 1364 |
| 160 | Ga0105248_10092018 | 3300009177 | Bacteria | 3415 |
| 161 | Ga0105248_10163778 | 3300009177 | Bacteria | 2507 |
| 162 | Ga0105248_10457848 | 3300009177 | Bacteria | 1438 |
| 163 | Ga0105237_10000112 | 3300009545 | Bacteria | 114192 |
| 164 | Ga0105237_10093677 | 3300009545 | Bacteria | 2993 |
| 165 | Ga0105237_10272967 | 3300009545 | Bacteria | 1694 |
| 166 | Ga0105237_10537236 | 3300009545 | Bacteria | 1176 |
| 167 | Ga0105238_10097305 | 3300009551 | Bacteria | 2929 |
| 168 | Ga0105238_10196312 | 3300009551 | Bacteria | 1994 |
| 169 | Ga0105249_10252758 | 3300009553 | Bacteria | 1748 |
| 170 | Ga0105147_107285 | 3300009982 | Bacteria | 938 |
| 171 | Ga0105239_10000054 | 3300010375 | Bacteria | 159216 |
| 172 | Ga0105239_10000061 | 3300010375 | Bacteria | 154661 |
| 173 | Ga0105239_10117019 | 3300010375 | Bacteria | 2958 |
| 174 | Ga0105246_10009096 | 3300011119 | Bacteria | 6117 |
| 175 | Ga0157314_1000010 | 3300012500 | Bacteria | 21255 |
| 176 | Ga0157373_10182862 | 3300013100 | Bacteria | 1476 |
| 177 | Ga0157369_10009042 | 3300013105 | Bacteria | 11405 |
| 178 | Ga0157369_10117285 | 3300013105 | Bacteria | 2826 |
| 179 | Ga0157378_10052337 | 3300013297 | Bacteria | 3633 |
| 180 | Ga0163162_10051973 | 3300013306 | Bacteria | 4114 |
| 181 | Ga0163162_10060208 | 3300013306 | Bacteria | 3831 |
| 182 | Ga0157372_10002320 | 3300013307 | Bacteria | 20607 |
| 183 | Ga0157375_11194103 | 3300013308 | Bacteria | 892 |
| 184 | Ga0157380_10008810 | 3300014326 | Bacteria | 7210 |
| 185 | Ga0157380_10053656 | 3300014326 | Bacteria | 3197 |
| 186 | Ga0157377_10253111 | 3300014745 | Bacteria | 1142 |
| 187 | Ga0157376_10098462 | 3300014969 | Bacteria | 2549 |
| 188 | Ga0182007_10069049 | 3300015262 | Bacteria | 1158 |
| 189 | Ga0183368_1002 | 3300015687 | Bacteria | 1865598 |
| 190 | Ga0206351_10683695 | 3300020077 | Bacteria | 826 |
| 191 | Ga0213872_10002401 | 3300021361 | Bacteria | 11064 |
| 192 | Ga0213872_10029959 | 3300021361 | Bacteria | 2496 |
| 193 | Ga0213872_10104153 | 3300021361 | Bacteria | 1263 |
| 194 | Ga0224571_105624 | 3300022734 | Bacteria | 826 |
| 195 | Ga0209435_102319 | 3300025206 | Bacteria | 2240 |
| 196 | Ga0209435_108715 | 3300025206 | Bacteria | 1114 |
| 197 | Ga0209760_100718 | 3300025207 | Bacteria | 5015 |
| 198 | Ga0209784_100074 | 3300025224 | Bacteria | 144366 |
| 199 | Ga0209566_102088 | 3300025225 | Bacteria | 4129 |
| 200 | Ga0209674_100068 | 3300025226 | Bacteria | 245612 |
| 201 | Ga0209674_100111 | 3300025226 | Bacteria | 143058 |
| 202 | Ga0209672_100004 | 3300025228 | Bacteria | 1467504 |
| 203 | Ga0209672_100008 | 3300025228 | Bacteria | 946876 |
| 204 | Ga0209672_100043 | 3300025228 | Bacteria | 270302 |
| 205 | Ga0209672_100229 | 3300025228 | Bacteria | 42746 |
| 206 | Ga0209672_100416 | 3300025228 | Bacteria | 25021 |
| 207 | Ga0209672_101094 | 3300025228 | Bacteria | 11506 |
| 208 | Ga0209672_103526 | 3300025228 | Bacteria | 3205 |
| 209 | Ga0209563_100028 | 3300025230 | Bacteria | 509539 |
| 210 | Ga0209563_100062 | 3300025230 | Bacteria | 264769 |
| 211 | Ga0207427_100079 | 3300025231 | Bacteria | 145096 |
| 212 | Ga0207427_100252 | 3300025231 | Bacteria | 42486 |
| 213 | Ga0207427_101437 | 3300025231 | Bacteria | 8615 |
| 214 | Ga0209437_100163 | 3300025233 | Bacteria | 145370 |
| 215 | Ga0209437_100379 | 3300025233 | Bacteria | 44647 |
| 216 | Ga0209437_100391 | 3300025233 | Bacteria | 42486 |
| 217 | Ga0209437_103389 | 3300025233 | Bacteria | 2896 |
| 218 | Ga0209258_100003 | 3300025242 | Bacteria | 1467504 |
| 219 | Ga0209258_100004 | 3300025242 | Bacteria | 1376422 |
| 220 | Ga0209258_100008 | 3300025242 | Bacteria | 1009355 |
| 221 | Ga0209258_100076 | 3300025242 | Bacteria | 270302 |
| 222 | Ga0209258_100217 | 3300025242 | Bacteria | 110607 |
| 223 | Ga0209258_100671 | 3300025242 | Bacteria | 24168 |
| 224 | Ga0209258_100757 | 3300025242 | Bacteria | 20285 |
| 225 | Ga0209258_101469 | 3300025242 | Bacteria | 8184 |
| 226 | Ga0209258_102547 | 3300025242 | Bacteria | 4592 |
| 227 | Ga0209646_1001082 | 3300025246 | Bacteria | 8153 |
| 228 | Ga0209646_1002310 | 3300025246 | Bacteria | 4331 |
| 229 | Ga0209646_1006223 | 3300025246 | Bacteria | 2016 |
| 230 | Ga0209026_1000088 | 3300025250 | Bacteria | 177275 |
| 231 | Ga0209026_1000109 | 3300025250 | Bacteria | 144563 |
| 232 | Ga0209026_1000578 | 3300025250 | Bacteria | 24159 |
| 233 | Ga0209026_1001248 | 3300025250 | Bacteria | 11644 |
| 234 | Ga0209677_103999 | 3300025253 | Bacteria | 4457 |
| 235 | Ga0209148_1000001 | 3300025254 | Bacteria | 2545271 |
| 236 | Ga0209148_1000002 | 3300025254 | Bacteria | 2399500 |
| 237 | Ga0209148_1000016 | 3300025254 | Bacteria | 804369 |
| 238 | Ga0209148_1000041 | 3300025254 | Bacteria | 469323 |
| 239 | Ga0209148_1000082 | 3300025254 | Bacteria | 270302 |
| 240 | Ga0209148_1000197 | 3300025254 | Bacteria | 109412 |
| 241 | Ga0209148_1000473 | 3300025254 | Bacteria | 42747 |
| 242 | Ga0209759_1000441 | 3300025256 | Bacteria | 48709 |
| 243 | Ga0209759_1000489 | 3300025256 | Bacteria | 43662 |
| 244 | Ga0209759_1001276 | 3300025256 | Bacteria | 15076 |
| 245 | Ga0209759_1008589 | 3300025256 | Bacteria | 3167 |
| 246 | Ga0209129_1000696 | 3300025258 | Bacteria | 22042 |
| 247 | Ga0209233_1000002 | 3300025261 | Bacteria | 2501366 |
| 248 | Ga0209233_1000357 | 3300025261 | Bacteria | 42486 |
| 249 | Ga0209233_1028130 | 3300025261 | Bacteria | 1353 |
| 250 | Ga0209455_1000004 | 3300025272 | Bacteria | 1467504 |
| 251 | Ga0209455_1000007 | 3300025272 | Bacteria | 1157983 |
| 252 | Ga0209455_1000078 | 3300025272 | Bacteria | 270237 |
| 253 | Ga0209455_1000079 | 3300025272 | Bacteria | 268778 |
| 254 | Ga0209455_1000356 | 3300025272 | Bacteria | 42747 |
| 255 | Ga0209455_1005236 | 3300025272 | Bacteria | 4054 |
| 256 | Ga0209455_1010211 | 3300025272 | Bacteria | 2403 |
| 257 | Ga0209455_1014346 | 3300025272 | Bacteria | 1796 |
| 258 | Ga0209676_1017627 | 3300025292 | Bacteria | 2521 |
| 259 | Ga0209758_1000185 | 3300025297 | Bacteria | 139330 |
| 260 | Ga0209758_1000726 | 3300025297 | Bacteria | 48263 |
| 261 | Ga0209758_1011013 | 3300025297 | Bacteria | 5302 |
| 262 | Ga0209050_1002993 | 3300025298 | Bacteria | 13139 |
| 263 | Ga0207656_10021530 | 3300025321 | Bacteria | 2577 |
| 264 | Ga0207655_1011838 | 3300025728 | Bacteria | 5154 |
| 265 | Ga0207655_1055154 | 3300025728 | Bacteria | 1575 |
| 266 | Ga0207713_1000078 | 3300025735 | Bacteria | 175087 |
| 267 | Ga0207710_10015747 | 3300025900 | Bacteria | 3197 |
| 268 | Ga0207647_10002237 | 3300025904 | Bacteria | 14740 |
| 269 | Ga0207647_10040567 | 3300025904 | Bacteria | 2931 |
| 270 | Ga0207699_10114972 | 3300025906 | Bacteria | 1731 |
| 271 | Ga0207705_10033478 | 3300025909 | Bacteria | 3671 |
| 272 | Ga0207705_10069160 | 3300025909 | Bacteria | 2557 |
| 273 | Ga0207684_10274831 | 3300025910 | Bacteria | 1453 |
| 274 | Ga0207707_10008510 | 3300025912 | Bacteria | 8894 |
| 275 | Ga0207707_10316013 | 3300025912 | Bacteria | 1349 |
| 276 | Ga0207695_10000207 | 3300025913 | Bacteria | 160390 |
| 277 | Ga0207695_10000746 | 3300025913 | Bacteria | 62682 |
| 278 | Ga0207695_10004175 | 3300025913 | Bacteria | 19845 |
| 279 | Ga0207695_10017482 | 3300025913 | Bacteria | 8345 |
| 280 | Ga0207695_10049748 | 3300025913 | Bacteria | 4414 |
| 281 | Ga0207695_10069643 | 3300025913 | Bacteria | 3599 |
| 282 | Ga0207695_10199978 | 3300025913 | Bacteria | 1913 |
| 283 | Ga0207695_10247819 | 3300025913 | Bacteria | 1681 |
| 284 | Ga0207671_10000009 | 3300025914 | Bacteria | 724862 |
| 285 | Ga0207693_10336810 | 3300025915 | Bacteria | 1181 |
| 286 | Ga0207660_10017740 | 3300025917 | Bacteria | 4735 |
| 287 | Ga0207662_10101193 | 3300025918 | Bacteria | 1786 |
| 288 | Ga0207662_10187892 | 3300025918 | Bacteria | 1332 |
| 289 | Ga0207652_10018181 | 3300025921 | Bacteria | 5762 |
| 290 | Ga0207652_10028627 | 3300025921 | Bacteria | 4651 |
| 291 | Ga0207646_10006618 | 3300025922 | Bacteria | 11961 |
| 292 | Ga0207646_10036118 | 3300025922 | Bacteria | 4461 |
| 293 | Ga0207646_10409019 | 3300025922 | Unclassified | 1225 |
| 294 | Ga0207646_10411577 | 3300025922 | Bacteria | 1221 |
| 295 | Ga0207694_10033668 | 3300025924 | Bacteria | 3925 |
| 296 | Ga0207694_10074422 | 3300025924 | Bacteria | 2658 |
| 297 | Ga0207659_10061379 | 3300025926 | Bacteria | 2709 |
| 298 | Ga0207659_10464961 | 3300025926 | Bacteria | 1067 |
| 299 | Ga0207700_10261112 | 3300025928 | Bacteria | 1483 |
| 300 | Ga0207700_10264391 | 3300025928 | Bacteria | 1474 |
| 301 | Ga0207700_10311770 | 3300025928 | Bacteria | 1361 |
| 302 | Ga0207664_10032883 | 3300025929 | Bacteria | 3979 |
| 303 | Ga0207706_10015120 | 3300025933 | Bacteria | 6984 |
| 304 | Ga0207706_10043672 | 3300025933 | Bacteria | 3972 |
| 305 | Ga0207686_10137772 | 3300025934 | Bacteria | 1683 |
| 306 | Ga0207686_10145005 | 3300025934 | Bacteria | 1646 |
| 307 | Ga0207670_10040837 | 3300025936 | Bacteria | 3047 |
| 308 | Ga0207670_10236785 | 3300025936 | Bacteria | 1404 |
| 309 | Ga0207665_10103521 | 3300025939 | Bacteria | 1991 |
| 310 | Ga0207665_10146425 | 3300025939 | Bacteria | 1688 |
| 311 | Ga0207665_10568814 | 3300025939 | Bacteria | 882 |
| 312 | Ga0207689_10218151 | 3300025942 | Bacteria | 1576 |
| 313 | Ga0207667_10001194 | 3300025949 | Bacteria | 32590 |
| 314 | Ga0207667_10002016 | 3300025949 | Bacteria | 25491 |
| 315 | Ga0207667_10096775 | 3300025949 | Bacteria | 3046 |
| 316 | Ga0207667_10320992 | 3300025949 | Bacteria | 1582 |
| 317 | Ga0207651_10212591 | 3300025960 | Bacteria | 1558 |
| 318 | Ga0207640_10001472 | 3300025981 | Bacteria | 12694 |
| 319 | Ga0207640_10015593 | 3300025981 | Bacteria | 4403 |
| 320 | Ga0207640_10472812 | 3300025981 | Bacteria | 1038 |
| 321 | Ga0207703_10010532 | 3300026035 | Bacteria | 7230 |
| 322 | Ga0207639_10066797 | 3300026041 | Bacteria | 2796 |
| 323 | Ga0207678_10049073 | 3300026067 | Bacteria | 3647 |
| 324 | Ga0207678_10050297 | 3300026067 | Bacteria | 3601 |
| 325 | Ga0207678_10060739 | 3300026067 | Bacteria | 3251 |
| 326 | Ga0207678_10090238 | 3300026067 | Bacteria | 2619 |
| 327 | Ga0207702_10001234 | 3300026078 | Bacteria | 25867 |
| 328 | Ga0207702_10030769 | 3300026078 | Bacteria | 4471 |
| 329 | Ga0207674_10000145 | 3300026116 | Bacteria | 83147 |
| 330 | Ga0207674_10004815 | 3300026116 | Bacteria | 16168 |
| 331 | Ga0207698_10005538 | 3300026142 | Bacteria | 7815 |
| 332 | Ga0207698_10202622 | 3300026142 | Bacteria | 1778 |
| 333 | Ga0207698_10345082 | 3300026142 | Bacteria | 1404 |
| 334 | Ga0207428_10050882 | 3300027907 | Bacteria | 3312 |
| 335 | Ga0207428_10150156 | 3300027907 | Bacteria | 1774 |
| 336 | Ga0207428_10152719 | 3300027907 | Bacteria | 1757 |
| 337 | Ga0207428_10306359 | 3300027907 | Bacteria | 1175 |
| 338 | Ga0268266_10000002 | 3300028379 | Bacteria | 3059047 |
| 339 | Ga0268266_10489735 | 3300028379 | Bacteria | 1173 |
| 340 | Ga0268265_10085066 | 3300028380 | Bacteria | 2509 |
| 341 | Ga0268264_10255248 | 3300028381 | Bacteria | 1631 |
| 342 | Ga0268264_10700146 | 3300028381 | Bacteria | 1006 |
| 343 | Ga0268264_10718655 | 3300028381 | Bacteria | 993 |
| 344 | Ga0265326_10013291 | 3300028558 | Bacteria | 2411 |
| 345 | Ga0265319_1011525 | 3300028563 | Bacteria | 3616 |
| 346 | Ga0265334_10001994 | 3300028573 | Bacteria | 9701 |
| 347 | Ga0307511_10055431 | 3300030521 | Bacteria | 3112 |
| 348 | Ga0265762_1027671 | 3300030760 | Bacteria | 1065 |
| 349 | Ga0265763_1000757 | 3300030763 | Bacteria | 2110 |
| 350 | Ga0265760_10002084 | 3300031090 | Bacteria | 5880 |
| 351 | Ga0265330_10004251 | 3300031235 | Bacteria | 7298 |
| 352 | Ga0265332_10043191 | 3300031238 | Bacteria | 1946 |
| 353 | Ga0265328_10061264 | 3300031239 | Bacteria | 1381 |
| 354 | Ga0265320_10022663 | 3300031240 | Bacteria | 3355 |
| 355 | Ga0265325_10018315 | 3300031241 | Bacteria | 3883 |
| 356 | Ga0265329_10008609 | 3300031242 | Bacteria | 3856 |
| 357 | Ga0265339_10013095 | 3300031249 | Bacteria | 5037 |
| 358 | Ga0265331_10027740 | 3300031250 | Bacteria | 2836 |
| 359 | Ga0265316_10114149 | 3300031344 | Bacteria | 2043 |
| 360 | Ga0265313_10005711 | 3300031595 | Bacteria | 9065 |
| 361 | Ga0307508_10048633 | 3300031616 | Bacteria | 3776 |
| 362 | Ga0265314_10000144 | 3300031711 | Bacteria | 107465 |
| 363 | Ga0265314_10008509 | 3300031711 | Bacteria | 8772 |
| 364 | Ga0265314_10015115 | 3300031711 | Bacteria | 6139 |
| 365 | Ga0265342_10024197 | 3300031712 | Bacteria | 3835 |
| 366 | Ga0307516_10085295 | 3300031730 | Bacteria | 2996 |
| 367 | Ga0307407_10018217 | 3300031903 | Bacteria | 3546 |
| 368 | Ga0307412_10001318 | 3300031911 | Bacteria | 13900 |
| 369 | Ga0307409_100298389 | 3300031995 | Bacteria | 1498 |
| 370 | Ga0307507_10070636 | 3300033179 | Bacteria | 3165 |
| 371 | Ga0373951_0093135 | 3300035091 | Bacteria | 793 |
| 372 | Ga0373936_0039182 | 3300035113 | Bacteria | 1896 |
| 373 | Ga0373941_0041906 | 3300035115 | Bacteria | 1419 |
| 374 | Ga0373924_0265187 | 3300035410 | Bacteria | 761 |
| 375 | Ga0373935_0030160 | 3300035692 | Bacteria | 3359 |
| 376 | Ga0373933_0452755 | 3300035724 | Bacteria | 840 |
| 377 | Ga0373937_0016031 | 3300036401 | Bacteria | 6646 |
| 378 | Ga0373937_0330237 | 3300036401 | Bacteria | 1443 |
| 379 | Ga0373937_0546154 | 3300036401 | Bacteria | 1101 |
| 380 | Ga0316582_0024616 | 3300036647 | Bacteria | 3605 |
| 381 | Ga0373925_0057500 | 3300037068 | Bacteria | 2914 |
| 382 | Ga0395899_0000057 | 3300037312 | Bacteria | 214710 |
| 383 | Ga0395899_0002577 | 3300037312 | Bacteria | 14625 |
| 384 | Ga0395899_0179696 | 3300037312 | Bacteria | 1486 |
| 385 | Ga0395900_0000035 | 3300037418 | Bacteria | 254301 |
| 386 | Ga0395900_0124721 | 3300037418 | Bacteria | 2641 |
| 387 | Ga0395900_0285532 | 3300037418 | Bacteria | 1641 |
| 388 | Ga0395898_0000150 | 3300037466 | Bacteria | 181023 |
| 389 | Ga0395898_0731258 | 3300037466 | Bacteria | 931 |
| 390 | Ga0395905_0002061 | 3300037471 | Bacteria | 22906 |
| 391 | Ga0395901_0015566 | 3300038443 | Bacteria | 7747 |
| 392 | Ga0395901_0472064 | 3300038443 | Bacteria | 1280 |
| 393 | Ga0436365_0402584 | 3300039437 | Bacteria | 1212 |
| 394 | Ga0436365_1638281 | 3300039437 | Bacteria | 1554 |
| 395 | Ga0436365_1902360 | 3300039437 | Bacteria | 940 |
| 396 | Ga0436360_0448261 | 3300039438 | Bacteria | 2197 |
| 397 | Ga0436361_0049588 | 3300039447 | Bacteria | 1407 |
| 398 | Ga0436361_0205650 | 3300039447 | Bacteria | 1045 |
| 399 | Ga0436361_0211450 | 3300039447 | Bacteria | 871 |
| 400 | Ga0436361_0472131 | 3300039447 | Bacteria | 13030 |
| 401 | Ga0436361_1106151 | 3300039447 | Bacteria | 2236 |
| 402 | Ga0436363_0124313 | 3300039450 | Bacteria | 1473 |
| 403 | Ga0436363_0611592 | 3300039450 | Bacteria | 728 |
| 404 | Ga0451793_1763305 | 3300041452 | Bacteria | 4159 |
| 405 | Ga0466969_0005093 | 3300044656 | Bacteria | 6989 |
| 406 | Ga0466969_0132900 | 3300044656 | Bacteria | 1153 |
| 407 | Ga0466972_0044091 | 3300044658 | Bacteria | 2164 |
| 408 | Ga0466975_0136558 | 3300044661 | Bacteria | 1721 |
| 409 | Ga0466989_0015645 | 3300044663 | Bacteria | 4235 |
| 410 | Ga0466982_0000006 | 3300044672 | Bacteria | 333931 |
| 411 | Ga0466965_0128484 | 3300044683 | Bacteria | 1312 |
| 412 | Ga0466966_0001181 | 3300044684 | Bacteria | 16739 |
| 413 | Ga0466966_0028116 | 3300044684 | Bacteria | 3663 |
| 414 | Ga0466966_0034284 | 3300044684 | Bacteria | 3282 |
| 415 | Ga0466961_0000592 | 3300044693 | Bacteria | 22956 |
| 416 | Ga0466961_0001406 | 3300044693 | Bacteria | 14929 |
| 417 | Ga0466961_0003804 | 3300044693 | Bacteria | 9442 |
| 418 | Ga0466963_0060932 | 3300044694 | Bacteria | 2521 |
| 419 | Ga0466963_0123603 | 3300044694 | Bacteria | 1783 |
| 420 | Ga0466964_0010610 | 3300044706 | Bacteria | 3475 |
| 421 | Ga0453684_0175244 | 3300044712 | Bacteria | 2523 |
| 422 | Ga0466968_0089163 | 3300044735 | Bacteria | 1364 |
| 423 | Ga0466970_0000413 | 3300044765 | Bacteria | 20876 |
| 424 | Ga0466970_0010903 | 3300044765 | Bacteria | 4623 |
| 425 | Ga0466970_0039366 | 3300044765 | Bacteria | 2508 |
| 426 | Ga0466970_0161903 | 3300044765 | Bacteria | 1238 |
| 427 | Ga0466957_0000599 | 3300044842 | Bacteria | 18324 |
| 428 | Ga0466957_0053446 | 3300044842 | Bacteria | 2462 |
| 429 | Ga0466960_0042067 | 3300044901 | Bacteria | 2167 |
| 430 | Ga0466959_0000038 | 3300045049 | Bacteria | 101314 |
| 431 | Ga0466959_0014309 | 3300045049 | Bacteria | 5758 |
| 432 | Ga0466959_0030035 | 3300045049 | Bacteria | 4025 |
| 433 | Ga0466959_0031645 | 3300045049 | Bacteria | 3914 |
| 434 | Ga0466959_0388619 | 3300045049 | Bacteria | 949 |
| 435 | Ga0451576_0001130 | 3300045051 | Bacteria | 48331 |
| 436 | Ga0451576_0208489 | 3300045051 | Bacteria | 2041 |
| 437 | Ga0466958_0009749 | 3300045836 | Bacteria | 5359 |
| 438 | Ga0466958_0022342 | 3300045836 | Bacteria | 3704 |
| 439 | Ga0466958_0076958 | 3300045836 | Bacteria | 2048 |
| 440 | Ga0466967_0176951 | 3300045976 | Bacteria | 2010 |
| 441 | Ga0466967_0189060 | 3300045976 | Bacteria | 1945 |
| 442 | Ga0495627_002096 | 3300046453 | Bacteria | 10127 |
| 443 | Ga0495592_0070495 | 3300046454 | Bacteria | 2546 |
| 444 | Ga0495591_000755 | 3300046458 | Bacteria | 23371 |
| 445 | Ga0495638_0000085 | 3300046460 | Bacteria | 153005 |
| 446 | Ga0495638_0000541 | 3300046460 | Bacteria | 43533 |
| 447 | Ga0495638_0001761 | 3300046460 | Bacteria | 18966 |
| 448 | Ga0495638_0011430 | 3300046460 | Bacteria | 6117 |
| 449 | Ga0495651_0064916 | 3300046462 | Bacteria | 2789 |
| 450 | Ga0495650_0000333 | 3300046471 | Bacteria | 84578 |
| 451 | Ga0495664_0029070 | 3300046477 | Bacteria | 3230 |
| 452 | Ga0495607_0001801 | 3300046501 | Bacteria | 18308 |
| 453 | Ga0495607_0022701 | 3300046501 | Bacteria | 3936 |
| 454 | Ga0495607_0041643 | 3300046501 | Bacteria | 2726 |
| 455 | Ga0495583_0007868 | 3300046506 | Bacteria | 6617 |
| 456 | Ga0495606_0000746 | 3300046507 | Bacteria | 50273 |
| 457 | Ga0495606_0042688 | 3300046507 | Bacteria | 3031 |
| 458 | Ga0495616_0000017 | 3300046513 | Bacteria | 167324 |
| 459 | Ga0495616_0140170 | 3300046513 | Bacteria | 1101 |
| 460 | Ga0495628_0038088 | 3300046516 | Bacteria | 3851 |
| 461 | Ga0495632_0140243 | 3300046519 | Bacteria | 1122 |
| 462 | Ga0495587_0005777 | 3300046536 | Bacteria | 8059 |
| 463 | Ga0495587_0042600 | 3300046536 | Bacteria | 2707 |
| 464 | Ga0495598_0035793 | 3300046537 | Bacteria | 1423 |
| 465 | Ga0495609_0000202 | 3300046538 | Bacteria | 59327 |
| 466 | Ga0495597_0043110 | 3300046542 | Bacteria | 2010 |
| 467 | Ga0495645_0000615 | 3300046543 | Bacteria | 24594 |
| 468 | Ga0495622_0015305 | 3300046557 | Bacteria | 3566 |
| 469 | Ga0495622_0016634 | 3300046557 | Bacteria | 3426 |
| 470 | Ga0495667_0011017 | 3300046559 | Bacteria | 6113 |
| 471 | Ga0495656_0012426 | 3300046615 | Bacteria | 3141 |
| 472 | Ga0495668_0012539 | 3300046616 | Bacteria | 5027 |
| 473 | Ga0495625_0024884 | 3300046660 | Bacteria | 4547 |
| 474 | Ga0495625_0122986 | 3300046660 | Bacteria | 1764 |
| 475 | Ga0495661_0080411 | 3300046665 | Bacteria | 1881 |
| 476 | Ga0495599_0304711 | 3300046678 | Bacteria | 961 |
| 477 | Ga0495623_0035123 | 3300046679 | Bacteria | 3213 |
| 478 | Ga0495646_0197122 | 3300046680 | Bacteria | 1098 |
| 479 | Ga0495670_0012637 | 3300046691 | Bacteria | 4153 |
| 480 | Ga0495670_0315938 | 3300046691 | Bacteria | 838 |
| 481 | Ga0495671_0186924 | 3300046692 | Bacteria | 1006 |
| 482 | Ga0495649_0001096 | 3300046694 | Bacteria | 21138 |
| 483 | Ga0495649_0011605 | 3300046694 | Bacteria | 5163 |
| 484 | Ga0495600_0055926 | 3300046809 | Bacteria | 2577 |
| 485 | Ga0495604_0127161 | 3300047317 | Bacteria | 1836 |
| 486 | Ga0495636_0049605 | 3300047318 | Bacteria | 1755 |
| 487 | Ga0495636_0122880 | 3300047318 | Bacteria | 1149 |
| 488 | Ga0495672_0000019 | 3300047320 | Bacteria | 448153 |
| 489 | Ga0495672_0010209 | 3300047320 | Bacteria | 6711 |
| 490 | Ga0495680_0307881 | 3300047322 | Bacteria | 1111 |
| 491 | Ga0495681_0002600 | 3300047470 | Bacteria | 12814 |
| 492 | Ga0495681_0093144 | 3300047470 | Bacteria | 1327 |
| 493 | Ga0496101_0025249 | 3300048904 | Bacteria | 4121 |
| 494 | Ga0496101_0655407 | 3300048904 | Bacteria | 829 |
| 495 | Ga0496102_0446357 | 3300048905 | Bacteria | 1214 |
| 496 | Ga0496102_0581823 | 3300048905 | Bacteria | 1042 |
| 497 | Ga0496102_0848208 | 3300048905 | Bacteria | 836 |
| 498 | Ga0496103_0120378 | 3300048906 | Bacteria | 1672 |
| 499 | Ga0496104_0046169 | 3300048907 | Bacteria | 4101 |
| 500 | Ga0496104_0292752 | 3300048907 | Bacteria | 1541 |
| 501 | Ga0496105_0001283 | 3300048908 | Bacteria | 17583 |
| 502 | Ga0496106_0037410 | 3300048909 | Bacteria | 3631 |
| 503 | Ga0496106_0106223 | 3300048909 | Bacteria | 2182 |
| 504 | Ga0496107_0146647 | 3300048910 | Bacteria | 1745 |
| 505 | Ga0496108_0261608 | 3300048911 | Bacteria | 1506 |
| 506 | Ga0496108_0405257 | 3300048911 | Bacteria | 1191 |
| 507 | Ga0496113_0006522 | 3300048916 | Bacteria | 7405 |
| 508 | Ga0496113_0449165 | 3300048916 | Bacteria | 1036 |
| 509 | Ga0496114_0207266 | 3300048917 | Bacteria | 1719 |
| 510 | Ga0496115_0000804 | 3300048918 | Bacteria | 23009 |
| 511 | Ga0496115_0004756 | 3300048918 | Bacteria | 9853 |
| 512 | Ga0496115_0007399 | 3300048918 | Bacteria | 8078 |
| 513 | Ga0496115_0265384 | 3300048918 | Bacteria | 1411 |
| 514 | Ga0496116_0000963 | 3300048919 | Bacteria | 35538 |
| 515 | Ga0496117_0000600 | 3300048920 | Bacteria | 59074 |
| 516 | Ga0496117_0000873 | 3300048920 | Bacteria | 46528 |
| 517 | Ga0496117_0023471 | 3300048920 | Bacteria | 4913 |
| 518 | Ga0496117_0055735 | 3300048920 | Bacteria | 2759 |
| 519 | Ga0496118_0004285 | 3300048921 | Bacteria | 17067 |
| 520 | Ga0496118_0010232 | 3300048921 | Bacteria | 9310 |
| 521 | Ga0496118_0034179 | 3300048921 | Bacteria | 4154 |
| 522 | Ga0496118_0049197 | 3300048921 | Bacteria | 3249 |
| 523 | Ga0496118_0054089 | 3300048921 | Bacteria | 3044 |
| 524 | Ga0496118_0118265 | 3300048921 | Bacteria | 1736 |
| 525 | Ga0496119_0000149 | 3300048922 | Bacteria | 97430 |
| 526 | Ga0496119_0008280 | 3300048922 | Bacteria | 9174 |
| 527 | Ga0496119_0253243 | 3300048922 | Bacteria | 887 |
| 528 | Ga0496120_0000841 | 3300048923 | Bacteria | 43682 |
| 529 | Ga0496120_0000982 | 3300048923 | Bacteria | 38803 |
| 530 | Ga0496120_0001845 | 3300048923 | Bacteria | 23584 |
| 531 | Ga0496121_0000124 | 3300048924 | Bacteria | 170427 |
| 532 | Ga0496121_0000173 | 3300048924 | Bacteria | 143397 |
| 533 | Ga0496121_0000542 | 3300048924 | Bacteria | 71767 |
| 534 | Ga0496121_0000543 | 3300048924 | Bacteria | 71696 |
| 535 | Ga0496121_0001793 | 3300048924 | Bacteria | 34696 |
| 536 | Ga0496121_0007834 | 3300048924 | Bacteria | 12776 |
| 537 | Ga0496121_0037774 | 3300048924 | Bacteria | 4284 |
| 538 | Ga0496121_0042695 | 3300048924 | Bacteria | 3939 |
| 539 | Ga0496121_0059126 | 3300048924 | Bacteria | 3162 |
| 540 | Ga0496121_0129175 | 3300048924 | Bacteria | 1895 |
| 541 | Ga0496121_0222469 | 3300048924 | Bacteria | 1328 |
| 542 | Ga0496122_0000316 | 3300048925 | Bacteria | 106100 |
| 543 | Ga0496122_0001658 | 3300048925 | Bacteria | 34572 |
| 544 | Ga0496122_0060307 | 3300048925 | Bacteria | 2795 |
| 545 | Ga0496123_0000297 | 3300048926 | Bacteria | 97340 |
| 546 | Ga0496123_0000891 | 3300048926 | Bacteria | 47218 |
| 547 | Ga0496124_0000022 | 3300048927 | Bacteria | 421020 |
| 548 | Ga0496124_0041712 | 3300048927 | Bacteria | 3957 |
| 549 | Ga0496124_0106993 | 3300048927 | Bacteria | 2257 |
| 550 | Ga0496124_0315709 | 3300048927 | Bacteria | 1121 |
| 551 | Ga0496125_0000116 | 3300048928 | Bacteria | 180492 |
| 552 | Ga0496125_0000251 | 3300048928 | Bacteria | 110300 |
| 553 | Ga0496125_0004591 | 3300048928 | Bacteria | 15786 |
| 554 | Ga0496125_0114148 | 3300048928 | Bacteria | 1946 |
| 555 | Ga0496125_0469959 | 3300048928 | Bacteria | 715 |
| 556 | Ga0496126_0000259 | 3300048929 | Bacteria | 113443 |
| 557 | Ga0496126_0018569 | 3300048929 | Bacteria | 6885 |
| 558 | Ga0496126_0019718 | 3300048929 | Bacteria | 6636 |
| 559 | Ga0496126_0028900 | 3300048929 | Bacteria | 5274 |
| 560 | Ga0496126_0032547 | 3300048929 | Bacteria | 4911 |
| 561 | Ga0496126_0047418 | 3300048929 | Bacteria | 3933 |
| 562 | Ga0496126_0054167 | 3300048929 | Bacteria | 3635 |
| 563 | Ga0496126_0112122 | 3300048929 | Bacteria | 2375 |
| 564 | Ga0496126_0120884 | 3300048929 | Bacteria | 2271 |
| 565 | Ga0496126_0172737 | 3300048929 | Bacteria | 1840 |
| 566 | Ga0496126_0338248 | 3300048929 | Bacteria | 1233 |
| 567 | Ga0496126_0564237 | 3300048929 | Bacteria | 901 |
| 568 | Ga0495678_025175 | 3300049459 | Bacteria | 2560 |
| 569 | Ga0495678_039654 | 3300049459 | Bacteria | 1898 |
| 570 | Ga0501031_0044965 | 3300049568 | Bacteria | 2881 |
| 571 | Ga0501031_0244118 | 3300049568 | Bacteria | 1167 |
| 572 | Ga0501032_0051473 | 3300049569 | Bacteria | 2777 |
| 573 | Ga0501032_0074725 | 3300049569 | Bacteria | 2258 |
| 574 | Ga0501033_0001220 | 3300049570 | Bacteria | 23082 |
| 575 | Ga0501033_0029198 | 3300049570 | Bacteria | 4144 |
| 576 | Ga0501033_0318287 | 3300049570 | Bacteria | 1093 |
| 577 | Ga0501034_0069489 | 3300049571 | Bacteria | 3533 |
| 578 | Ga0501034_0132424 | 3300049571 | Bacteria | 2476 |
| 579 | Ga0501036_0029254 | 3300049572 | Bacteria | 4657 |
| 580 | Ga0501036_0047624 | 3300049572 | Bacteria | 3630 |
| 581 | Ga0501036_0186666 | 3300049572 | Bacteria | 1745 |
| 582 | Ga0501037_0109328 | 3300049573 | Bacteria | 1992 |
| 583 | Ga0501037_0359594 | 3300049573 | Bacteria | 1003 |
| 584 | Ga0501041_0052101 | 3300049577 | Bacteria | 2495 |
| 585 | Ga0501042_0004920 | 3300049578 | Bacteria | 8554 |
| 586 | Ga0501043_0025057 | 3300049579 | Bacteria | 4680 |
| 587 | Ga0501043_0118681 | 3300049579 | Bacteria | 2074 |
| 588 | Ga0501043_0275619 | 3300049579 | Bacteria | 1290 |
| 589 | Ga0501046_0006258 | 3300049580 | Bacteria | 10560 |
| 590 | Ga0501046_0320072 | 3300049580 | Bacteria | 1130 |
| 591 | Ga0501047_0032550 | 3300049581 | Bacteria | 5033 |
| 592 | Ga0501047_0041671 | 3300049581 | Bacteria | 4436 |
| 593 | Ga0501047_0091049 | 3300049581 | Bacteria | 2927 |
| 594 | Ga0501047_0288352 | 3300049581 | Bacteria | 1485 |
| 595 | Ga0501047_0416996 | 3300049581 | Bacteria | 1174 |
| 596 | Ga0501047_0711528 | 3300049581 | Bacteria | 821 |
| 597 | Ga0501070_0287040 | 3300049586 | Bacteria | 1342 |
| 598 | Ga0501070_0386492 | 3300049586 | Bacteria | 1133 |
| 599 | Ga0501071_0101632 | 3300049587 | Bacteria | 2119 |
| 600 | Ga0501075_0269397 | 3300049591 | Bacteria | 1298 |
| 601 | Ga0501076_0339609 | 3300049592 | Bacteria | 1232 |
| 602 | Ga0501076_0471865 | 3300049592 | Bacteria | 1034 |
| 603 | Ga0501076_0672753 | 3300049592 | Bacteria | 854 |
| 604 | Ga0501081_0134808 | 3300049743 | Bacteria | 1767 |
| 605 | Ga0501083_0145130 | 3300049744 | Bacteria | 1554 |
| 606 | Ga0501035_0058713 | 3300049822 | Bacteria | 3427 |
| 607 | Ga0501035_0129494 | 3300049822 | Bacteria | 2201 |
| 608 | Ga0501035_0272381 | 3300049822 | Bacteria | 1432 |
| 609 | Ga0501035_0338672 | 3300049822 | Bacteria | 1261 |
| 610 | Ga0501044_0116589 | 3300049823 | Bacteria | 2676 |
| 611 | Ga0501044_0128698 | 3300049823 | Bacteria | 2527 |
| 612 | Ga0501044_0238399 | 3300049823 | Bacteria | 1763 |
| 613 | Ga0501044_0240696 | 3300049823 | Bacteria | 1753 |
| 614 | Ga0501045_0187853 | 3300049824 | Bacteria | 1540 |
| 615 | nmdc:mga05p37_105884_c1 | 3300050507 | Bacteria | 3459 |
| 616 | nmdc:mga09592_224349_c1 | 3300050508 | Bacteria | 1628 |
| 617 | nmdc:mga0qj67_757989_c1 | 3300050509 | Bacteria | 770 |
| 618 | nmdc:mga06r32_105824_c1 | 3300050510 | Bacteria | 2764 |
| 619 | nmdc:mga08y16_381559_c1 | 3300050511 | Bacteria | 1444 |
| 620 | nmdc:mga0n895_144431_c1 | 3300050512 | Bacteria | 2409 |
| 621 | nmdc:mga0n895_220793_c1 | 3300050512 | Bacteria | 1924 |
| 622 | nmdc:mga0n895_59314_c1 | 3300050512 | Bacteria | 3775 |
| 623 | nmdc:mga0n895_8703_c1 | 3300050512 | Bacteria | 8817 |
| 624 | nmdc:mga0rr50_23915_c1 | 3300050513 | Bacteria | 4225 |
| 625 | nmdc:mga0rr50_86922_c1 | 3300050513 | Bacteria | 2426 |
| 626 | nmdc:mga08x19_19639_c1 | 3300050514 | Bacteria | 4150 |
| 627 | nmdc:mga0a205_389547_c1 | 3300050515 | Bacteria | 1258 |
| 628 | nmdc:mga0a205_432957_c1 | 3300050515 | Bacteria | 1177 |
| 629 | nmdc:mga0a205_84048_c1 | 3300050515 | Bacteria | 3074 |
| 630 | Ga0495601_0048292 | 3300053077 | Bacteria | 2680 |
| 631 | Ga0495601_0161324 | 3300053077 | Bacteria | 1465 |
| 632 | Ga0500610_0000245 | 3300053079 | Bacteria | 16309 |
| 633 | Ga0500635_0003989 | 3300053080 | Bacteria | 3763 |
| 634 | Ga0495595_0076997 | 3300053084 | Bacteria | 1584 |
| 635 | Ga0500643_000013 | 3300053087 | Bacteria | 324296 |
| 636 | Ga0500643_000907 | 3300053087 | Bacteria | 18763 |
| 637 | Ga0500643_019636 | 3300053087 | Bacteria | 2221 |
| 638 | Ga0500566_0195178 | 3300053094 | Bacteria | 1027 |
| 639 | Ga0500604_0008443 | 3300053151 | Bacteria | 2733 |
| 640 | Ga0500616_0000048 | 3300053153 | Bacteria | 313108 |
| 641 | Ga0500637_0001497 | 3300053178 | Bacteria | 9953 |
| 642 | Ga0500637_0268437 | 3300053178 | Bacteria | 944 |
| 643 | Ga0500552_016032 | 3300053733 | Bacteria | 1009 |
| 644 | Ga0501084_0021045 | 3300054114 | Bacteria | 5441 |
| 645 | Ga0501082_0001081 | 3300060353 | Bacteria | 24111 |
| 646 | Ga0466962_0000351 | 3300061719 | Bacteria | 19774 |
| 647 | Ga0466962_0001452 | 3300061719 | Bacteria | 11063 |
| 648 | Ga0466962_0002771 | 3300061719 | Bacteria | 8326 |
| 649 | Ga0530510_0691989 | 3300061734 | Bacteria | 777 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300028558 | Ga0265326_10013291 | Ga0265326_100132912 | 204 |
| 2 | 3300028563 | Ga0265319_1011525 | Ga0265319_10115252 | 204 |
| 3 | 3300028573 | Ga0265334_10001994 | Ga0265334_100019946 | 204 |
| 4 | 3300031235 | Ga0265330_10004251 | Ga0265330_100042516 | 204 |
| 5 | 3300031238 | Ga0265332_10043191 | Ga0265332_100431912 | 204 |
| 6 | 3300031239 | Ga0265328_10061264 | Ga0265328_100612642 | 204 |
| 7 | 3300031240 | Ga0265320_10022663 | Ga0265320_100226631 | 204 |
| 8 | 3300031241 | Ga0265325_10018315 | Ga0265325_100183154 | 204 |
| 9 | 3300031242 | Ga0265329_10008609 | Ga0265329_100086094 | 204 |
| 10 | 3300031249 | Ga0265339_10013095 | Ga0265339_100130953 | 204 |
| 11 | 3300031250 | Ga0265331_10027740 | Ga0265331_100277402 | 204 |
| 12 | 3300031344 | Ga0265316_10114149 | Ga0265316_101141492 | 204 |
| 13 | 3300031595 | Ga0265313_10005711 | Ga0265313_100057118 | 204 |
| 14 | 3300031711 | Ga0265314_10015115 | Ga0265314_100151156 | 204 |
| 15 | 3300031712 | Ga0265342_10024197 | Ga0265342_100241972 | 204 |
| 16 | 3300049822 | Ga0501035_0338672 | Ga0501035_0338672_90_767 | 209 |
| 17 | 3300005577 | Ga0068857_100002222 | Ga0068857_10000222210 | 211 |
| 18 | 3300039450 | Ga0436363_0611592 | Ga0436363_0611592_39_692 | 214 |
| 19 | 3300046460 | Ga0495638_0011430 | Ga0495638_0011430_2165_2857 | 218 |
| 20 | 3300046501 | Ga0495607_0001801 | Ga0495607_0001801_3337_4029 | 218 |
| 21 | 3300046506 | Ga0495583_0007868 | Ga0495583_0007868_3808_4500 | 218 |
| 22 | 3300046538 | Ga0495609_0000202 | Ga0495609_0000202_38430_39122 | 218 |
| 23 | 3300046616 | Ga0495668_0012539 | Ga0495668_0012539_3419_4111 | 218 |
| 24 | 3300046665 | Ga0495661_0080411 | Ga0495661_0080411_852_1544 | 218 |
| 25 | 3300046692 | Ga0495671_0186924 | Ga0495671_0186924_66_758 | 218 |
| 26 | 3300046694 | Ga0495649_0011605 | Ga0495649_0011605_3922_4614 | 218 |
| 27 | 3300047318 | Ga0495636_0049605 | Ga0495636_0049605_797_1489 | 218 |
| 28 | 3300047470 | Ga0495681_0002600 | Ga0495681_0002600_10542_11234 | 218 |
| 29 | 3300048928 | Ga0496125_0469959 | Ga0496125_0469959_27_686 | 219 |
| 30 | 3300003215 | JGI25153J46596_10001253 | JGI25153J46596_100012533 | 223 |
| 31 | 3300025272 | Ga0209455_1010211 | Ga0209455_10102113 | 223 |
| 32 | 3300025297 | Ga0209758_1000185 | Ga0209758_1000185129 | 223 |
| 33 | iso_pu_bacteria | 2990265787 | 2990268738 | 225 |
| 34 | iso_pu_bacteria | 2993693658 | 2993694555 | 225 |
| 35 | 3300048920 | Ga0496117_0000600 | Ga0496117_0000600_19154_19840 | 226 |
| 36 | iso_pu_bacteria | 2842698319 | 2842702324 | 226 |
| 37 | iso_pu_bacteria | 2842780639 | 2842783061 | 226 |
| 38 | iso_pu_bacteria | 8055225921 | 8055227416 | 226 |
| 39 | 3300002705 | JGI25156J39149_1000479 | JGI25156J39149_10004797 | 227 |
| 40 | 3300002705 | JGI25156J39149_1020802 | JGI25156J39149_10208022 | 227 |
| 41 | 3300002737 | JGI25162J39368_1002475 | JGI25162J39368_10024751 | 227 |
| 42 | 3300002737 | JGI25162J39368_1003297 | JGI25162J39368_10032974 | 227 |
| 43 | 3300002737 | JGI25162J39368_1003914 | JGI25162J39368_10039143 | 227 |
| 44 | 3300002741 | JGI25157J39369_1000483 | JGI25157J39369_10004838 | 227 |
| 45 | 3300002741 | JGI25157J39369_1003426 | JGI25157J39369_10034264 | 227 |
| 46 | 3300002772 | JGI25164J39214_1000270 | JGI25164J39214_10002705 | 227 |
| 47 | 3300003214 | JGI25165J46597_1000487 | JGI25165J46597_100048735 | 227 |
| 48 | 3300003756 | Ga0055533_1001842 | Ga0055533_10018422 | 227 |
| 49 | 3300003759 | Ga0055525_1000030 | Ga0055525_100003045 | 227 |
| 50 | 3300003760 | Ga0055527_1000113 | Ga0055527_10001136 | 227 |
| 51 | 3300003760 | Ga0055527_1000142 | Ga0055527_100014245 | 227 |
| 52 | 3300003760 | Ga0055527_1000290 | Ga0055527_100029025 | 227 |
| 53 | 3300003760 | Ga0055527_1000341 | Ga0055527_100034113 | 227 |
| 54 | 3300003761 | Ga0055535_1000160 | Ga0055535_100016027 | 227 |
| 55 | 3300003761 | Ga0055535_1000257 | Ga0055535_100025752 | 227 |
| 56 | 3300003761 | Ga0055535_1001127 | Ga0055535_10011275 | 227 |
| 57 | 3300003761 | Ga0055535_1001465 | Ga0055535_10014656 | 227 |
| 58 | 3300003762 | Ga0055542_1000128 | Ga0055542_100012845 | 227 |
| 59 | 3300003762 | Ga0055542_1000294 | Ga0055542_100029452 | 227 |
| 60 | 3300003762 | Ga0055542_1000413 | Ga0055542_100041336 | 227 |
| 61 | 3300003762 | Ga0055542_1000776 | Ga0055542_100077620 | 227 |
| 62 | 3300003763 | Ga0055529_1000295 | Ga0055529_10002956 | 227 |
| 63 | 3300003763 | Ga0055529_1000429 | Ga0055529_10004296 | 227 |
| 64 | 3300003763 | Ga0055529_1000573 | Ga0055529_10005738 | 227 |
| 65 | 3300003763 | Ga0055529_1000754 | Ga0055529_100075415 | 227 |
| 66 | 3300005614 | Ga0068856_100001892 | Ga0068856_1000018923 | 227 |
| 67 | 3300025226 | Ga0209674_100111 | Ga0209674_10011134 | 227 |
| 68 | 3300025228 | Ga0209672_100004 | Ga0209672_100004158 | 227 |
| 69 | 3300025228 | Ga0209672_100008 | Ga0209672_100008124 | 227 |
| 70 | 3300025228 | Ga0209672_100229 | Ga0209672_1002296 | 227 |
| 71 | 3300025228 | Ga0209672_101094 | Ga0209672_10109411 | 227 |
| 72 | 3300025230 | Ga0209563_100028 | Ga0209563_100028221 | 227 |
| 73 | 3300025231 | Ga0207427_100252 | Ga0207427_10025235 | 227 |
| 74 | 3300025233 | Ga0209437_100391 | Ga0209437_1003916 | 227 |
| 75 | 3300025242 | Ga0209258_100003 | Ga0209258_100003158 | 227 |
| 76 | 3300025242 | Ga0209258_100004 | Ga0209258_1000041066 | 227 |
| 77 | 3300025242 | Ga0209258_100008 | Ga0209258_100008691 | 227 |
| 78 | 3300025242 | Ga0209258_100217 | Ga0209258_10021762 | 227 |
| 79 | 3300025242 | Ga0209258_100757 | Ga0209258_1007576 | 227 |
| 80 | 3300025246 | Ga0209646_1001082 | Ga0209646_10010821 | 227 |
| 81 | 3300025250 | Ga0209026_1000088 | Ga0209026_100008835 | 227 |
| 82 | 3300025250 | Ga0209026_1000578 | Ga0209026_10005789 | 227 |
| 83 | 3300025253 | Ga0209677_103999 | Ga0209677_1039993 | 227 |
| 84 | 3300025254 | Ga0209148_1000016 | Ga0209148_1000016158 | 227 |
| 85 | 3300025254 | Ga0209148_1000041 | Ga0209148_1000041193 | 227 |
| 86 | 3300025254 | Ga0209148_1000197 | Ga0209148_100019761 | 227 |
| 87 | 3300025254 | Ga0209148_1000473 | Ga0209148_10004736 | 227 |
| 88 | 3300025256 | Ga0209759_1000489 | Ga0209759_100048910 | 227 |
| 89 | 3300025256 | Ga0209759_1001276 | Ga0209759_10012764 | 227 |
| 90 | 3300025261 | Ga0209233_1000357 | Ga0209233_100035735 | 227 |
| 91 | 3300025272 | Ga0209455_1000004 | Ga0209455_1000004158 | 227 |
| 92 | 3300025272 | Ga0209455_1000007 | Ga0209455_1000007811 | 227 |
| 93 | 3300025272 | Ga0209455_1000356 | Ga0209455_10003566 | 227 |
| 94 | 3300025272 | Ga0209455_1005236 | Ga0209455_10052365 | 227 |
| 95 | 3300026078 | Ga0207702_10001234 | Ga0207702_1000123418 | 227 |
| 96 | 3300031711 | Ga0265314_10000144 | Ga0265314_1000014472 | 227 |
| 97 | 3300037312 | Ga0395899_0000057 | Ga0395899_0000057_197670_198356 | 227 |
| 98 | 3300037312 | Ga0395899_0002577 | Ga0395899_0002577_5777_6463 | 227 |
| 99 | 3300037418 | Ga0395900_0000035 | Ga0395900_0000035_215452_216162 | 227 |
| 100 | 3300037466 | Ga0395898_0000150 | Ga0395898_0000150_37905_38591 | 227 |
| 101 | 3300038443 | Ga0395901_0472064 | Ga0395901_0472064_136_822 | 227 |
| 102 | 3300041452 | Ga0451793_1763305 | Ga0451793_1763305_850_1539 | 227 |
| 103 | 3300044656 | Ga0466969_0005093 | Ga0466969_0005093_4288_4998 | 227 |
| 104 | 3300044661 | Ga0466975_0136558 | Ga0466975_0136558_17_727 | 227 |
| 105 | 3300044663 | Ga0466989_0015645 | Ga0466989_0015645_554_1240 | 227 |
| 106 | 3300044684 | Ga0466966_0028116 | Ga0466966_0028116_1026_1712 | 227 |
| 107 | 3300044684 | Ga0466966_0034284 | Ga0466966_0034284_2382_3092 | 227 |
| 108 | 3300044693 | Ga0466961_0000592 | Ga0466961_0000592_8799_9485 | 227 |
| 109 | 3300044693 | Ga0466961_0001406 | Ga0466961_0001406_10647_11333 | 227 |
| 110 | 3300044693 | Ga0466961_0003804 | Ga0466961_0003804_8676_9386 | 227 |
| 111 | 3300044694 | Ga0466963_0060932 | Ga0466963_0060932_802_1488 | 227 |
| 112 | 3300044694 | Ga0466963_0123603 | Ga0466963_0123603_962_1648 | 227 |
| 113 | 3300044765 | Ga0466970_0000413 | Ga0466970_0000413_16595_17281 | 227 |
| 114 | 3300044765 | Ga0466970_0010903 | Ga0466970_0010903_2916_3626 | 227 |
| 115 | 3300044765 | Ga0466970_0161903 | Ga0466970_0161903_305_991 | 227 |
| 116 | 3300044842 | Ga0466957_0000599 | Ga0466957_0000599_5457_6143 | 227 |
| 117 | 3300044842 | Ga0466957_0053446 | Ga0466957_0053446_100_927 | 227 |
| 118 | 3300045049 | Ga0466959_0000038 | Ga0466959_0000038_71452_72162 | 227 |
| 119 | 3300045049 | Ga0466959_0014309 | Ga0466959_0014309_1079_1906 | 227 |
| 120 | 3300045049 | Ga0466959_0030035 | Ga0466959_0030035_2892_3578 | 227 |
| 121 | 3300045049 | Ga0466959_0031645 | Ga0466959_0031645_2479_3165 | 227 |
| 122 | 3300045836 | Ga0466958_0009749 | Ga0466958_0009749_3866_4552 | 227 |
| 123 | 3300045836 | Ga0466958_0022342 | Ga0466958_0022342_392_1078 | 227 |
| 124 | 3300045836 | Ga0466958_0076958 | Ga0466958_0076958_1093_1920 | 227 |
| 125 | 3300045976 | Ga0466967_0189060 | Ga0466967_0189060_533_1219 | 227 |
| 126 | 3300046460 | Ga0495638_0000085 | Ga0495638_0000085_88853_89542 | 227 |
| 127 | 3300046537 | Ga0495598_0035793 | Ga0495598_0035793_506_1189 | 227 |
| 128 | 3300049569 | Ga0501032_0051473 | Ga0501032_0051473_2011_2697 | 227 |
| 129 | 3300049570 | Ga0501033_0029198 | Ga0501033_0029198_1771_2457 | 227 |
| 130 | 3300049571 | Ga0501034_0069489 | Ga0501034_0069489_1429_2115 | 227 |
| 131 | 3300049572 | Ga0501036_0186666 | Ga0501036_0186666_584_1270 | 227 |
| 132 | 3300049579 | Ga0501043_0025057 | Ga0501043_0025057_369_1055 | 227 |
| 133 | 3300049581 | Ga0501047_0041671 | Ga0501047_0041671_316_1002 | 227 |
| 134 | 3300049586 | Ga0501070_0386492 | Ga0501070_0386492_400_1086 | 227 |
| 135 | 3300049822 | Ga0501035_0272381 | Ga0501035_0272381_312_998 | 227 |
| 136 | 3300049823 | Ga0501044_0128698 | Ga0501044_0128698_1283_1969 | 227 |
| 137 | 3300061719 | Ga0466962_0001452 | Ga0466962_0001452_5485_6312 | 227 |
| 138 | 3300061719 | Ga0466962_0002771 | Ga0466962_0002771_4926_5612 | 227 |
| 139 | iso_pu_bacteria | 2513237087 | 2513590549 | 227 |
| 140 | iso_pu_bacteria | 2739367700 | 2739733807 | 227 |
| 141 | iso_pu_bacteria | 2884411467 | 2884415545 | 227 |
| 142 | iso_pu_bacteria | 2887375801 | 2887377438 | 227 |
| 143 | iso_pu_bacteria | 2928963466 | 2928967080 | 227 |
| 144 | iso_pu_bacteria | 2946787523 | 2946787927 | 227 |
| 145 | iso_pu_bacteria | 643348564 | 643599387 | 227 |
| 146 | 3300005336 | Ga0070680_100197455 | Ga0070680_1001974551 | 228 |
| 147 | 3300005435 | Ga0070714_100004122 | Ga0070714_1000041227 | 228 |
| 148 | 3300005436 | Ga0070713_100042543 | Ga0070713_1000425432 | 228 |
| 149 | 3300005439 | Ga0070711_100073428 | Ga0070711_1000734282 | 228 |
| 150 | 3300005530 | Ga0070679_100030406 | Ga0070679_1000304063 | 228 |
| 151 | 3300005614 | Ga0068856_100297394 | Ga0068856_1002973942 | 228 |
| 152 | 3300006173 | Ga0070716_100125424 | Ga0070716_1001254242 | 228 |
| 153 | 3300025928 | Ga0207700_10264391 | Ga0207700_102643912 | 228 |
| 154 | 3300025929 | Ga0207664_10032883 | Ga0207664_100328832 | 228 |
| 155 | 3300036647 | Ga0316582_0024616 | Ga0316582_0024616_2650_3336 | 228 |
| 156 | 3300039438 | Ga0436360_0448261 | Ga0436360_0448261_608_1294 | 228 |
| 157 | 3300048904 | Ga0496101_0655407 | Ga0496101_0655407_132_818 | 228 |
| 158 | 3300048911 | Ga0496108_0261608 | Ga0496108_0261608_805_1491 | 228 |
| 159 | 3300050513 | nmdc:mga0rr50_86922_c1 | nmdc:mga0rr50_86922_c1_588_1274 | 228 |
| 160 | iso_pu_bacteria | 2599185292 | 2599907086 | 228 |
| 161 | iso_pu_bacteria | 2643221569 | 2643863292 | 228 |
| 162 | iso_pu_bacteria | 2643221594 | 2643978693 | 228 |
| 163 | iso_pu_bacteria | 2643221621 | 2644125132 | 228 |
| 164 | iso_pu_bacteria | 2643221651 | 2644289788 | 228 |
| 165 | iso_pu_bacteria | 2808606395 | 2809036550 | 228 |
| 166 | iso_pu_bacteria | 2857537821 | 2857541259 | 228 |
| 167 | iso_pu_bacteria | 2858950400 | 2858950423 | 228 |
| 168 | iso_pu_bacteria | 2941479691 | 2941481138 | 228 |
| 169 | 3300005436 | Ga0070713_100277959 | Ga0070713_1002779592 | 229 |
| 170 | 3300005445 | Ga0070708_100135184 | Ga0070708_1001351842 | 229 |
| 171 | 3300005468 | Ga0070707_100230363 | Ga0070707_1002303632 | 229 |
| 172 | 3300005471 | Ga0070698_100050031 | Ga0070698_1000500314 | 229 |
| 173 | 3300005518 | Ga0070699_100073941 | Ga0070699_1000739412 | 229 |
| 174 | 3300005536 | Ga0070697_100298218 | Ga0070697_1002982181 | 229 |
| 175 | 3300006173 | Ga0070716_100184583 | Ga0070716_1001845832 | 229 |
| 176 | 3300009093 | Ga0105240_10829593 | Ga0105240_108295931 | 229 |
| 177 | 3300009147 | Ga0114129_10126778 | Ga0114129_101267784 | 229 |
| 178 | 3300010375 | Ga0105239_10000061 | Ga0105239_10000061109 | 229 |
| 179 | 3300025910 | Ga0207684_10274831 | Ga0207684_102748312 | 229 |
| 180 | 3300025913 | Ga0207695_10199978 | Ga0207695_101999782 | 229 |
| 181 | 3300025922 | Ga0207646_10036118 | Ga0207646_100361182 | 229 |
| 182 | 3300025928 | Ga0207700_10261112 | Ga0207700_102611122 | 229 |
| 183 | 3300025939 | Ga0207665_10103521 | Ga0207665_101035212 | 229 |
| 184 | 3300028381 | Ga0268264_10700146 | Ga0268264_107001462 | 229 |
| 185 | 3300037471 | Ga0395905_0002061 | Ga0395905_0002061_12784_13473 | 229 |
| 186 | 3300048921 | Ga0496118_0049197 | Ga0496118_0049197_1143_1835 | 229 |
| 187 | 3300048924 | Ga0496121_0000173 | Ga0496121_0000173_34829_35521 | 229 |
| 188 | 3300048924 | Ga0496121_0129175 | Ga0496121_0129175_1181_1873 | 229 |
| 189 | 3300048929 | Ga0496126_0019718 | Ga0496126_0019718_106_798 | 229 |
| 190 | 3300050507 | nmdc:mga05p37_105884_c1 | nmdc:mga05p37_105884_c1_1317_2012 | 229 |
| 191 | 3300050512 | nmdc:mga0n895_59314_c1 | nmdc:mga0n895_59314_c1_848_1543 | 229 |
| 192 | iso_pu_bacteria | 2511231221 | 2512036416 | 229 |
| 193 | iso_pu_bacteria | 2595698237 | 2596377029 | 229 |
| 194 | iso_pu_bacteria | 2738541281 | 2738746443 | 229 |
| 195 | iso_pu_bacteria | 2738543032 | 2739355673 | 229 |
| 196 | iso_pu_bacteria | 2829745981 | 2829749506 | 229 |
| 197 | iso_pu_bacteria | 2861691609 | 2861693658 | 229 |
| 198 | iso_pu_bacteria | 2889306138 | 2889308323 | 229 |
| 199 | iso_pu_bacteria | 2897803580 | 2897807484 | 229 |
| 200 | iso_pu_bacteria | 2902330777 | 2902334699 | 229 |
| 201 | iso_pu_bacteria | 2902405164 | 2902405744 | 229 |
| 202 | iso_pu_bacteria | 2928125067 | 2928125094 | 229 |
| 203 | iso_pu_bacteria | 8054002106 | 8054003091 | 229 |
| 204 | 3300005435 | Ga0070714_100012973 | Ga0070714_1000129733 | 230 |
| 205 | 3300009177 | Ga0105248_10163778 | Ga0105248_101637782 | 230 |
| 206 | 3300009545 | Ga0105237_10537236 | Ga0105237_105372362 | 230 |
| 207 | 3300028379 | Ga0268266_10489735 | Ga0268266_104897351 | 230 |
| 208 | 3300046501 | Ga0495607_0041643 | Ga0495607_0041643_661_1356 | 230 |
| 209 | 3300046507 | Ga0495606_0042688 | Ga0495606_0042688_81_776 | 230 |
| 210 | 3300046513 | Ga0495616_0140170 | Ga0495616_0140170_329_1024 | 230 |
| 211 | 3300046519 | Ga0495632_0140243 | Ga0495632_0140243_196_891 | 230 |
| 212 | 3300046615 | Ga0495656_0012426 | Ga0495656_0012426_342_1034 | 230 |
| 213 | 3300046691 | Ga0495670_0315938 | Ga0495670_0315938_32_724 | 230 |
| 214 | 3300047318 | Ga0495636_0122880 | Ga0495636_0122880_116_808 | 230 |
| 215 | 3300047470 | Ga0495681_0093144 | Ga0495681_0093144_531_1226 | 230 |
| 216 | 3300048918 | Ga0496115_0265384 | Ga0496115_0265384_389_1105 | 230 |
| 217 | 3300048927 | Ga0496124_0000022 | Ga0496124_0000022_113533_114225 | 230 |
| 218 | 3300053087 | Ga0500643_019636 | Ga0500643_019636_856_1551 | 230 |
| 219 | 3300053178 | Ga0500637_0001497 | Ga0500637_0001497_8763_9476 | 230 |
| 220 | 3300001990 | JGI24737J22298_10005705 | JGI24737J22298_100057053 | 231 |
| 221 | 3300002705 | JGI25156J39149_1008700 | JGI25156J39149_10087001 | 231 |
| 222 | 3300002737 | JGI25162J39368_1001129 | JGI25162J39368_100112912 | 231 |
| 223 | 3300002737 | JGI25162J39368_1002121 | JGI25162J39368_10021212 | 231 |
| 224 | 3300002741 | JGI25157J39369_1000584 | JGI25157J39369_10005843 | 231 |
| 225 | 3300002771 | JGI25163J39215_1000647 | JGI25163J39215_10006471 | 231 |
| 226 | 3300002772 | JGI25164J39214_1000428 | JGI25164J39214_10004283 | 231 |
| 227 | 3300003214 | JGI25165J46597_1000832 | JGI25165J46597_10008322 | 231 |
| 228 | 3300003215 | JGI25153J46596_10009999 | JGI25153J46596_100099992 | 231 |
| 229 | 3300003322 | rootL2_10007589 | rootL2_100075892 | 231 |
| 230 | 3300003756 | Ga0055533_1000439 | Ga0055533_100043913 | 231 |
| 231 | 3300003759 | Ga0055525_1000306 | Ga0055525_100030631 | 231 |
| 232 | 3300003760 | Ga0055527_1000060 | Ga0055527_100006051 | 231 |
| 233 | 3300003761 | Ga0055535_1000412 | Ga0055535_100041231 | 231 |
| 234 | 3300003761 | Ga0055535_1000907 | Ga0055535_10009073 | 231 |
| 235 | 3300003762 | Ga0055542_1000171 | Ga0055542_100017138 | 231 |
| 236 | 3300003762 | Ga0055542_1001114 | Ga0055542_100111412 | 231 |
| 237 | 3300003762 | Ga0055542_1001281 | Ga0055542_100128110 | 231 |
| 238 | 3300003763 | Ga0055529_1000388 | Ga0055529_100038829 | 231 |
| 239 | 3300003763 | Ga0055529_1000752 | Ga0055529_10007523 | 231 |
| 240 | 3300005328 | Ga0070676_10108474 | Ga0070676_101084742 | 231 |
| 241 | 3300005330 | Ga0070690_100012375 | Ga0070690_1000123753 | 231 |
| 242 | 3300005336 | Ga0070680_100184429 | Ga0070680_1001844292 | 231 |
| 243 | 3300005336 | Ga0070680_100197460 | Ga0070680_1001974603 | 231 |
| 244 | 3300005339 | Ga0070660_100218849 | Ga0070660_1002188492 | 231 |
| 245 | 3300005340 | Ga0070689_100001554 | Ga0070689_1000015542 | 231 |
| 246 | 3300005353 | Ga0070669_100237250 | Ga0070669_1002372502 | 231 |
| 247 | 3300005354 | Ga0070675_100050457 | Ga0070675_1000504572 | 231 |
| 248 | 3300005364 | Ga0070673_100101216 | Ga0070673_1001012162 | 231 |
| 249 | 3300005366 | Ga0070659_100073529 | Ga0070659_1000735292 | 231 |
| 250 | 3300005436 | Ga0070713_100324765 | Ga0070713_1003247652 | 231 |
| 251 | 3300005439 | Ga0070711_100236284 | Ga0070711_1002362842 | 231 |
| 252 | 3300005445 | Ga0070708_100009962 | Ga0070708_1000099624 | 231 |
| 253 | 3300005455 | Ga0070663_100028585 | Ga0070663_1000285852 | 231 |
| 254 | 3300005455 | Ga0070663_100075221 | Ga0070663_1000752213 | 231 |
| 255 | 3300005455 | Ga0070663_100102607 | Ga0070663_1001026072 | 231 |
| 256 | 3300005457 | Ga0070662_100355077 | Ga0070662_1003550771 | 231 |
| 257 | 3300005458 | Ga0070681_10035542 | Ga0070681_100355424 | 231 |
| 258 | 3300005458 | Ga0070681_10139023 | Ga0070681_101390233 | 231 |
| 259 | 3300005458 | Ga0070681_10157745 | Ga0070681_101577455 | 231 |
| 260 | 3300005466 | Ga0070685_10027920 | Ga0070685_100279204 | 231 |
| 261 | 3300005468 | Ga0070707_100017177 | Ga0070707_1000171772 | 231 |
| 262 | 3300005530 | Ga0070679_100017201 | Ga0070679_1000172013 | 231 |
| 263 | 3300005530 | Ga0070679_100330913 | Ga0070679_1003309131 | 231 |
| 264 | 3300005536 | Ga0070697_100133026 | Ga0070697_1001330263 | 231 |
| 265 | 3300005539 | Ga0068853_100337729 | Ga0068853_1003377292 | 231 |
| 266 | 3300005563 | Ga0068855_100020179 | Ga0068855_1000201792 | 231 |
| 267 | 3300005563 | Ga0068855_100108896 | Ga0068855_1001088962 | 231 |
| 268 | 3300005563 | Ga0068855_100142567 | Ga0068855_1001425673 | 231 |
| 269 | 3300005578 | Ga0068854_100002653 | Ga0068854_1000026537 | 231 |
| 270 | 3300005578 | Ga0068854_100015938 | Ga0068854_1000159385 | 231 |
| 271 | 3300005615 | Ga0070702_100253162 | Ga0070702_1002531622 | 231 |
| 272 | 3300005616 | Ga0068852_100137729 | Ga0068852_1001377292 | 231 |
| 273 | 3300005834 | Ga0068851_10000936 | Ga0068851_100009367 | 231 |
| 274 | 3300005842 | Ga0068858_100698750 | Ga0068858_1006987502 | 231 |
| 275 | 3300005937 | Ga0081455_10150107 | Ga0081455_101501072 | 231 |
| 276 | 3300006175 | Ga0070712_100230697 | Ga0070712_1002306971 | 231 |
| 277 | 3300006847 | Ga0075431_100019988 | Ga0075431_1000199888 | 231 |
| 278 | 3300006852 | Ga0075433_10265919 | Ga0075433_102659192 | 231 |
| 279 | 3300006871 | Ga0075434_100005412 | Ga0075434_1000054127 | 231 |
| 280 | 3300006871 | Ga0075434_100058711 | Ga0075434_1000587113 | 231 |
| 281 | 3300007076 | Ga0075435_100199657 | Ga0075435_1001996572 | 231 |
| 282 | 3300009093 | Ga0105240_10045931 | Ga0105240_100459313 | 231 |
| 283 | 3300009093 | Ga0105240_10054121 | Ga0105240_100541215 | 231 |
| 284 | 3300009093 | Ga0105240_10074999 | Ga0105240_100749994 | 231 |
| 285 | 3300009147 | Ga0114129_10576911 | Ga0114129_105769113 | 231 |
| 286 | 3300009545 | Ga0105237_10000112 | Ga0105237_1000011288 | 231 |
| 287 | 3300009545 | Ga0105237_10093677 | Ga0105237_100936773 | 231 |
| 288 | 3300009551 | Ga0105238_10097305 | Ga0105238_100973054 | 231 |
| 289 | 3300009551 | Ga0105238_10196312 | Ga0105238_101963122 | 231 |
| 290 | 3300009982 | Ga0105147_107285 | Ga0105147_1072851 | 231 |
| 291 | 3300010375 | Ga0105239_10117019 | Ga0105239_101170193 | 231 |
| 292 | 3300012500 | Ga0157314_1000010 | Ga0157314_100001016 | 231 |
| 293 | 3300013100 | Ga0157373_10182862 | Ga0157373_101828621 | 231 |
| 294 | 3300013105 | Ga0157369_10117285 | Ga0157369_101172853 | 231 |
| 295 | 3300013306 | Ga0163162_10060208 | Ga0163162_100602083 | 231 |
| 296 | 3300014745 | Ga0157377_10253111 | Ga0157377_102531112 | 231 |
| 297 | 3300014969 | Ga0157376_10098462 | Ga0157376_100984622 | 231 |
| 298 | 3300015262 | Ga0182007_10069049 | Ga0182007_100690491 | 231 |
| 299 | 3300015687 | Ga0183368_1002 | Ga0183368_10021537 | 231 |
| 300 | 3300021361 | Ga0213872_10002401 | Ga0213872_1000240111 | 231 |
| 301 | 3300021361 | Ga0213872_10029959 | Ga0213872_100299592 | 231 |
| 302 | 3300021361 | Ga0213872_10104153 | Ga0213872_101041531 | 231 |
| 303 | 3300022734 | Ga0224571_105624 | Ga0224571_1056241 | 231 |
| 304 | 3300025206 | Ga0209435_102319 | Ga0209435_1023192 | 231 |
| 305 | 3300025206 | Ga0209435_108715 | Ga0209435_1087151 | 231 |
| 306 | 3300025207 | Ga0209760_100718 | Ga0209760_1007183 | 231 |
| 307 | 3300025224 | Ga0209784_100074 | Ga0209784_10007437 | 231 |
| 308 | 3300025225 | Ga0209566_102088 | Ga0209566_1020883 | 231 |
| 309 | 3300025226 | Ga0209674_100068 | Ga0209674_100068112 | 231 |
| 310 | 3300025228 | Ga0209672_100043 | Ga0209672_100043165 | 231 |
| 311 | 3300025228 | Ga0209672_103526 | Ga0209672_1035262 | 231 |
| 312 | 3300025230 | Ga0209563_100062 | Ga0209563_100062156 | 231 |
| 313 | 3300025231 | Ga0207427_100079 | Ga0207427_1000793 | 231 |
| 314 | 3300025231 | Ga0207427_101437 | Ga0207427_1014377 | 231 |
| 315 | 3300025233 | Ga0209437_100163 | Ga0209437_1001633 | 231 |
| 316 | 3300025233 | Ga0209437_100379 | Ga0209437_10037934 | 231 |
| 317 | 3300025233 | Ga0209437_103389 | Ga0209437_1033892 | 231 |
| 318 | 3300025242 | Ga0209258_100076 | Ga0209258_100076165 | 231 |
| 319 | 3300025242 | Ga0209258_100671 | Ga0209258_10067117 | 231 |
| 320 | 3300025242 | Ga0209258_101469 | Ga0209258_1014694 | 231 |
| 321 | 3300025242 | Ga0209258_102547 | Ga0209258_1025472 | 231 |
| 322 | 3300025246 | Ga0209646_1002310 | Ga0209646_10023104 | 231 |
| 323 | 3300025246 | Ga0209646_1006223 | Ga0209646_10062231 | 231 |
| 324 | 3300025250 | Ga0209026_1000109 | Ga0209026_1000109135 | 231 |
| 325 | 3300025250 | Ga0209026_1001248 | Ga0209026_10012487 | 231 |
| 326 | 3300025254 | Ga0209148_1000001 | Ga0209148_1000001135 | 231 |
| 327 | 3300025254 | Ga0209148_1000002 | Ga0209148_1000002124 | 231 |
| 328 | 3300025254 | Ga0209148_1000082 | Ga0209148_1000082165 | 231 |
| 329 | 3300025256 | Ga0209759_1000441 | Ga0209759_100044137 | 231 |
| 330 | 3300025256 | Ga0209759_1008589 | Ga0209759_10085891 | 231 |
| 331 | 3300025258 | Ga0209129_1000696 | Ga0209129_100069613 | 231 |
| 332 | 3300025261 | Ga0209233_1000002 | Ga0209233_10000022096 | 231 |
| 333 | 3300025261 | Ga0209233_1028130 | Ga0209233_10281301 | 231 |
| 334 | 3300025272 | Ga0209455_1000078 | Ga0209455_1000078165 | 231 |
| 335 | 3300025272 | Ga0209455_1000079 | Ga0209455_1000079216 | 231 |
| 336 | 3300025272 | Ga0209455_1014346 | Ga0209455_10143462 | 231 |
| 337 | 3300025297 | Ga0209758_1000726 | Ga0209758_100072638 | 231 |
| 338 | 3300025297 | Ga0209758_1011013 | Ga0209758_10110135 | 231 |
| 339 | 3300025321 | Ga0207656_10021530 | Ga0207656_100215302 | 231 |
| 340 | 3300025904 | Ga0207647_10040567 | Ga0207647_100405674 | 231 |
| 341 | 3300025912 | Ga0207707_10008510 | Ga0207707_100085105 | 231 |
| 342 | 3300025912 | Ga0207707_10316013 | Ga0207707_103160132 | 231 |
| 343 | 3300025913 | Ga0207695_10004175 | Ga0207695_100041755 | 231 |
| 344 | 3300025913 | Ga0207695_10017482 | Ga0207695_100174822 | 231 |
| 345 | 3300025913 | Ga0207695_10049748 | Ga0207695_100497484 | 231 |
| 346 | 3300025914 | Ga0207671_10000009 | Ga0207671_10000009125 | 231 |
| 347 | 3300025915 | Ga0207693_10336810 | Ga0207693_103368102 | 231 |
| 348 | 3300025917 | Ga0207660_10017740 | Ga0207660_100177401 | 231 |
| 349 | 3300025921 | Ga0207652_10018181 | Ga0207652_100181815 | 231 |
| 350 | 3300025921 | Ga0207652_10028627 | Ga0207652_100286271 | 231 |
| 351 | 3300025922 | Ga0207646_10006618 | Ga0207646_1000661811 | 231 |
| 352 | 3300025924 | Ga0207694_10033668 | Ga0207694_100336684 | 231 |
| 353 | 3300025926 | Ga0207659_10061379 | Ga0207659_100613793 | 231 |
| 354 | 3300025926 | Ga0207659_10464961 | Ga0207659_104649612 | 231 |
| 355 | 3300025933 | Ga0207706_10015120 | Ga0207706_100151204 | 231 |
| 356 | 3300025933 | Ga0207706_10043672 | Ga0207706_100436725 | 231 |
| 357 | 3300025936 | Ga0207670_10040837 | Ga0207670_100408374 | 231 |
| 358 | 3300025936 | Ga0207670_10236785 | Ga0207670_102367852 | 231 |
| 359 | 3300025939 | Ga0207665_10146425 | Ga0207665_101464252 | 231 |
| 360 | 3300025939 | Ga0207665_10568814 | Ga0207665_105688142 | 231 |
| 361 | 3300025949 | Ga0207667_10001194 | Ga0207667_100011945 | 231 |
| 362 | 3300025949 | Ga0207667_10002016 | Ga0207667_1000201617 | 231 |
| 363 | 3300025949 | Ga0207667_10320992 | Ga0207667_103209922 | 231 |
| 364 | 3300025981 | Ga0207640_10001472 | Ga0207640_100014727 | 231 |
| 365 | 3300025981 | Ga0207640_10015593 | Ga0207640_100155934 | 231 |
| 366 | 3300026067 | Ga0207678_10049073 | Ga0207678_100490733 | 231 |
| 367 | 3300026067 | Ga0207678_10050297 | Ga0207678_100502972 | 231 |
| 368 | 3300026067 | Ga0207678_10090238 | Ga0207678_100902382 | 231 |
| 369 | 3300026116 | Ga0207674_10000145 | Ga0207674_100001457 | 231 |
| 370 | 3300026142 | Ga0207698_10005538 | Ga0207698_100055383 | 231 |
| 371 | 3300026142 | Ga0207698_10202622 | Ga0207698_102026221 | 231 |
| 372 | 3300027907 | Ga0207428_10050882 | Ga0207428_100508823 | 231 |
| 373 | 3300027907 | Ga0207428_10306359 | Ga0207428_103063591 | 231 |
| 374 | 3300028380 | Ga0268265_10085066 | Ga0268265_100850663 | 231 |
| 375 | 3300028381 | Ga0268264_10255248 | Ga0268264_102552481 | 231 |
| 376 | 3300028381 | Ga0268264_10718655 | Ga0268264_107186552 | 231 |
| 377 | 3300030760 | Ga0265762_1027671 | Ga0265762_10276711 | 231 |
| 378 | 3300030763 | Ga0265763_1000757 | Ga0265763_10007572 | 231 |
| 379 | 3300031090 | Ga0265760_10002084 | Ga0265760_100020842 | 231 |
| 380 | 3300031711 | Ga0265314_10008509 | Ga0265314_100085093 | 231 |
| 381 | 3300031995 | Ga0307409_100298389 | Ga0307409_1002983893 | 231 |
| 382 | 3300035091 | Ga0373951_0093135 | Ga0373951_0093135_53_775 | 231 |
| 383 | 3300035113 | Ga0373936_0039182 | Ga0373936_0039182_588_1283 | 231 |
| 384 | 3300035115 | Ga0373941_0041906 | Ga0373941_0041906_192_887 | 231 |
| 385 | 3300035410 | Ga0373924_0265187 | Ga0373924_0265187_15_713 | 231 |
| 386 | 3300035724 | Ga0373933_0452755 | Ga0373933_0452755_18_722 | 231 |
| 387 | 3300036401 | Ga0373937_0330237 | Ga0373937_0330237_74_772 | 231 |
| 388 | 3300036401 | Ga0373937_0546154 | Ga0373937_0546154_330_1034 | 231 |
| 389 | 3300039437 | Ga0436365_1638281 | Ga0436365_1638281_249_956 | 231 |
| 390 | 3300039437 | Ga0436365_1902360 | Ga0436365_1902360_107_814 | 231 |
| 391 | 3300039447 | Ga0436361_0049588 | Ga0436361_0049588_661_1371 | 231 |
| 392 | 3300039447 | Ga0436361_0205650 | Ga0436361_0205650_203_910 | 231 |
| 393 | 3300039447 | Ga0436361_0472131 | Ga0436361_0472131_3693_4391 | 231 |
| 394 | 3300039447 | Ga0436361_1106151 | Ga0436361_1106151_1067_1762 | 231 |
| 395 | 3300044656 | Ga0466969_0132900 | Ga0466969_0132900_114_812 | 231 |
| 396 | 3300044658 | Ga0466972_0044091 | Ga0466972_0044091_70_768 | 231 |
| 397 | 3300044672 | Ga0466982_0000006 | Ga0466982_0000006_227934_228632 | 231 |
| 398 | 3300044683 | Ga0466965_0128484 | Ga0466965_0128484_160_858 | 231 |
| 399 | 3300044684 | Ga0466966_0001181 | Ga0466966_0001181_2051_2749 | 231 |
| 400 | 3300044706 | Ga0466964_0010610 | Ga0466964_0010610_2142_2840 | 231 |
| 401 | 3300044712 | Ga0453684_0175244 | Ga0453684_0175244_1586_2281 | 231 |
| 402 | 3300044765 | Ga0466970_0039366 | Ga0466970_0039366_1421_2119 | 231 |
| 403 | 3300044901 | Ga0466960_0042067 | Ga0466960_0042067_1115_1813 | 231 |
| 404 | 3300045049 | Ga0466959_0388619 | Ga0466959_0388619_166_864 | 231 |
| 405 | 3300045051 | Ga0451576_0208489 | Ga0451576_0208489_78_773 | 231 |
| 406 | 3300045976 | Ga0466967_0176951 | Ga0466967_0176951_1109_1807 | 231 |
| 407 | 3300046460 | Ga0495638_0000541 | Ga0495638_0000541_17305_18003 | 231 |
| 408 | 3300046460 | Ga0495638_0001761 | Ga0495638_0001761_8199_8897 | 231 |
| 409 | 3300046471 | Ga0495650_0000333 | Ga0495650_0000333_25397_26095 | 231 |
| 410 | 3300046501 | Ga0495607_0022701 | Ga0495607_0022701_2195_2890 | 231 |
| 411 | 3300046507 | Ga0495606_0000746 | Ga0495606_0000746_46844_47542 | 231 |
| 412 | 3300046536 | Ga0495587_0042600 | Ga0495587_0042600_116_814 | 231 |
| 413 | 3300046542 | Ga0495597_0043110 | Ga0495597_0043110_694_1392 | 231 |
| 414 | 3300046557 | Ga0495622_0015305 | Ga0495622_0015305_1281_1979 | 231 |
| 415 | 3300046660 | Ga0495625_0024884 | Ga0495625_0024884_1587_2285 | 231 |
| 416 | 3300046660 | Ga0495625_0122986 | Ga0495625_0122986_956_1654 | 231 |
| 417 | 3300046678 | Ga0495599_0304711 | Ga0495599_0304711_227_931 | 231 |
| 418 | 3300046694 | Ga0495649_0001096 | Ga0495649_0001096_14145_14843 | 231 |
| 419 | 3300047320 | Ga0495672_0000019 | Ga0495672_0000019_395306_396016 | 231 |
| 420 | 3300048905 | Ga0496102_0848208 | Ga0496102_0848208_48_743 | 231 |
| 421 | 3300048907 | Ga0496104_0292752 | Ga0496104_0292752_752_1450 | 231 |
| 422 | 3300048911 | Ga0496108_0405257 | Ga0496108_0405257_373_1068 | 231 |
| 423 | 3300048916 | Ga0496113_0006522 | Ga0496113_0006522_2436_3134 | 231 |
| 424 | 3300048917 | Ga0496114_0207266 | Ga0496114_0207266_622_1320 | 231 |
| 425 | 3300048918 | Ga0496115_0000804 | Ga0496115_0000804_15323_16021 | 231 |
| 426 | 3300048918 | Ga0496115_0004756 | Ga0496115_0004756_6229_6927 | 231 |
| 427 | 3300048928 | Ga0496125_0000251 | Ga0496125_0000251_28431_29129 | 231 |
| 428 | 3300048929 | Ga0496126_0032547 | Ga0496126_0032547_1517_2215 | 231 |
| 429 | 3300048929 | Ga0496126_0338248 | Ga0496126_0338248_59_757 | 231 |
| 430 | 3300049459 | Ga0495678_025175 | Ga0495678_025175_1152_1862 | 231 |
| 431 | 3300049459 | Ga0495678_039654 | Ga0495678_039654_589_1287 | 231 |
| 432 | 3300049580 | Ga0501046_0006258 | Ga0501046_0006258_4544_5278 | 231 |
| 433 | 3300049581 | Ga0501047_0288352 | Ga0501047_0288352_131_865 | 231 |
| 434 | 3300050509 | nmdc:mga0qj67_757989_c1 | nmdc:mga0qj67_757989_c1_28_723 | 231 |
| 435 | 3300050512 | nmdc:mga0n895_220793_c1 | nmdc:mga0n895_220793_c1_767_1468 | 231 |
| 436 | 3300050512 | nmdc:mga0n895_8703_c1 | nmdc:mga0n895_8703_c1_5807_6502 | 231 |
| 437 | 3300053077 | Ga0495601_0161324 | Ga0495601_0161324_130_828 | 231 |
| 438 | 3300060353 | Ga0501082_0001081 | Ga0501082_0001081_8024_8758 | 231 |
| 439 | 3300061719 | Ga0466962_0000351 | Ga0466962_0000351_5618_6316 | 231 |
| 440 | 3300061734 | Ga0530510_0691989 | Ga0530510_0691989_51_746 | 231 |
| 441 | iso_pu_bacteria | 2643221609 | 2644060220 | 231 |
| 442 | iso_pu_bacteria | 2643221611 | 2644076017 | 231 |
| 443 | 3300005295 | Ga0065707_10100611 | Ga0065707_101006112 | 232 |
| 444 | 3300005364 | Ga0070673_100163402 | Ga0070673_1001634022 | 232 |
| 445 | 3300005434 | Ga0070709_10214040 | Ga0070709_102140402 | 232 |
| 446 | 3300005435 | Ga0070714_100171241 | Ga0070714_1001712412 | 232 |
| 447 | 3300005436 | Ga0070713_100001562 | Ga0070713_1000015624 | 232 |
| 448 | 3300005536 | Ga0070697_100419715 | Ga0070697_1004197152 | 232 |
| 449 | 3300005547 | Ga0070693_100012025 | Ga0070693_1000120255 | 232 |
| 450 | 3300005842 | Ga0068858_100144312 | Ga0068858_1001443122 | 232 |
| 451 | 3300006051 | Ga0075364_10035088 | Ga0075364_100350883 | 232 |
| 452 | 3300006186 | Ga0075369_10030921 | Ga0075369_100309212 | 232 |
| 453 | 3300006195 | Ga0075366_10003143 | Ga0075366_100031432 | 232 |
| 454 | 3300006237 | Ga0097621_100024293 | Ga0097621_1000242933 | 232 |
| 455 | 3300006358 | Ga0068871_100007696 | Ga0068871_1000076967 | 232 |
| 456 | 3300006847 | Ga0075431_100042754 | Ga0075431_1000427543 | 232 |
| 457 | 3300006852 | Ga0075433_10395832 | Ga0075433_103958322 | 232 |
| 458 | 3300006871 | Ga0075434_100009536 | Ga0075434_1000095362 | 232 |
| 459 | 3300006880 | Ga0075429_100115587 | Ga0075429_1001155871 | 232 |
| 460 | 3300006914 | Ga0075436_100005990 | Ga0075436_1000059906 | 232 |
| 461 | 3300009011 | Ga0105251_10002726 | Ga0105251_1000272612 | 232 |
| 462 | 3300009036 | Ga0105244_10080285 | Ga0105244_100802852 | 232 |
| 463 | 3300009093 | Ga0105240_10031713 | Ga0105240_100317133 | 232 |
| 464 | 3300009098 | Ga0105245_10111298 | Ga0105245_101112982 | 232 |
| 465 | 3300009147 | Ga0114129_10058975 | Ga0114129_100589754 | 232 |
| 466 | 3300009147 | Ga0114129_10533595 | Ga0114129_105335952 | 232 |
| 467 | 3300009148 | Ga0105243_10125125 | Ga0105243_101251253 | 232 |
| 468 | 3300009176 | Ga0105242_10017145 | Ga0105242_100171455 | 232 |
| 469 | 3300009176 | Ga0105242_10143183 | Ga0105242_101431832 | 232 |
| 470 | 3300009176 | Ga0105242_10349991 | Ga0105242_103499912 | 232 |
| 471 | 3300009177 | Ga0105248_10092018 | Ga0105248_100920185 | 232 |
| 472 | 3300009177 | Ga0105248_10457848 | Ga0105248_104578483 | 232 |
| 473 | 3300009553 | Ga0105249_10252758 | Ga0105249_102527583 | 232 |
| 474 | 3300013297 | Ga0157378_10052337 | Ga0157378_100523375 | 232 |
| 475 | 3300013306 | Ga0163162_10051973 | Ga0163162_100519732 | 232 |
| 476 | 3300013307 | Ga0157372_10002320 | Ga0157372_1000232010 | 232 |
| 477 | 3300013308 | Ga0157375_11194103 | Ga0157375_111941031 | 232 |
| 478 | 3300014326 | Ga0157380_10008810 | Ga0157380_100088108 | 232 |
| 479 | 3300014326 | Ga0157380_10053656 | Ga0157380_100536563 | 232 |
| 480 | 3300025292 | Ga0209676_1017627 | Ga0209676_10176272 | 232 |
| 481 | 3300025298 | Ga0209050_1002993 | Ga0209050_10029934 | 232 |
| 482 | 3300025728 | Ga0207655_1011838 | Ga0207655_10118382 | 232 |
| 483 | 3300025728 | Ga0207655_1055154 | Ga0207655_10551542 | 232 |
| 484 | 3300025735 | Ga0207713_1000078 | Ga0207713_100007828 | 232 |
| 485 | 3300025906 | Ga0207699_10114972 | Ga0207699_101149722 | 232 |
| 486 | 3300025909 | Ga0207705_10033478 | Ga0207705_100334783 | 232 |
| 487 | 3300025909 | Ga0207705_10069160 | Ga0207705_100691602 | 232 |
| 488 | 3300025913 | Ga0207695_10069643 | Ga0207695_100696432 | 232 |
| 489 | 3300025918 | Ga0207662_10101193 | Ga0207662_101011931 | 232 |
| 490 | 3300025918 | Ga0207662_10187892 | Ga0207662_101878922 | 232 |
| 491 | 3300025922 | Ga0207646_10409019 | Ga0207646_104090191 | 232 |
| 492 | 3300025928 | Ga0207700_10311770 | Ga0207700_103117702 | 232 |
| 493 | 3300025934 | Ga0207686_10137772 | Ga0207686_101377722 | 232 |
| 494 | 3300025934 | Ga0207686_10145005 | Ga0207686_101450052 | 232 |
| 495 | 3300025942 | Ga0207689_10218151 | Ga0207689_102181512 | 232 |
| 496 | 3300025960 | Ga0207651_10212591 | Ga0207651_102125912 | 232 |
| 497 | 3300025981 | Ga0207640_10472812 | Ga0207640_104728122 | 232 |
| 498 | 3300026035 | Ga0207703_10010532 | Ga0207703_100105327 | 232 |
| 499 | 3300027907 | Ga0207428_10150156 | Ga0207428_101501562 | 232 |
| 500 | 3300027907 | Ga0207428_10152719 | Ga0207428_101527192 | 232 |
| 501 | 3300031911 | Ga0307412_10001318 | Ga0307412_100013182 | 232 |
| 502 | 3300036401 | Ga0373937_0016031 | Ga0373937_0016031_1274_2008 | 232 |
| 503 | 3300037312 | Ga0395899_0179696 | Ga0395899_0179696_759_1466 | 232 |
| 504 | 3300037418 | Ga0395900_0124721 | Ga0395900_0124721_539_1270 | 232 |
| 505 | 3300038443 | Ga0395901_0015566 | Ga0395901_0015566_4906_5637 | 232 |
| 506 | 3300046453 | Ga0495627_002096 | Ga0495627_002096_4368_5078 | 232 |
| 507 | 3300046454 | Ga0495592_0070495 | Ga0495592_0070495_851_1585 | 232 |
| 508 | 3300046458 | Ga0495591_000755 | Ga0495591_000755_4950_5660 | 232 |
| 509 | 3300046462 | Ga0495651_0064916 | Ga0495651_0064916_1397_2131 | 232 |
| 510 | 3300046477 | Ga0495664_0029070 | Ga0495664_0029070_1567_2307 | 232 |
| 511 | 3300046513 | Ga0495616_0000017 | Ga0495616_0000017_144907_145683 | 232 |
| 512 | 3300046516 | Ga0495628_0038088 | Ga0495628_0038088_1579_2313 | 232 |
| 513 | 3300046536 | Ga0495587_0005777 | Ga0495587_0005777_5143_5877 | 232 |
| 514 | 3300046543 | Ga0495645_0000615 | Ga0495645_0000615_771_1505 | 232 |
| 515 | 3300046559 | Ga0495667_0011017 | Ga0495667_0011017_2284_3018 | 232 |
| 516 | 3300046679 | Ga0495623_0035123 | Ga0495623_0035123_655_1389 | 232 |
| 517 | 3300046680 | Ga0495646_0197122 | Ga0495646_0197122_175_909 | 232 |
| 518 | 3300046691 | Ga0495670_0012637 | Ga0495670_0012637_3396_4106 | 232 |
| 519 | 3300046809 | Ga0495600_0055926 | Ga0495600_0055926_958_1692 | 232 |
| 520 | 3300047317 | Ga0495604_0127161 | Ga0495604_0127161_640_1341 | 232 |
| 521 | 3300047322 | Ga0495680_0307881 | Ga0495680_0307881_180_914 | 232 |
| 522 | 3300048916 | Ga0496113_0449165 | Ga0496113_0449165_153_863 | 232 |
| 523 | 3300048919 | Ga0496116_0000963 | Ga0496116_0000963_14861_15562 | 232 |
| 524 | 3300048920 | Ga0496117_0055735 | Ga0496117_0055735_628_1338 | 232 |
| 525 | 3300048921 | Ga0496118_0034179 | Ga0496118_0034179_2523_3224 | 232 |
| 526 | 3300048921 | Ga0496118_0118265 | Ga0496118_0118265_793_1503 | 232 |
| 527 | 3300048923 | Ga0496120_0001845 | Ga0496120_0001845_1683_2405 | 232 |
| 528 | 3300048924 | Ga0496121_0000124 | Ga0496121_0000124_49377_50078 | 232 |
| 529 | 3300048924 | Ga0496121_0001793 | Ga0496121_0001793_6506_7213 | 232 |
| 530 | 3300048924 | Ga0496121_0007834 | Ga0496121_0007834_3301_4011 | 232 |
| 531 | 3300048924 | Ga0496121_0222469 | Ga0496121_0222469_574_1275 | 232 |
| 532 | 3300048925 | Ga0496122_0000316 | Ga0496122_0000316_46168_46869 | 232 |
| 533 | 3300048925 | Ga0496122_0001658 | Ga0496122_0001658_11555_12265 | 232 |
| 534 | 3300048926 | Ga0496123_0000297 | Ga0496123_0000297_46168_46869 | 232 |
| 535 | 3300048926 | Ga0496123_0000891 | Ga0496123_0000891_19523_20233 | 232 |
| 536 | 3300048927 | Ga0496124_0106993 | Ga0496124_0106993_639_1340 | 232 |
| 537 | 3300048927 | Ga0496124_0315709 | Ga0496124_0315709_140_841 | 232 |
| 538 | 3300048928 | Ga0496125_0000116 | Ga0496125_0000116_1691_2392 | 232 |
| 539 | 3300048928 | Ga0496125_0004591 | Ga0496125_0004591_4121_4822 | 232 |
| 540 | 3300048928 | Ga0496125_0114148 | Ga0496125_0114148_71_772 | 232 |
| 541 | 3300048929 | Ga0496126_0018569 | Ga0496126_0018569_6153_6857 | 232 |
| 542 | 3300048929 | Ga0496126_0028900 | Ga0496126_0028900_1884_2585 | 232 |
| 543 | 3300048929 | Ga0496126_0047418 | Ga0496126_0047418_348_1079 | 232 |
| 544 | 3300048929 | Ga0496126_0564237 | Ga0496126_0564237_103_804 | 232 |
| 545 | 3300049568 | Ga0501031_0044965 | Ga0501031_0044965_515_1216 | 232 |
| 546 | 3300049568 | Ga0501031_0244118 | Ga0501031_0244118_27_737 | 232 |
| 547 | 3300049569 | Ga0501032_0074725 | Ga0501032_0074725_1252_1995 | 232 |
| 548 | 3300049570 | Ga0501033_0001220 | Ga0501033_0001220_5084_5785 | 232 |
| 549 | 3300049572 | Ga0501036_0047624 | Ga0501036_0047624_1684_2427 | 232 |
| 550 | 3300049573 | Ga0501037_0109328 | Ga0501037_0109328_794_1537 | 232 |
| 551 | 3300049573 | Ga0501037_0359594 | Ga0501037_0359594_176_877 | 232 |
| 552 | 3300049579 | Ga0501043_0118681 | Ga0501043_0118681_815_1516 | 232 |
| 553 | 3300049579 | Ga0501043_0275619 | Ga0501043_0275619_17_760 | 232 |
| 554 | 3300049580 | Ga0501046_0320072 | Ga0501046_0320072_136_837 | 232 |
| 555 | 3300049581 | Ga0501047_0091049 | Ga0501047_0091049_318_1019 | 232 |
| 556 | 3300049581 | Ga0501047_0711528 | Ga0501047_0711528_98_796 | 232 |
| 557 | 3300049586 | Ga0501070_0287040 | Ga0501070_0287040_625_1323 | 232 |
| 558 | 3300049591 | Ga0501075_0269397 | Ga0501075_0269397_379_1077 | 232 |
| 559 | 3300049592 | Ga0501076_0471865 | Ga0501076_0471865_200_898 | 232 |
| 560 | 3300049592 | Ga0501076_0672753 | Ga0501076_0672753_85_783 | 232 |
| 561 | 3300049743 | Ga0501081_0134808 | Ga0501081_0134808_179_877 | 232 |
| 562 | 3300049744 | Ga0501083_0145130 | Ga0501083_0145130_702_1445 | 232 |
| 563 | 3300049822 | Ga0501035_0058713 | Ga0501035_0058713_2498_3202 | 232 |
| 564 | 3300049823 | Ga0501044_0116589 | Ga0501044_0116589_1875_2576 | 232 |
| 565 | 3300049823 | Ga0501044_0238399 | Ga0501044_0238399_278_979 | 232 |
| 566 | 3300049823 | Ga0501044_0240696 | Ga0501044_0240696_543_1286 | 232 |
| 567 | 3300050510 | nmdc:mga06r32_105824_c1 | nmdc:mga06r32_105824_c1_2032_2736 | 232 |
| 568 | 3300050512 | nmdc:mga0n895_144431_c1 | nmdc:mga0n895_144431_c1_1270_2004 | 232 |
| 569 | 3300050513 | nmdc:mga0rr50_23915_c1 | nmdc:mga0rr50_23915_c1_271_1005 | 232 |
| 570 | 3300050514 | nmdc:mga08x19_19639_c1 | nmdc:mga08x19_19639_c1_3233_3967 | 232 |
| 571 | 3300050515 | nmdc:mga0a205_389547_c1 | nmdc:mga0a205_389547_c1_537_1238 | 232 |
| 572 | 3300050515 | nmdc:mga0a205_432957_c1 | nmdc:mga0a205_432957_c1_359_1093 | 232 |
| 573 | 3300050515 | nmdc:mga0a205_84048_c1 | nmdc:mga0a205_84048_c1_1499_2197 | 232 |
| 574 | 3300053077 | Ga0495601_0048292 | Ga0495601_0048292_428_1162 | 232 |
| 575 | 3300053079 | Ga0500610_0000245 | Ga0500610_0000245_5443_6198 | 232 |
| 576 | 3300053084 | Ga0495595_0076997 | Ga0495595_0076997_167_901 | 232 |
| 577 | 3300053087 | Ga0500643_000907 | Ga0500643_000907_5058_5777 | 232 |
| 578 | 3300053151 | Ga0500604_0008443 | Ga0500604_0008443_1301_2017 | 232 |
| 579 | 3300053153 | Ga0500616_0000048 | Ga0500616_0000048_193908_194609 | 232 |
| 580 | 3300003320 | rootH2_10006370 | rootH2_100063707 | 233 |
| 581 | 3300005355 | Ga0070671_100228133 | Ga0070671_1002281332 | 233 |
| 582 | 3300006051 | Ga0075364_10318975 | Ga0075364_103189752 | 233 |
| 583 | 3300009093 | Ga0105240_10000197 | Ga0105240_1000019714 | 233 |
| 584 | 3300009093 | Ga0105240_10000199 | Ga0105240_1000019912 | 233 |
| 585 | 3300010375 | Ga0105239_10000054 | Ga0105239_1000005480 | 233 |
| 586 | 3300025228 | Ga0209672_100416 | Ga0209672_1004164 | 233 |
| 587 | 3300025913 | Ga0207695_10000207 | Ga0207695_10000207106 | 233 |
| 588 | 3300025913 | Ga0207695_10000746 | Ga0207695_1000074619 | 233 |
| 589 | 3300025922 | Ga0207646_10411577 | Ga0207646_104115772 | 233 |
| 590 | 3300028379 | Ga0268266_10000002 | Ga0268266_100000022665 | 233 |
| 591 | 3300031903 | Ga0307407_10018217 | Ga0307407_100182173 | 233 |
| 592 | 3300037418 | Ga0395900_0285532 | Ga0395900_0285532_401_1246 | 233 |
| 593 | 3300037466 | Ga0395898_0731258 | Ga0395898_0731258_20_727 | 233 |
| 594 | 3300044735 | Ga0466968_0089163 | Ga0466968_0089163_186_893 | 233 |
| 595 | 3300045051 | Ga0451576_0001130 | Ga0451576_0001130_11215_11940 | 233 |
| 596 | 3300048904 | Ga0496101_0025249 | Ga0496101_0025249_1791_2495 | 233 |
| 597 | 3300048905 | Ga0496102_0446357 | Ga0496102_0446357_399_1103 | 233 |
| 598 | 3300048905 | Ga0496102_0581823 | Ga0496102_0581823_51_755 | 233 |
| 599 | 3300048906 | Ga0496103_0120378 | Ga0496103_0120378_792_1496 | 233 |
| 600 | 3300048907 | Ga0496104_0046169 | Ga0496104_0046169_2093_2797 | 233 |
| 601 | 3300048908 | Ga0496105_0001283 | Ga0496105_0001283_6847_7551 | 233 |
| 602 | 3300048909 | Ga0496106_0037410 | Ga0496106_0037410_1144_1848 | 233 |
| 603 | 3300048910 | Ga0496107_0146647 | Ga0496107_0146647_444_1148 | 233 |
| 604 | 3300048918 | Ga0496115_0007399 | Ga0496115_0007399_1707_2411 | 233 |
| 605 | 3300048920 | Ga0496117_0000873 | Ga0496117_0000873_10336_11040 | 233 |
| 606 | 3300048920 | Ga0496117_0023471 | Ga0496117_0023471_2502_3206 | 233 |
| 607 | 3300048921 | Ga0496118_0004285 | Ga0496118_0004285_12252_12956 | 233 |
| 608 | 3300048921 | Ga0496118_0010232 | Ga0496118_0010232_5961_6665 | 233 |
| 609 | 3300048922 | Ga0496119_0000149 | Ga0496119_0000149_86695_87399 | 233 |
| 610 | 3300048922 | Ga0496119_0008280 | Ga0496119_0008280_6541_7245 | 233 |
| 611 | 3300048923 | Ga0496120_0000841 | Ga0496120_0000841_22187_22891 | 233 |
| 612 | 3300048923 | Ga0496120_0000982 | Ga0496120_0000982_2419_3123 | 233 |
| 613 | 3300048924 | Ga0496121_0000542 | Ga0496121_0000542_24240_24941 | 233 |
| 614 | 3300048924 | Ga0496121_0000543 | Ga0496121_0000543_19170_19874 | 233 |
| 615 | 3300048924 | Ga0496121_0037774 | Ga0496121_0037774_3077_3781 | 233 |
| 616 | 3300048924 | Ga0496121_0059126 | Ga0496121_0059126_403_1107 | 233 |
| 617 | 3300048925 | Ga0496122_0060307 | Ga0496122_0060307_1181_1888 | 233 |
| 618 | 3300048929 | Ga0496126_0000259 | Ga0496126_0000259_13895_14599 | 233 |
| 619 | 3300048929 | Ga0496126_0054167 | Ga0496126_0054167_1322_2026 | 233 |
| 620 | 3300048929 | Ga0496126_0120884 | Ga0496126_0120884_430_1140 | 233 |
| 621 | 3300049570 | Ga0501033_0318287 | Ga0501033_0318287_48_758 | 233 |
| 622 | 3300049571 | Ga0501034_0132424 | Ga0501034_0132424_1373_2077 | 233 |
| 623 | 3300049572 | Ga0501036_0029254 | Ga0501036_0029254_1362_2072 | 233 |
| 624 | 3300049577 | Ga0501041_0052101 | Ga0501041_0052101_867_1577 | 233 |
| 625 | 3300049578 | Ga0501042_0004920 | Ga0501042_0004920_4891_5601 | 233 |
| 626 | 3300049581 | Ga0501047_0032550 | Ga0501047_0032550_3444_4148 | 233 |
| 627 | 3300049581 | Ga0501047_0416996 | Ga0501047_0416996_240_947 | 233 |
| 628 | 3300049587 | Ga0501071_0101632 | Ga0501071_0101632_1078_1788 | 233 |
| 629 | 3300049592 | Ga0501076_0339609 | Ga0501076_0339609_97_807 | 233 |
| 630 | 3300049822 | Ga0501035_0129494 | Ga0501035_0129494_550_1254 | 233 |
| 631 | 3300049824 | Ga0501045_0187853 | Ga0501045_0187853_625_1335 | 233 |
| 632 | 3300050511 | nmdc:mga08y16_381559_c1 | nmdc:mga08y16_381559_c1_556_1257 | 233 |
| 633 | 3300054114 | Ga0501084_0021045 | Ga0501084_0021045_1426_2136 | 233 |
| 634 | 3300006880 | Ga0075429_100228905 | Ga0075429_1002289052 | 234 |
| 635 | 3300050508 | nmdc:mga09592_224349_c1 | nmdc:mga09592_224349_c1_639_1349 | 234 |
| 636 | 3300001989 | JGI24739J22299_10017019 | JGI24739J22299_100170193 | 235 |
| 637 | 3300005434 | Ga0070709_10013558 | Ga0070709_100135584 | 235 |
| 638 | 3300005435 | Ga0070714_100028985 | Ga0070714_1000289851 | 235 |
| 639 | 3300005539 | Ga0068853_100110363 | Ga0068853_1001103633 | 235 |
| 640 | 3300005563 | Ga0068855_100042682 | Ga0068855_1000426823 | 235 |
| 641 | 3300005577 | Ga0068857_100056162 | Ga0068857_1000561623 | 235 |
| 642 | 3300005614 | Ga0068856_100069266 | Ga0068856_1000692663 | 235 |
| 643 | 3300005843 | Ga0068860_100000548 | Ga0068860_10000054825 | 235 |
| 644 | 3300006237 | Ga0097621_100090181 | Ga0097621_1000901812 | 235 |
| 645 | 3300009093 | Ga0105240_10107999 | Ga0105240_101079993 | 235 |
| 646 | 3300009101 | Ga0105247_10032660 | Ga0105247_100326601 | 235 |
| 647 | 3300009174 | Ga0105241_10133884 | Ga0105241_101338842 | 235 |
| 648 | 3300009545 | Ga0105237_10272967 | Ga0105237_102729672 | 235 |
| 649 | 3300011119 | Ga0105246_10009096 | Ga0105246_100090965 | 235 |
| 650 | 3300013105 | Ga0157369_10009042 | Ga0157369_1000904212 | 235 |
| 651 | 3300020077 | Ga0206351_10683695 | Ga0206351_106836952 | 235 |
| 652 | 3300025900 | Ga0207710_10015747 | Ga0207710_100157475 | 235 |
| 653 | 3300025904 | Ga0207647_10002237 | Ga0207647_100022373 | 235 |
| 654 | 3300025913 | Ga0207695_10247819 | Ga0207695_102478193 | 235 |
| 655 | 3300025924 | Ga0207694_10074422 | Ga0207694_100744223 | 235 |
| 656 | 3300025949 | Ga0207667_10096775 | Ga0207667_100967752 | 235 |
| 657 | 3300026041 | Ga0207639_10066797 | Ga0207639_100667971 | 235 |
| 658 | 3300026067 | Ga0207678_10060739 | Ga0207678_100607393 | 235 |
| 659 | 3300026078 | Ga0207702_10030769 | Ga0207702_100307693 | 235 |
| 660 | 3300026116 | Ga0207674_10004815 | Ga0207674_100048153 | 235 |
| 661 | 3300026142 | Ga0207698_10345082 | Ga0207698_103450821 | 235 |
| 662 | 3300030521 | Ga0307511_10055431 | Ga0307511_100554315 | 235 |
| 663 | 3300031616 | Ga0307508_10048633 | Ga0307508_100486331 | 235 |
| 664 | 3300031730 | Ga0307516_10085295 | Ga0307516_100852953 | 235 |
| 665 | 3300033179 | Ga0307507_10070636 | Ga0307507_100706363 | 235 |
| 666 | 3300035692 | Ga0373935_0030160 | Ga0373935_0030160_1775_2482 | 235 |
| 667 | 3300037068 | Ga0373925_0057500 | Ga0373925_0057500_412_1119 | 235 |
| 668 | 3300039437 | Ga0436365_0402584 | Ga0436365_0402584_163_870 | 235 |
| 669 | 3300039447 | Ga0436361_0211450 | Ga0436361_0211450_29_736 | 235 |
| 670 | 3300039450 | Ga0436363_0124313 | Ga0436363_0124313_713_1420 | 235 |
| 671 | 3300046557 | Ga0495622_0016634 | Ga0495622_0016634_217_924 | 235 |
| 672 | 3300047320 | Ga0495672_0010209 | Ga0495672_0010209_1067_1843 | 235 |
| 673 | 3300048909 | Ga0496106_0106223 | Ga0496106_0106223_735_1442 | 235 |
| 674 | 3300048921 | Ga0496118_0054089 | Ga0496118_0054089_1997_2704 | 235 |
| 675 | 3300048922 | Ga0496119_0253243 | Ga0496119_0253243_27_734 | 235 |
| 676 | 3300048924 | Ga0496121_0042695 | Ga0496121_0042695_2225_2932 | 235 |
| 677 | 3300048927 | Ga0496124_0041712 | Ga0496124_0041712_235_942 | 235 |
| 678 | 3300048929 | Ga0496126_0112122 | Ga0496126_0112122_318_1025 | 235 |
| 679 | 3300048929 | Ga0496126_0172737 | Ga0496126_0172737_213_920 | 235 |
| 680 | 3300053080 | Ga0500635_0003989 | Ga0500635_0003989_607_1314 | 235 |
| 681 | 3300053087 | Ga0500643_000013 | Ga0500643_000013_212520_213227 | 235 |
| 682 | 3300053094 | Ga0500566_0195178 | Ga0500566_0195178_113_820 | 235 |
| 683 | 3300053178 | Ga0500637_0268437 | Ga0500637_0268437_58_765 | 235 |
| 684 | 3300053733 | Ga0500552_016032 | Ga0500552_016032_107_814 | 235 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5hfk-assembly1.cif.gz_B | crystal structure of a glutathione s-transferase protein from escherichia coli och 157:h7 str. sakai (ecs3186, target efi-507414) with bound glutathione | 0.9905 | 1 | 203 |
| 3gx0-assembly1.cif.gz_A-2 | crystal structure of gsh-dependent disulfide bond oxidoreductase | 0.9862 | 1 | 202 |
| 4l8e-assembly1.cif.gz_A-2 | crystal structure of a glutathione transferase family member from xenorhabdus nematophila, target efi-507418, with two gsh per subunit | 0.9775 | 3 | 202 |
| 5hfk-assembly1.cif.gz_B | crystal structure of a glutathione s-transferase protein from escherichia coli och 157:h7 str. sakai (ecs3186, target efi-507414) with bound glutathione | 0.9762 | 1 | 203 |
| 6tah-assembly1.cif.gz_CAA | crystal structure of a nu-class glutathione-s-transferase from pseudomonas aeruginosa pacs2 bound to glutathione | 0.9739 | 1 | 201 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P77526_1_85_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9917 | 1 | 84 | 3.40.30.10 |
| af_P77526_93_209_1.20.1050.130 | Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; | 0.9907 | 94 | 207 | 1.20.1050.130 |
| 4l8eA01 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9888 | 3 | 86 | 3.40.30.10 |
| af_P77526_87_192_1.20.1050.10 | Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; | 0.9882 | 87 | 190 | 1.20.1050.10 |
| 4f0bB02 | Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; | 0.9825 | 93 | 195 | 1.20.1050.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q5PD99-F1-model_v4 | Thiol:disulfide oxidoreductase | 0.9982 | 76 | 208 |
|
| AF-A0A2A2TBE1-F1-model_v4 | Thiol:disulfide oxidoreductase | 0.9975 | 1 | 209 |
|
| AF-T1D8R9-F1-model_v4 | Glutathione S-transferase domain-containing protein | 0.9964 | 1 | 139 |
GO:0016740
|
| AF-A0A0S8AWI8-F1-model_v4 | Glutathione S-transferase | 0.9959 | 1 | 100 |
GO:0016740
|
| AF-A0A3M4YC52-F1-model_v4 | Glutathione S-transferase | 0.9954 | 1 | 210 |
GO:0016740
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar