F475067

General Info

Members Datasets Scaffolds Average Seq Length
684 356 649 233

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0285532|Ga0395900_0285532_401_1246
Length 281
Sequence VKRIGTLRRGILALVARRSIAAGSVLDRSAAPTHFPSAGGIAGHQPMIDLYYWPTPNGHKITMFLEEAGLPYRIHPVNIGKGEQFNPDFLKIAPNNRMPAIVDDEPTGGGAPVSLFESGAILLYLAEKTGRFIPADLRGRAEVLQWLFWQMGGLGPMLGQNHHFSQYAPEKIDYAIKRYVNETNRLYGVLDRRLADRAFVAGPDYSIADMACYPWIVPWEKQGQNLDHHPNLKRWFTAIAERPATKAAYARAPEVNPDHGKTMSEEAKKVMFGQTANSTKR

Samples

Sample ID Description Type Environment
1 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
2 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
3 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
4 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
5 2643221569 Achromobacter sp. Root565 Isolate Unclassified
6 2643221594 Achromobacter sp. Root170 Isolate Unclassified
7 2643221609 Acidovorax sp. Root217 Isolate Unclassified
8 2643221611 Acidovorax sp. Root219 Isolate Unclassified
9 2643221621 Achromobacter sp. Root83 Isolate Unclassified
10 2643221651 Afipia sp. Root123D2 Isolate Unclassified
11 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
12 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
13 2739367700 Dyella sp. YR388 Isolate Unclassified
14 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
15 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
16 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
17 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
18 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
19 2858950400 Achromobacter sp. K91 Isolate Unclassified
20 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
21 2884411467 Dyella sp. AD56 Isolate Rhizosphere
22 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
23 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
24 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
25 2902330777 Methylobacterium sp. 2A Isolate Unclassified
26 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
27 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
28 2928963466 Dyella japonica 1073 Isolate Unclassified
29 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
30 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
31 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
32 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
33 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
34 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
35 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
36 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
37 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
38 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
39 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
40 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
41 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
42 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
43 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
44 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
45 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
46 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
47 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
48 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
49 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
50 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
51 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
52 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
53 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
54 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
55 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
56 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
57 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
58 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
59 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
60 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
61 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
62 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
63 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
64 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
65 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
66 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
67 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
68 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
69 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
70 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
71 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
72 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
73 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
74 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
75 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
76 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
77 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
78 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
79 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
80 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
81 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
82 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
83 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
84 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
85 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
86 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
87 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
88 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
89 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
90 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
91 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
93 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
94 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
95 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
96 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
97 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
98 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
99 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
100 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
101 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
102 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
103 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
104 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
106 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
107 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
108 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
109 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
110 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
111 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
112 3300009982 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG Metagenome Rhizosphere
113 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
114 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
115 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
116 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
117 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
118 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
119 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
120 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
121 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
122 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
123 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
124 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
125 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
126 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
127 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
129 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
130 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
131 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
132 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
138 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
139 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
141 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
142 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
145 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
146 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
147 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
150 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
186 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
190 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
191 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
192 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
193 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
197 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
198 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
199 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
200 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
201 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
202 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
203 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
204 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
205 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
206 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
207 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
208 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
209 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
210 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
211 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
212 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
213 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
214 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
215 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
216 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
217 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
218 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
219 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
220 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
221 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
222 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
223 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
224 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
225 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
226 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
227 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
228 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
229 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
230 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
231 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
232 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
233 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
234 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
235 3300044661 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COC2E Metagenome Unclassified
236 3300044663 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E_TR Metagenome Unclassified
237 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
238 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
239 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
240 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
241 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
242 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
243 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
244 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
245 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
246 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
247 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
248 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
249 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
250 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
251 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
252 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
253 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
254 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
255 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
256 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
257 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
258 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
259 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
260 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
261 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
262 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
263 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
264 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
265 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
266 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
267 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
268 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
269 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
270 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
271 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
272 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
273 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
274 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
275 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
276 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
277 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
278 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
279 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
280 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
281 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
282 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
283 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
284 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
285 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
286 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
287 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
288 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
289 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
290 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
291 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
292 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
293 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
294 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
295 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
296 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
297 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
298 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
299 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
300 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
301 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
302 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
303 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
304 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
305 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
306 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
307 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
308 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
309 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
310 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
311 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
312 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
313 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
314 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
315 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
316 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
319 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
320 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
321 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
322 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
323 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
324 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
325 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
326 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
327 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
328 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
329 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
330 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
331 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
332 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
333 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
334 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
335 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
336 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
337 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
338 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
339 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
340 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
341 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
342 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
343 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
344 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
345 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
346 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
347 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
348 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
349 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
350 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
351 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
352 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
353 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
354 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
355 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
356 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.3
Metatranscriptomes 0.58
Isolates 5.12

Biome Distribution

Category Percentage (%)
Aerial Root 0.29
Bulb 0
Endosphere 16.08
Nodule 0.29
Rhizoplane 3.36
Rhizosphere 64.04
Stem 0
Stem Tuber 0
Unclassified 15.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10017019 3300001989 Bacteria 2627
2 JGI24737J22298_10005705 3300001990 Bacteria 4284
3 JGI25156J39149_1000479 3300002705 Bacteria 24065
4 JGI25156J39149_1008700 3300002705 Bacteria 2531
5 JGI25156J39149_1020802 3300002705 Bacteria 1146
6 JGI25162J39368_1001129 3300002737 Bacteria 16058
7 JGI25162J39368_1002121 3300002737 Bacteria 8425
8 JGI25162J39368_1002475 3300002737 Bacteria 7128
9 JGI25162J39368_1003297 3300002737 Bacteria 4857
10 JGI25162J39368_1003914 3300002737 Bacteria 3842
11 JGI25157J39369_1000483 3300002741 Bacteria 24992
12 JGI25157J39369_1000584 3300002741 Bacteria 21537
13 JGI25157J39369_1003426 3300002741 Bacteria 3255
14 JGI25163J39215_1000647 3300002771 Bacteria 9418
15 JGI25164J39214_1000270 3300002772 Bacteria 38473
16 JGI25164J39214_1000428 3300002772 Bacteria 23332
17 JGI25165J46597_1000487 3300003214 Bacteria 38473
18 JGI25165J46597_1000832 3300003214 Bacteria 22947
19 JGI25153J46596_10001253 3300003215 Bacteria 15280
20 JGI25153J46596_10009999 3300003215 Bacteria 4334
21 rootH2_10006370 3300003320 Bacteria 27393
22 rootL2_10007589 3300003322 Bacteria 2869
23 Ga0055533_1000439 3300003756 Bacteria 15819
24 Ga0055533_1001842 3300003756 Bacteria 5307
25 Ga0055525_1000030 3300003759 Bacteria 318094
26 Ga0055525_1000306 3300003759 Bacteria 40206
27 Ga0055527_1000060 3300003760 Bacteria 92147
28 Ga0055527_1000113 3300003760 Bacteria 57956
29 Ga0055527_1000142 3300003760 Bacteria 50604
30 Ga0055527_1000290 3300003760 Bacteria 29064
31 Ga0055527_1000341 3300003760 Bacteria 23705
32 Ga0055535_1000160 3300003761 Bacteria 72123
33 Ga0055535_1000257 3300003761 Bacteria 55687
34 Ga0055535_1000412 3300003761 Bacteria 40225
35 Ga0055535_1000907 3300003761 Bacteria 20090
36 Ga0055535_1001127 3300003761 Bacteria 15999
37 Ga0055535_1001465 3300003761 Bacteria 11880
38 Ga0055542_1000128 3300003762 Bacteria 99868
39 Ga0055542_1000171 3300003762 Bacteria 80629
40 Ga0055542_1000294 3300003762 Bacteria 55687
41 Ga0055542_1000413 3300003762 Bacteria 41680
42 Ga0055542_1000776 3300003762 Bacteria 24010
43 Ga0055542_1001114 3300003762 Bacteria 16058
44 Ga0055542_1001281 3300003762 Bacteria 13538
45 Ga0055529_1000295 3300003763 Bacteria 57960
46 Ga0055529_1000388 3300003763 Bacteria 47502
47 Ga0055529_1000429 3300003763 Bacteria 42686
48 Ga0055529_1000573 3300003763 Bacteria 29920
49 Ga0055529_1000752 3300003763 Bacteria 20858
50 Ga0055529_1000754 3300003763 Bacteria 20643
51 Ga0065707_10100611 3300005295 Bacteria 2918
52 Ga0070676_10108474 3300005328 Bacteria 1725
53 Ga0070690_100012375 3300005330 Bacteria 5021
54 Ga0070680_100184429 3300005336 Bacteria 1758
55 Ga0070680_100197455 3300005336 Bacteria 1696
56 Ga0070680_100197460 3300005336 Bacteria 1696
57 Ga0070660_100218849 3300005339 Bacteria 1547
58 Ga0070689_100001554 3300005340 Bacteria 14625
59 Ga0070669_100237250 3300005353 Bacteria 1447
60 Ga0070675_100050457 3300005354 Bacteria 3416
61 Ga0070671_100228133 3300005355 Bacteria 1580
62 Ga0070673_100101216 3300005364 Bacteria 2373
63 Ga0070673_100163402 3300005364 Bacteria 1895
64 Ga0070659_100073529 3300005366 Bacteria 2721
65 Ga0070709_10013558 3300005434 Bacteria 4586
66 Ga0070709_10214040 3300005434 Bacteria 1371
67 Ga0070714_100004122 3300005435 Bacteria 10927
68 Ga0070714_100012973 3300005435 Bacteria 6665
69 Ga0070714_100028985 3300005435 Bacteria 4598
70 Ga0070714_100171241 3300005435 Bacteria 1970
71 Ga0070713_100001562 3300005436 Bacteria 14645
72 Ga0070713_100042543 3300005436 Bacteria 3708
73 Ga0070713_100277959 3300005436 Bacteria 1535
74 Ga0070713_100324765 3300005436 Bacteria 1422
75 Ga0070711_100073428 3300005439 Bacteria 2417
76 Ga0070711_100236284 3300005439 Bacteria 1427
77 Ga0070708_100009962 3300005445 Bacteria 7684
78 Ga0070708_100135184 3300005445 Bacteria 2283
79 Ga0070663_100028585 3300005455 Bacteria 3798
80 Ga0070663_100075221 3300005455 Bacteria 2468
81 Ga0070663_100102607 3300005455 Bacteria 2137
82 Ga0070662_100355077 3300005457 Bacteria 1202
83 Ga0070681_10035542 3300005458 Bacteria 5006
84 Ga0070681_10139023 3300005458 Bacteria 2358
85 Ga0070681_10157745 3300005458 Bacteria 2193
86 Ga0070685_10027920 3300005466 Bacteria 3124
87 Ga0070707_100017177 3300005468 Bacteria 6800
88 Ga0070707_100230363 3300005468 Bacteria 1803
89 Ga0070698_100050031 3300005471 Bacteria 4263
90 Ga0070699_100073941 3300005518 Bacteria 2965
91 Ga0070679_100017201 3300005530 Bacteria 6995
92 Ga0070679_100030406 3300005530 Bacteria 5332
93 Ga0070679_100330913 3300005530 Bacteria 1472
94 Ga0070697_100133026 3300005536 Bacteria 2087
95 Ga0070697_100298218 3300005536 Bacteria 1385
96 Ga0070697_100419715 3300005536 Bacteria 1162
97 Ga0068853_100110363 3300005539 Bacteria 2443
98 Ga0068853_100337729 3300005539 Bacteria 1399
99 Ga0070693_100012025 3300005547 Bacteria 4370
100 Ga0068855_100020179 3300005563 Bacteria 8002
101 Ga0068855_100042682 3300005563 Bacteria 5373
102 Ga0068855_100108896 3300005563 Bacteria 3182
103 Ga0068855_100142567 3300005563 Bacteria 2729
104 Ga0068857_100002222 3300005577 Bacteria 15811
105 Ga0068857_100056162 3300005577 Bacteria 3494
106 Ga0068854_100002653 3300005578 Bacteria 11087
107 Ga0068854_100015938 3300005578 Bacteria 4996
108 Ga0068856_100001892 3300005614 Bacteria 21818
109 Ga0068856_100069266 3300005614 Bacteria 3488
110 Ga0068856_100297394 3300005614 Bacteria 1631
111 Ga0070702_100253162 3300005615 Bacteria 1195
112 Ga0068852_100137729 3300005616 Bacteria 2255
113 Ga0068851_10000936 3300005834 Bacteria 12635
114 Ga0068858_100144312 3300005842 Bacteria 2235
115 Ga0068858_100698750 3300005842 Bacteria 987
116 Ga0068860_100000548 3300005843 Bacteria 45747
117 Ga0081455_10150107 3300005937 Bacteria 1798
118 Ga0075364_10035088 3300006051 Bacteria 3240
119 Ga0075364_10318975 3300006051 Bacteria 1058
120 Ga0070716_100125424 3300006173 Bacteria 1614
121 Ga0070716_100184583 3300006173 Bacteria 1373
122 Ga0070712_100230697 3300006175 Bacteria 1470
123 Ga0075369_10030921 3300006186 Bacteria 2256
124 Ga0075366_10003143 3300006195 Bacteria 8641
125 Ga0097621_100024293 3300006237 Bacteria 4731
126 Ga0097621_100090181 3300006237 Bacteria 2564
127 Ga0068871_100007696 3300006358 Bacteria 7708
128 Ga0075431_100019988 3300006847 Bacteria 6838
129 Ga0075431_100042754 3300006847 Bacteria 4674
130 Ga0075433_10265919 3300006852 Bacteria 1520
131 Ga0075433_10395832 3300006852 Bacteria 1219
132 Ga0075434_100005412 3300006871 Bacteria 11616
133 Ga0075434_100009536 3300006871 Bacteria 9059
134 Ga0075434_100058711 3300006871 Bacteria 3824
135 Ga0075429_100115587 3300006880 Bacteria 2345
136 Ga0075429_100228905 3300006880 Bacteria 1628
137 Ga0075436_100005990 3300006914 Bacteria 8350
138 Ga0075435_100199657 3300007076 Bacteria 1694
139 Ga0105251_10002726 3300009011 Bacteria 13539
140 Ga0105244_10080285 3300009036 Bacteria 1615
141 Ga0105240_10000197 3300009093 Bacteria 123221
142 Ga0105240_10000199 3300009093 Bacteria 122191
143 Ga0105240_10031713 3300009093 Bacteria 6848
144 Ga0105240_10045931 3300009093 Bacteria 5538
145 Ga0105240_10054121 3300009093 Bacteria 5031
146 Ga0105240_10074999 3300009093 Bacteria 4173
147 Ga0105240_10107999 3300009093 Bacteria 3372
148 Ga0105240_10829593 3300009093 Bacteria 1000
149 Ga0105245_10111298 3300009098 Bacteria 2546
150 Ga0105247_10032660 3300009101 Bacteria 3162
151 Ga0114129_10058975 3300009147 Bacteria 5367
152 Ga0114129_10126778 3300009147 Bacteria 3509
153 Ga0114129_10533595 3300009147 Bacteria 1528
154 Ga0114129_10576911 3300009147 Bacteria 1460
155 Ga0105243_10125125 3300009148 Bacteria 2173
156 Ga0105241_10133884 3300009174 Bacteria 2010
157 Ga0105242_10017145 3300009176 Bacteria 5639
158 Ga0105242_10143183 3300009176 Bacteria 2077
159 Ga0105242_10349991 3300009176 Bacteria 1364
160 Ga0105248_10092018 3300009177 Bacteria 3415
161 Ga0105248_10163778 3300009177 Bacteria 2507
162 Ga0105248_10457848 3300009177 Bacteria 1438
163 Ga0105237_10000112 3300009545 Bacteria 114192
164 Ga0105237_10093677 3300009545 Bacteria 2993
165 Ga0105237_10272967 3300009545 Bacteria 1694
166 Ga0105237_10537236 3300009545 Bacteria 1176
167 Ga0105238_10097305 3300009551 Bacteria 2929
168 Ga0105238_10196312 3300009551 Bacteria 1994
169 Ga0105249_10252758 3300009553 Bacteria 1748
170 Ga0105147_107285 3300009982 Bacteria 938
171 Ga0105239_10000054 3300010375 Bacteria 159216
172 Ga0105239_10000061 3300010375 Bacteria 154661
173 Ga0105239_10117019 3300010375 Bacteria 2958
174 Ga0105246_10009096 3300011119 Bacteria 6117
175 Ga0157314_1000010 3300012500 Bacteria 21255
176 Ga0157373_10182862 3300013100 Bacteria 1476
177 Ga0157369_10009042 3300013105 Bacteria 11405
178 Ga0157369_10117285 3300013105 Bacteria 2826
179 Ga0157378_10052337 3300013297 Bacteria 3633
180 Ga0163162_10051973 3300013306 Bacteria 4114
181 Ga0163162_10060208 3300013306 Bacteria 3831
182 Ga0157372_10002320 3300013307 Bacteria 20607
183 Ga0157375_11194103 3300013308 Bacteria 892
184 Ga0157380_10008810 3300014326 Bacteria 7210
185 Ga0157380_10053656 3300014326 Bacteria 3197
186 Ga0157377_10253111 3300014745 Bacteria 1142
187 Ga0157376_10098462 3300014969 Bacteria 2549
188 Ga0182007_10069049 3300015262 Bacteria 1158
189 Ga0183368_1002 3300015687 Bacteria 1865598
190 Ga0206351_10683695 3300020077 Bacteria 826
191 Ga0213872_10002401 3300021361 Bacteria 11064
192 Ga0213872_10029959 3300021361 Bacteria 2496
193 Ga0213872_10104153 3300021361 Bacteria 1263
194 Ga0224571_105624 3300022734 Bacteria 826
195 Ga0209435_102319 3300025206 Bacteria 2240
196 Ga0209435_108715 3300025206 Bacteria 1114
197 Ga0209760_100718 3300025207 Bacteria 5015
198 Ga0209784_100074 3300025224 Bacteria 144366
199 Ga0209566_102088 3300025225 Bacteria 4129
200 Ga0209674_100068 3300025226 Bacteria 245612
201 Ga0209674_100111 3300025226 Bacteria 143058
202 Ga0209672_100004 3300025228 Bacteria 1467504
203 Ga0209672_100008 3300025228 Bacteria 946876
204 Ga0209672_100043 3300025228 Bacteria 270302
205 Ga0209672_100229 3300025228 Bacteria 42746
206 Ga0209672_100416 3300025228 Bacteria 25021
207 Ga0209672_101094 3300025228 Bacteria 11506
208 Ga0209672_103526 3300025228 Bacteria 3205
209 Ga0209563_100028 3300025230 Bacteria 509539
210 Ga0209563_100062 3300025230 Bacteria 264769
211 Ga0207427_100079 3300025231 Bacteria 145096
212 Ga0207427_100252 3300025231 Bacteria 42486
213 Ga0207427_101437 3300025231 Bacteria 8615
214 Ga0209437_100163 3300025233 Bacteria 145370
215 Ga0209437_100379 3300025233 Bacteria 44647
216 Ga0209437_100391 3300025233 Bacteria 42486
217 Ga0209437_103389 3300025233 Bacteria 2896
218 Ga0209258_100003 3300025242 Bacteria 1467504
219 Ga0209258_100004 3300025242 Bacteria 1376422
220 Ga0209258_100008 3300025242 Bacteria 1009355
221 Ga0209258_100076 3300025242 Bacteria 270302
222 Ga0209258_100217 3300025242 Bacteria 110607
223 Ga0209258_100671 3300025242 Bacteria 24168
224 Ga0209258_100757 3300025242 Bacteria 20285
225 Ga0209258_101469 3300025242 Bacteria 8184
226 Ga0209258_102547 3300025242 Bacteria 4592
227 Ga0209646_1001082 3300025246 Bacteria 8153
228 Ga0209646_1002310 3300025246 Bacteria 4331
229 Ga0209646_1006223 3300025246 Bacteria 2016
230 Ga0209026_1000088 3300025250 Bacteria 177275
231 Ga0209026_1000109 3300025250 Bacteria 144563
232 Ga0209026_1000578 3300025250 Bacteria 24159
233 Ga0209026_1001248 3300025250 Bacteria 11644
234 Ga0209677_103999 3300025253 Bacteria 4457
235 Ga0209148_1000001 3300025254 Bacteria 2545271
236 Ga0209148_1000002 3300025254 Bacteria 2399500
237 Ga0209148_1000016 3300025254 Bacteria 804369
238 Ga0209148_1000041 3300025254 Bacteria 469323
239 Ga0209148_1000082 3300025254 Bacteria 270302
240 Ga0209148_1000197 3300025254 Bacteria 109412
241 Ga0209148_1000473 3300025254 Bacteria 42747
242 Ga0209759_1000441 3300025256 Bacteria 48709
243 Ga0209759_1000489 3300025256 Bacteria 43662
244 Ga0209759_1001276 3300025256 Bacteria 15076
245 Ga0209759_1008589 3300025256 Bacteria 3167
246 Ga0209129_1000696 3300025258 Bacteria 22042
247 Ga0209233_1000002 3300025261 Bacteria 2501366
248 Ga0209233_1000357 3300025261 Bacteria 42486
249 Ga0209233_1028130 3300025261 Bacteria 1353
250 Ga0209455_1000004 3300025272 Bacteria 1467504
251 Ga0209455_1000007 3300025272 Bacteria 1157983
252 Ga0209455_1000078 3300025272 Bacteria 270237
253 Ga0209455_1000079 3300025272 Bacteria 268778
254 Ga0209455_1000356 3300025272 Bacteria 42747
255 Ga0209455_1005236 3300025272 Bacteria 4054
256 Ga0209455_1010211 3300025272 Bacteria 2403
257 Ga0209455_1014346 3300025272 Bacteria 1796
258 Ga0209676_1017627 3300025292 Bacteria 2521
259 Ga0209758_1000185 3300025297 Bacteria 139330
260 Ga0209758_1000726 3300025297 Bacteria 48263
261 Ga0209758_1011013 3300025297 Bacteria 5302
262 Ga0209050_1002993 3300025298 Bacteria 13139
263 Ga0207656_10021530 3300025321 Bacteria 2577
264 Ga0207655_1011838 3300025728 Bacteria 5154
265 Ga0207655_1055154 3300025728 Bacteria 1575
266 Ga0207713_1000078 3300025735 Bacteria 175087
267 Ga0207710_10015747 3300025900 Bacteria 3197
268 Ga0207647_10002237 3300025904 Bacteria 14740
269 Ga0207647_10040567 3300025904 Bacteria 2931
270 Ga0207699_10114972 3300025906 Bacteria 1731
271 Ga0207705_10033478 3300025909 Bacteria 3671
272 Ga0207705_10069160 3300025909 Bacteria 2557
273 Ga0207684_10274831 3300025910 Bacteria 1453
274 Ga0207707_10008510 3300025912 Bacteria 8894
275 Ga0207707_10316013 3300025912 Bacteria 1349
276 Ga0207695_10000207 3300025913 Bacteria 160390
277 Ga0207695_10000746 3300025913 Bacteria 62682
278 Ga0207695_10004175 3300025913 Bacteria 19845
279 Ga0207695_10017482 3300025913 Bacteria 8345
280 Ga0207695_10049748 3300025913 Bacteria 4414
281 Ga0207695_10069643 3300025913 Bacteria 3599
282 Ga0207695_10199978 3300025913 Bacteria 1913
283 Ga0207695_10247819 3300025913 Bacteria 1681
284 Ga0207671_10000009 3300025914 Bacteria 724862
285 Ga0207693_10336810 3300025915 Bacteria 1181
286 Ga0207660_10017740 3300025917 Bacteria 4735
287 Ga0207662_10101193 3300025918 Bacteria 1786
288 Ga0207662_10187892 3300025918 Bacteria 1332
289 Ga0207652_10018181 3300025921 Bacteria 5762
290 Ga0207652_10028627 3300025921 Bacteria 4651
291 Ga0207646_10006618 3300025922 Bacteria 11961
292 Ga0207646_10036118 3300025922 Bacteria 4461
293 Ga0207646_10409019 3300025922 Unclassified 1225
294 Ga0207646_10411577 3300025922 Bacteria 1221
295 Ga0207694_10033668 3300025924 Bacteria 3925
296 Ga0207694_10074422 3300025924 Bacteria 2658
297 Ga0207659_10061379 3300025926 Bacteria 2709
298 Ga0207659_10464961 3300025926 Bacteria 1067
299 Ga0207700_10261112 3300025928 Bacteria 1483
300 Ga0207700_10264391 3300025928 Bacteria 1474
301 Ga0207700_10311770 3300025928 Bacteria 1361
302 Ga0207664_10032883 3300025929 Bacteria 3979
303 Ga0207706_10015120 3300025933 Bacteria 6984
304 Ga0207706_10043672 3300025933 Bacteria 3972
305 Ga0207686_10137772 3300025934 Bacteria 1683
306 Ga0207686_10145005 3300025934 Bacteria 1646
307 Ga0207670_10040837 3300025936 Bacteria 3047
308 Ga0207670_10236785 3300025936 Bacteria 1404
309 Ga0207665_10103521 3300025939 Bacteria 1991
310 Ga0207665_10146425 3300025939 Bacteria 1688
311 Ga0207665_10568814 3300025939 Bacteria 882
312 Ga0207689_10218151 3300025942 Bacteria 1576
313 Ga0207667_10001194 3300025949 Bacteria 32590
314 Ga0207667_10002016 3300025949 Bacteria 25491
315 Ga0207667_10096775 3300025949 Bacteria 3046
316 Ga0207667_10320992 3300025949 Bacteria 1582
317 Ga0207651_10212591 3300025960 Bacteria 1558
318 Ga0207640_10001472 3300025981 Bacteria 12694
319 Ga0207640_10015593 3300025981 Bacteria 4403
320 Ga0207640_10472812 3300025981 Bacteria 1038
321 Ga0207703_10010532 3300026035 Bacteria 7230
322 Ga0207639_10066797 3300026041 Bacteria 2796
323 Ga0207678_10049073 3300026067 Bacteria 3647
324 Ga0207678_10050297 3300026067 Bacteria 3601
325 Ga0207678_10060739 3300026067 Bacteria 3251
326 Ga0207678_10090238 3300026067 Bacteria 2619
327 Ga0207702_10001234 3300026078 Bacteria 25867
328 Ga0207702_10030769 3300026078 Bacteria 4471
329 Ga0207674_10000145 3300026116 Bacteria 83147
330 Ga0207674_10004815 3300026116 Bacteria 16168
331 Ga0207698_10005538 3300026142 Bacteria 7815
332 Ga0207698_10202622 3300026142 Bacteria 1778
333 Ga0207698_10345082 3300026142 Bacteria 1404
334 Ga0207428_10050882 3300027907 Bacteria 3312
335 Ga0207428_10150156 3300027907 Bacteria 1774
336 Ga0207428_10152719 3300027907 Bacteria 1757
337 Ga0207428_10306359 3300027907 Bacteria 1175
338 Ga0268266_10000002 3300028379 Bacteria 3059047
339 Ga0268266_10489735 3300028379 Bacteria 1173
340 Ga0268265_10085066 3300028380 Bacteria 2509
341 Ga0268264_10255248 3300028381 Bacteria 1631
342 Ga0268264_10700146 3300028381 Bacteria 1006
343 Ga0268264_10718655 3300028381 Bacteria 993
344 Ga0265326_10013291 3300028558 Bacteria 2411
345 Ga0265319_1011525 3300028563 Bacteria 3616
346 Ga0265334_10001994 3300028573 Bacteria 9701
347 Ga0307511_10055431 3300030521 Bacteria 3112
348 Ga0265762_1027671 3300030760 Bacteria 1065
349 Ga0265763_1000757 3300030763 Bacteria 2110
350 Ga0265760_10002084 3300031090 Bacteria 5880
351 Ga0265330_10004251 3300031235 Bacteria 7298
352 Ga0265332_10043191 3300031238 Bacteria 1946
353 Ga0265328_10061264 3300031239 Bacteria 1381
354 Ga0265320_10022663 3300031240 Bacteria 3355
355 Ga0265325_10018315 3300031241 Bacteria 3883
356 Ga0265329_10008609 3300031242 Bacteria 3856
357 Ga0265339_10013095 3300031249 Bacteria 5037
358 Ga0265331_10027740 3300031250 Bacteria 2836
359 Ga0265316_10114149 3300031344 Bacteria 2043
360 Ga0265313_10005711 3300031595 Bacteria 9065
361 Ga0307508_10048633 3300031616 Bacteria 3776
362 Ga0265314_10000144 3300031711 Bacteria 107465
363 Ga0265314_10008509 3300031711 Bacteria 8772
364 Ga0265314_10015115 3300031711 Bacteria 6139
365 Ga0265342_10024197 3300031712 Bacteria 3835
366 Ga0307516_10085295 3300031730 Bacteria 2996
367 Ga0307407_10018217 3300031903 Bacteria 3546
368 Ga0307412_10001318 3300031911 Bacteria 13900
369 Ga0307409_100298389 3300031995 Bacteria 1498
370 Ga0307507_10070636 3300033179 Bacteria 3165
371 Ga0373951_0093135 3300035091 Bacteria 793
372 Ga0373936_0039182 3300035113 Bacteria 1896
373 Ga0373941_0041906 3300035115 Bacteria 1419
374 Ga0373924_0265187 3300035410 Bacteria 761
375 Ga0373935_0030160 3300035692 Bacteria 3359
376 Ga0373933_0452755 3300035724 Bacteria 840
377 Ga0373937_0016031 3300036401 Bacteria 6646
378 Ga0373937_0330237 3300036401 Bacteria 1443
379 Ga0373937_0546154 3300036401 Bacteria 1101
380 Ga0316582_0024616 3300036647 Bacteria 3605
381 Ga0373925_0057500 3300037068 Bacteria 2914
382 Ga0395899_0000057 3300037312 Bacteria 214710
383 Ga0395899_0002577 3300037312 Bacteria 14625
384 Ga0395899_0179696 3300037312 Bacteria 1486
385 Ga0395900_0000035 3300037418 Bacteria 254301
386 Ga0395900_0124721 3300037418 Bacteria 2641
387 Ga0395900_0285532 3300037418 Bacteria 1641
388 Ga0395898_0000150 3300037466 Bacteria 181023
389 Ga0395898_0731258 3300037466 Bacteria 931
390 Ga0395905_0002061 3300037471 Bacteria 22906
391 Ga0395901_0015566 3300038443 Bacteria 7747
392 Ga0395901_0472064 3300038443 Bacteria 1280
393 Ga0436365_0402584 3300039437 Bacteria 1212
394 Ga0436365_1638281 3300039437 Bacteria 1554
395 Ga0436365_1902360 3300039437 Bacteria 940
396 Ga0436360_0448261 3300039438 Bacteria 2197
397 Ga0436361_0049588 3300039447 Bacteria 1407
398 Ga0436361_0205650 3300039447 Bacteria 1045
399 Ga0436361_0211450 3300039447 Bacteria 871
400 Ga0436361_0472131 3300039447 Bacteria 13030
401 Ga0436361_1106151 3300039447 Bacteria 2236
402 Ga0436363_0124313 3300039450 Bacteria 1473
403 Ga0436363_0611592 3300039450 Bacteria 728
404 Ga0451793_1763305 3300041452 Bacteria 4159
405 Ga0466969_0005093 3300044656 Bacteria 6989
406 Ga0466969_0132900 3300044656 Bacteria 1153
407 Ga0466972_0044091 3300044658 Bacteria 2164
408 Ga0466975_0136558 3300044661 Bacteria 1721
409 Ga0466989_0015645 3300044663 Bacteria 4235
410 Ga0466982_0000006 3300044672 Bacteria 333931
411 Ga0466965_0128484 3300044683 Bacteria 1312
412 Ga0466966_0001181 3300044684 Bacteria 16739
413 Ga0466966_0028116 3300044684 Bacteria 3663
414 Ga0466966_0034284 3300044684 Bacteria 3282
415 Ga0466961_0000592 3300044693 Bacteria 22956
416 Ga0466961_0001406 3300044693 Bacteria 14929
417 Ga0466961_0003804 3300044693 Bacteria 9442
418 Ga0466963_0060932 3300044694 Bacteria 2521
419 Ga0466963_0123603 3300044694 Bacteria 1783
420 Ga0466964_0010610 3300044706 Bacteria 3475
421 Ga0453684_0175244 3300044712 Bacteria 2523
422 Ga0466968_0089163 3300044735 Bacteria 1364
423 Ga0466970_0000413 3300044765 Bacteria 20876
424 Ga0466970_0010903 3300044765 Bacteria 4623
425 Ga0466970_0039366 3300044765 Bacteria 2508
426 Ga0466970_0161903 3300044765 Bacteria 1238
427 Ga0466957_0000599 3300044842 Bacteria 18324
428 Ga0466957_0053446 3300044842 Bacteria 2462
429 Ga0466960_0042067 3300044901 Bacteria 2167
430 Ga0466959_0000038 3300045049 Bacteria 101314
431 Ga0466959_0014309 3300045049 Bacteria 5758
432 Ga0466959_0030035 3300045049 Bacteria 4025
433 Ga0466959_0031645 3300045049 Bacteria 3914
434 Ga0466959_0388619 3300045049 Bacteria 949
435 Ga0451576_0001130 3300045051 Bacteria 48331
436 Ga0451576_0208489 3300045051 Bacteria 2041
437 Ga0466958_0009749 3300045836 Bacteria 5359
438 Ga0466958_0022342 3300045836 Bacteria 3704
439 Ga0466958_0076958 3300045836 Bacteria 2048
440 Ga0466967_0176951 3300045976 Bacteria 2010
441 Ga0466967_0189060 3300045976 Bacteria 1945
442 Ga0495627_002096 3300046453 Bacteria 10127
443 Ga0495592_0070495 3300046454 Bacteria 2546
444 Ga0495591_000755 3300046458 Bacteria 23371
445 Ga0495638_0000085 3300046460 Bacteria 153005
446 Ga0495638_0000541 3300046460 Bacteria 43533
447 Ga0495638_0001761 3300046460 Bacteria 18966
448 Ga0495638_0011430 3300046460 Bacteria 6117
449 Ga0495651_0064916 3300046462 Bacteria 2789
450 Ga0495650_0000333 3300046471 Bacteria 84578
451 Ga0495664_0029070 3300046477 Bacteria 3230
452 Ga0495607_0001801 3300046501 Bacteria 18308
453 Ga0495607_0022701 3300046501 Bacteria 3936
454 Ga0495607_0041643 3300046501 Bacteria 2726
455 Ga0495583_0007868 3300046506 Bacteria 6617
456 Ga0495606_0000746 3300046507 Bacteria 50273
457 Ga0495606_0042688 3300046507 Bacteria 3031
458 Ga0495616_0000017 3300046513 Bacteria 167324
459 Ga0495616_0140170 3300046513 Bacteria 1101
460 Ga0495628_0038088 3300046516 Bacteria 3851
461 Ga0495632_0140243 3300046519 Bacteria 1122
462 Ga0495587_0005777 3300046536 Bacteria 8059
463 Ga0495587_0042600 3300046536 Bacteria 2707
464 Ga0495598_0035793 3300046537 Bacteria 1423
465 Ga0495609_0000202 3300046538 Bacteria 59327
466 Ga0495597_0043110 3300046542 Bacteria 2010
467 Ga0495645_0000615 3300046543 Bacteria 24594
468 Ga0495622_0015305 3300046557 Bacteria 3566
469 Ga0495622_0016634 3300046557 Bacteria 3426
470 Ga0495667_0011017 3300046559 Bacteria 6113
471 Ga0495656_0012426 3300046615 Bacteria 3141
472 Ga0495668_0012539 3300046616 Bacteria 5027
473 Ga0495625_0024884 3300046660 Bacteria 4547
474 Ga0495625_0122986 3300046660 Bacteria 1764
475 Ga0495661_0080411 3300046665 Bacteria 1881
476 Ga0495599_0304711 3300046678 Bacteria 961
477 Ga0495623_0035123 3300046679 Bacteria 3213
478 Ga0495646_0197122 3300046680 Bacteria 1098
479 Ga0495670_0012637 3300046691 Bacteria 4153
480 Ga0495670_0315938 3300046691 Bacteria 838
481 Ga0495671_0186924 3300046692 Bacteria 1006
482 Ga0495649_0001096 3300046694 Bacteria 21138
483 Ga0495649_0011605 3300046694 Bacteria 5163
484 Ga0495600_0055926 3300046809 Bacteria 2577
485 Ga0495604_0127161 3300047317 Bacteria 1836
486 Ga0495636_0049605 3300047318 Bacteria 1755
487 Ga0495636_0122880 3300047318 Bacteria 1149
488 Ga0495672_0000019 3300047320 Bacteria 448153
489 Ga0495672_0010209 3300047320 Bacteria 6711
490 Ga0495680_0307881 3300047322 Bacteria 1111
491 Ga0495681_0002600 3300047470 Bacteria 12814
492 Ga0495681_0093144 3300047470 Bacteria 1327
493 Ga0496101_0025249 3300048904 Bacteria 4121
494 Ga0496101_0655407 3300048904 Bacteria 829
495 Ga0496102_0446357 3300048905 Bacteria 1214
496 Ga0496102_0581823 3300048905 Bacteria 1042
497 Ga0496102_0848208 3300048905 Bacteria 836
498 Ga0496103_0120378 3300048906 Bacteria 1672
499 Ga0496104_0046169 3300048907 Bacteria 4101
500 Ga0496104_0292752 3300048907 Bacteria 1541
501 Ga0496105_0001283 3300048908 Bacteria 17583
502 Ga0496106_0037410 3300048909 Bacteria 3631
503 Ga0496106_0106223 3300048909 Bacteria 2182
504 Ga0496107_0146647 3300048910 Bacteria 1745
505 Ga0496108_0261608 3300048911 Bacteria 1506
506 Ga0496108_0405257 3300048911 Bacteria 1191
507 Ga0496113_0006522 3300048916 Bacteria 7405
508 Ga0496113_0449165 3300048916 Bacteria 1036
509 Ga0496114_0207266 3300048917 Bacteria 1719
510 Ga0496115_0000804 3300048918 Bacteria 23009
511 Ga0496115_0004756 3300048918 Bacteria 9853
512 Ga0496115_0007399 3300048918 Bacteria 8078
513 Ga0496115_0265384 3300048918 Bacteria 1411
514 Ga0496116_0000963 3300048919 Bacteria 35538
515 Ga0496117_0000600 3300048920 Bacteria 59074
516 Ga0496117_0000873 3300048920 Bacteria 46528
517 Ga0496117_0023471 3300048920 Bacteria 4913
518 Ga0496117_0055735 3300048920 Bacteria 2759
519 Ga0496118_0004285 3300048921 Bacteria 17067
520 Ga0496118_0010232 3300048921 Bacteria 9310
521 Ga0496118_0034179 3300048921 Bacteria 4154
522 Ga0496118_0049197 3300048921 Bacteria 3249
523 Ga0496118_0054089 3300048921 Bacteria 3044
524 Ga0496118_0118265 3300048921 Bacteria 1736
525 Ga0496119_0000149 3300048922 Bacteria 97430
526 Ga0496119_0008280 3300048922 Bacteria 9174
527 Ga0496119_0253243 3300048922 Bacteria 887
528 Ga0496120_0000841 3300048923 Bacteria 43682
529 Ga0496120_0000982 3300048923 Bacteria 38803
530 Ga0496120_0001845 3300048923 Bacteria 23584
531 Ga0496121_0000124 3300048924 Bacteria 170427
532 Ga0496121_0000173 3300048924 Bacteria 143397
533 Ga0496121_0000542 3300048924 Bacteria 71767
534 Ga0496121_0000543 3300048924 Bacteria 71696
535 Ga0496121_0001793 3300048924 Bacteria 34696
536 Ga0496121_0007834 3300048924 Bacteria 12776
537 Ga0496121_0037774 3300048924 Bacteria 4284
538 Ga0496121_0042695 3300048924 Bacteria 3939
539 Ga0496121_0059126 3300048924 Bacteria 3162
540 Ga0496121_0129175 3300048924 Bacteria 1895
541 Ga0496121_0222469 3300048924 Bacteria 1328
542 Ga0496122_0000316 3300048925 Bacteria 106100
543 Ga0496122_0001658 3300048925 Bacteria 34572
544 Ga0496122_0060307 3300048925 Bacteria 2795
545 Ga0496123_0000297 3300048926 Bacteria 97340
546 Ga0496123_0000891 3300048926 Bacteria 47218
547 Ga0496124_0000022 3300048927 Bacteria 421020
548 Ga0496124_0041712 3300048927 Bacteria 3957
549 Ga0496124_0106993 3300048927 Bacteria 2257
550 Ga0496124_0315709 3300048927 Bacteria 1121
551 Ga0496125_0000116 3300048928 Bacteria 180492
552 Ga0496125_0000251 3300048928 Bacteria 110300
553 Ga0496125_0004591 3300048928 Bacteria 15786
554 Ga0496125_0114148 3300048928 Bacteria 1946
555 Ga0496125_0469959 3300048928 Bacteria 715
556 Ga0496126_0000259 3300048929 Bacteria 113443
557 Ga0496126_0018569 3300048929 Bacteria 6885
558 Ga0496126_0019718 3300048929 Bacteria 6636
559 Ga0496126_0028900 3300048929 Bacteria 5274
560 Ga0496126_0032547 3300048929 Bacteria 4911
561 Ga0496126_0047418 3300048929 Bacteria 3933
562 Ga0496126_0054167 3300048929 Bacteria 3635
563 Ga0496126_0112122 3300048929 Bacteria 2375
564 Ga0496126_0120884 3300048929 Bacteria 2271
565 Ga0496126_0172737 3300048929 Bacteria 1840
566 Ga0496126_0338248 3300048929 Bacteria 1233
567 Ga0496126_0564237 3300048929 Bacteria 901
568 Ga0495678_025175 3300049459 Bacteria 2560
569 Ga0495678_039654 3300049459 Bacteria 1898
570 Ga0501031_0044965 3300049568 Bacteria 2881
571 Ga0501031_0244118 3300049568 Bacteria 1167
572 Ga0501032_0051473 3300049569 Bacteria 2777
573 Ga0501032_0074725 3300049569 Bacteria 2258
574 Ga0501033_0001220 3300049570 Bacteria 23082
575 Ga0501033_0029198 3300049570 Bacteria 4144
576 Ga0501033_0318287 3300049570 Bacteria 1093
577 Ga0501034_0069489 3300049571 Bacteria 3533
578 Ga0501034_0132424 3300049571 Bacteria 2476
579 Ga0501036_0029254 3300049572 Bacteria 4657
580 Ga0501036_0047624 3300049572 Bacteria 3630
581 Ga0501036_0186666 3300049572 Bacteria 1745
582 Ga0501037_0109328 3300049573 Bacteria 1992
583 Ga0501037_0359594 3300049573 Bacteria 1003
584 Ga0501041_0052101 3300049577 Bacteria 2495
585 Ga0501042_0004920 3300049578 Bacteria 8554
586 Ga0501043_0025057 3300049579 Bacteria 4680
587 Ga0501043_0118681 3300049579 Bacteria 2074
588 Ga0501043_0275619 3300049579 Bacteria 1290
589 Ga0501046_0006258 3300049580 Bacteria 10560
590 Ga0501046_0320072 3300049580 Bacteria 1130
591 Ga0501047_0032550 3300049581 Bacteria 5033
592 Ga0501047_0041671 3300049581 Bacteria 4436
593 Ga0501047_0091049 3300049581 Bacteria 2927
594 Ga0501047_0288352 3300049581 Bacteria 1485
595 Ga0501047_0416996 3300049581 Bacteria 1174
596 Ga0501047_0711528 3300049581 Bacteria 821
597 Ga0501070_0287040 3300049586 Bacteria 1342
598 Ga0501070_0386492 3300049586 Bacteria 1133
599 Ga0501071_0101632 3300049587 Bacteria 2119
600 Ga0501075_0269397 3300049591 Bacteria 1298
601 Ga0501076_0339609 3300049592 Bacteria 1232
602 Ga0501076_0471865 3300049592 Bacteria 1034
603 Ga0501076_0672753 3300049592 Bacteria 854
604 Ga0501081_0134808 3300049743 Bacteria 1767
605 Ga0501083_0145130 3300049744 Bacteria 1554
606 Ga0501035_0058713 3300049822 Bacteria 3427
607 Ga0501035_0129494 3300049822 Bacteria 2201
608 Ga0501035_0272381 3300049822 Bacteria 1432
609 Ga0501035_0338672 3300049822 Bacteria 1261
610 Ga0501044_0116589 3300049823 Bacteria 2676
611 Ga0501044_0128698 3300049823 Bacteria 2527
612 Ga0501044_0238399 3300049823 Bacteria 1763
613 Ga0501044_0240696 3300049823 Bacteria 1753
614 Ga0501045_0187853 3300049824 Bacteria 1540
615 nmdc:mga05p37_105884_c1 3300050507 Bacteria 3459
616 nmdc:mga09592_224349_c1 3300050508 Bacteria 1628
617 nmdc:mga0qj67_757989_c1 3300050509 Bacteria 770
618 nmdc:mga06r32_105824_c1 3300050510 Bacteria 2764
619 nmdc:mga08y16_381559_c1 3300050511 Bacteria 1444
620 nmdc:mga0n895_144431_c1 3300050512 Bacteria 2409
621 nmdc:mga0n895_220793_c1 3300050512 Bacteria 1924
622 nmdc:mga0n895_59314_c1 3300050512 Bacteria 3775
623 nmdc:mga0n895_8703_c1 3300050512 Bacteria 8817
624 nmdc:mga0rr50_23915_c1 3300050513 Bacteria 4225
625 nmdc:mga0rr50_86922_c1 3300050513 Bacteria 2426
626 nmdc:mga08x19_19639_c1 3300050514 Bacteria 4150
627 nmdc:mga0a205_389547_c1 3300050515 Bacteria 1258
628 nmdc:mga0a205_432957_c1 3300050515 Bacteria 1177
629 nmdc:mga0a205_84048_c1 3300050515 Bacteria 3074
630 Ga0495601_0048292 3300053077 Bacteria 2680
631 Ga0495601_0161324 3300053077 Bacteria 1465
632 Ga0500610_0000245 3300053079 Bacteria 16309
633 Ga0500635_0003989 3300053080 Bacteria 3763
634 Ga0495595_0076997 3300053084 Bacteria 1584
635 Ga0500643_000013 3300053087 Bacteria 324296
636 Ga0500643_000907 3300053087 Bacteria 18763
637 Ga0500643_019636 3300053087 Bacteria 2221
638 Ga0500566_0195178 3300053094 Bacteria 1027
639 Ga0500604_0008443 3300053151 Bacteria 2733
640 Ga0500616_0000048 3300053153 Bacteria 313108
641 Ga0500637_0001497 3300053178 Bacteria 9953
642 Ga0500637_0268437 3300053178 Bacteria 944
643 Ga0500552_016032 3300053733 Bacteria 1009
644 Ga0501084_0021045 3300054114 Bacteria 5441
645 Ga0501082_0001081 3300060353 Bacteria 24111
646 Ga0466962_0000351 3300061719 Bacteria 19774
647 Ga0466962_0001452 3300061719 Bacteria 11063
648 Ga0466962_0002771 3300061719 Bacteria 8326
649 Ga0530510_0691989 3300061734 Bacteria 777

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300028558 Ga0265326_10013291 Ga0265326_100132912 204
2 3300028563 Ga0265319_1011525 Ga0265319_10115252 204
3 3300028573 Ga0265334_10001994 Ga0265334_100019946 204
4 3300031235 Ga0265330_10004251 Ga0265330_100042516 204
5 3300031238 Ga0265332_10043191 Ga0265332_100431912 204
6 3300031239 Ga0265328_10061264 Ga0265328_100612642 204
7 3300031240 Ga0265320_10022663 Ga0265320_100226631 204
8 3300031241 Ga0265325_10018315 Ga0265325_100183154 204
9 3300031242 Ga0265329_10008609 Ga0265329_100086094 204
10 3300031249 Ga0265339_10013095 Ga0265339_100130953 204
11 3300031250 Ga0265331_10027740 Ga0265331_100277402 204
12 3300031344 Ga0265316_10114149 Ga0265316_101141492 204
13 3300031595 Ga0265313_10005711 Ga0265313_100057118 204
14 3300031711 Ga0265314_10015115 Ga0265314_100151156 204
15 3300031712 Ga0265342_10024197 Ga0265342_100241972 204
16 3300049822 Ga0501035_0338672 Ga0501035_0338672_90_767 209
17 3300005577 Ga0068857_100002222 Ga0068857_10000222210 211
18 3300039450 Ga0436363_0611592 Ga0436363_0611592_39_692 214
19 3300046460 Ga0495638_0011430 Ga0495638_0011430_2165_2857 218
20 3300046501 Ga0495607_0001801 Ga0495607_0001801_3337_4029 218
21 3300046506 Ga0495583_0007868 Ga0495583_0007868_3808_4500 218
22 3300046538 Ga0495609_0000202 Ga0495609_0000202_38430_39122 218
23 3300046616 Ga0495668_0012539 Ga0495668_0012539_3419_4111 218
24 3300046665 Ga0495661_0080411 Ga0495661_0080411_852_1544 218
25 3300046692 Ga0495671_0186924 Ga0495671_0186924_66_758 218
26 3300046694 Ga0495649_0011605 Ga0495649_0011605_3922_4614 218
27 3300047318 Ga0495636_0049605 Ga0495636_0049605_797_1489 218
28 3300047470 Ga0495681_0002600 Ga0495681_0002600_10542_11234 218
29 3300048928 Ga0496125_0469959 Ga0496125_0469959_27_686 219
30 3300003215 JGI25153J46596_10001253 JGI25153J46596_100012533 223
31 3300025272 Ga0209455_1010211 Ga0209455_10102113 223
32 3300025297 Ga0209758_1000185 Ga0209758_1000185129 223
33 iso_pu_bacteria 2990265787 2990268738 225
34 iso_pu_bacteria 2993693658 2993694555 225
35 3300048920 Ga0496117_0000600 Ga0496117_0000600_19154_19840 226
36 iso_pu_bacteria 2842698319 2842702324 226
37 iso_pu_bacteria 2842780639 2842783061 226
38 iso_pu_bacteria 8055225921 8055227416 226
39 3300002705 JGI25156J39149_1000479 JGI25156J39149_10004797 227
40 3300002705 JGI25156J39149_1020802 JGI25156J39149_10208022 227
41 3300002737 JGI25162J39368_1002475 JGI25162J39368_10024751 227
42 3300002737 JGI25162J39368_1003297 JGI25162J39368_10032974 227
43 3300002737 JGI25162J39368_1003914 JGI25162J39368_10039143 227
44 3300002741 JGI25157J39369_1000483 JGI25157J39369_10004838 227
45 3300002741 JGI25157J39369_1003426 JGI25157J39369_10034264 227
46 3300002772 JGI25164J39214_1000270 JGI25164J39214_10002705 227
47 3300003214 JGI25165J46597_1000487 JGI25165J46597_100048735 227
48 3300003756 Ga0055533_1001842 Ga0055533_10018422 227
49 3300003759 Ga0055525_1000030 Ga0055525_100003045 227
50 3300003760 Ga0055527_1000113 Ga0055527_10001136 227
51 3300003760 Ga0055527_1000142 Ga0055527_100014245 227
52 3300003760 Ga0055527_1000290 Ga0055527_100029025 227
53 3300003760 Ga0055527_1000341 Ga0055527_100034113 227
54 3300003761 Ga0055535_1000160 Ga0055535_100016027 227
55 3300003761 Ga0055535_1000257 Ga0055535_100025752 227
56 3300003761 Ga0055535_1001127 Ga0055535_10011275 227
57 3300003761 Ga0055535_1001465 Ga0055535_10014656 227
58 3300003762 Ga0055542_1000128 Ga0055542_100012845 227
59 3300003762 Ga0055542_1000294 Ga0055542_100029452 227
60 3300003762 Ga0055542_1000413 Ga0055542_100041336 227
61 3300003762 Ga0055542_1000776 Ga0055542_100077620 227
62 3300003763 Ga0055529_1000295 Ga0055529_10002956 227
63 3300003763 Ga0055529_1000429 Ga0055529_10004296 227
64 3300003763 Ga0055529_1000573 Ga0055529_10005738 227
65 3300003763 Ga0055529_1000754 Ga0055529_100075415 227
66 3300005614 Ga0068856_100001892 Ga0068856_1000018923 227
67 3300025226 Ga0209674_100111 Ga0209674_10011134 227
68 3300025228 Ga0209672_100004 Ga0209672_100004158 227
69 3300025228 Ga0209672_100008 Ga0209672_100008124 227
70 3300025228 Ga0209672_100229 Ga0209672_1002296 227
71 3300025228 Ga0209672_101094 Ga0209672_10109411 227
72 3300025230 Ga0209563_100028 Ga0209563_100028221 227
73 3300025231 Ga0207427_100252 Ga0207427_10025235 227
74 3300025233 Ga0209437_100391 Ga0209437_1003916 227
75 3300025242 Ga0209258_100003 Ga0209258_100003158 227
76 3300025242 Ga0209258_100004 Ga0209258_1000041066 227
77 3300025242 Ga0209258_100008 Ga0209258_100008691 227
78 3300025242 Ga0209258_100217 Ga0209258_10021762 227
79 3300025242 Ga0209258_100757 Ga0209258_1007576 227
80 3300025246 Ga0209646_1001082 Ga0209646_10010821 227
81 3300025250 Ga0209026_1000088 Ga0209026_100008835 227
82 3300025250 Ga0209026_1000578 Ga0209026_10005789 227
83 3300025253 Ga0209677_103999 Ga0209677_1039993 227
84 3300025254 Ga0209148_1000016 Ga0209148_1000016158 227
85 3300025254 Ga0209148_1000041 Ga0209148_1000041193 227
86 3300025254 Ga0209148_1000197 Ga0209148_100019761 227
87 3300025254 Ga0209148_1000473 Ga0209148_10004736 227
88 3300025256 Ga0209759_1000489 Ga0209759_100048910 227
89 3300025256 Ga0209759_1001276 Ga0209759_10012764 227
90 3300025261 Ga0209233_1000357 Ga0209233_100035735 227
91 3300025272 Ga0209455_1000004 Ga0209455_1000004158 227
92 3300025272 Ga0209455_1000007 Ga0209455_1000007811 227
93 3300025272 Ga0209455_1000356 Ga0209455_10003566 227
94 3300025272 Ga0209455_1005236 Ga0209455_10052365 227
95 3300026078 Ga0207702_10001234 Ga0207702_1000123418 227
96 3300031711 Ga0265314_10000144 Ga0265314_1000014472 227
97 3300037312 Ga0395899_0000057 Ga0395899_0000057_197670_198356 227
98 3300037312 Ga0395899_0002577 Ga0395899_0002577_5777_6463 227
99 3300037418 Ga0395900_0000035 Ga0395900_0000035_215452_216162 227
100 3300037466 Ga0395898_0000150 Ga0395898_0000150_37905_38591 227
101 3300038443 Ga0395901_0472064 Ga0395901_0472064_136_822 227
102 3300041452 Ga0451793_1763305 Ga0451793_1763305_850_1539 227
103 3300044656 Ga0466969_0005093 Ga0466969_0005093_4288_4998 227
104 3300044661 Ga0466975_0136558 Ga0466975_0136558_17_727 227
105 3300044663 Ga0466989_0015645 Ga0466989_0015645_554_1240 227
106 3300044684 Ga0466966_0028116 Ga0466966_0028116_1026_1712 227
107 3300044684 Ga0466966_0034284 Ga0466966_0034284_2382_3092 227
108 3300044693 Ga0466961_0000592 Ga0466961_0000592_8799_9485 227
109 3300044693 Ga0466961_0001406 Ga0466961_0001406_10647_11333 227
110 3300044693 Ga0466961_0003804 Ga0466961_0003804_8676_9386 227
111 3300044694 Ga0466963_0060932 Ga0466963_0060932_802_1488 227
112 3300044694 Ga0466963_0123603 Ga0466963_0123603_962_1648 227
113 3300044765 Ga0466970_0000413 Ga0466970_0000413_16595_17281 227
114 3300044765 Ga0466970_0010903 Ga0466970_0010903_2916_3626 227
115 3300044765 Ga0466970_0161903 Ga0466970_0161903_305_991 227
116 3300044842 Ga0466957_0000599 Ga0466957_0000599_5457_6143 227
117 3300044842 Ga0466957_0053446 Ga0466957_0053446_100_927 227
118 3300045049 Ga0466959_0000038 Ga0466959_0000038_71452_72162 227
119 3300045049 Ga0466959_0014309 Ga0466959_0014309_1079_1906 227
120 3300045049 Ga0466959_0030035 Ga0466959_0030035_2892_3578 227
121 3300045049 Ga0466959_0031645 Ga0466959_0031645_2479_3165 227
122 3300045836 Ga0466958_0009749 Ga0466958_0009749_3866_4552 227
123 3300045836 Ga0466958_0022342 Ga0466958_0022342_392_1078 227
124 3300045836 Ga0466958_0076958 Ga0466958_0076958_1093_1920 227
125 3300045976 Ga0466967_0189060 Ga0466967_0189060_533_1219 227
126 3300046460 Ga0495638_0000085 Ga0495638_0000085_88853_89542 227
127 3300046537 Ga0495598_0035793 Ga0495598_0035793_506_1189 227
128 3300049569 Ga0501032_0051473 Ga0501032_0051473_2011_2697 227
129 3300049570 Ga0501033_0029198 Ga0501033_0029198_1771_2457 227
130 3300049571 Ga0501034_0069489 Ga0501034_0069489_1429_2115 227
131 3300049572 Ga0501036_0186666 Ga0501036_0186666_584_1270 227
132 3300049579 Ga0501043_0025057 Ga0501043_0025057_369_1055 227
133 3300049581 Ga0501047_0041671 Ga0501047_0041671_316_1002 227
134 3300049586 Ga0501070_0386492 Ga0501070_0386492_400_1086 227
135 3300049822 Ga0501035_0272381 Ga0501035_0272381_312_998 227
136 3300049823 Ga0501044_0128698 Ga0501044_0128698_1283_1969 227
137 3300061719 Ga0466962_0001452 Ga0466962_0001452_5485_6312 227
138 3300061719 Ga0466962_0002771 Ga0466962_0002771_4926_5612 227
139 iso_pu_bacteria 2513237087 2513590549 227
140 iso_pu_bacteria 2739367700 2739733807 227
141 iso_pu_bacteria 2884411467 2884415545 227
142 iso_pu_bacteria 2887375801 2887377438 227
143 iso_pu_bacteria 2928963466 2928967080 227
144 iso_pu_bacteria 2946787523 2946787927 227
145 iso_pu_bacteria 643348564 643599387 227
146 3300005336 Ga0070680_100197455 Ga0070680_1001974551 228
147 3300005435 Ga0070714_100004122 Ga0070714_1000041227 228
148 3300005436 Ga0070713_100042543 Ga0070713_1000425432 228
149 3300005439 Ga0070711_100073428 Ga0070711_1000734282 228
150 3300005530 Ga0070679_100030406 Ga0070679_1000304063 228
151 3300005614 Ga0068856_100297394 Ga0068856_1002973942 228
152 3300006173 Ga0070716_100125424 Ga0070716_1001254242 228
153 3300025928 Ga0207700_10264391 Ga0207700_102643912 228
154 3300025929 Ga0207664_10032883 Ga0207664_100328832 228
155 3300036647 Ga0316582_0024616 Ga0316582_0024616_2650_3336 228
156 3300039438 Ga0436360_0448261 Ga0436360_0448261_608_1294 228
157 3300048904 Ga0496101_0655407 Ga0496101_0655407_132_818 228
158 3300048911 Ga0496108_0261608 Ga0496108_0261608_805_1491 228
159 3300050513 nmdc:mga0rr50_86922_c1 nmdc:mga0rr50_86922_c1_588_1274 228
160 iso_pu_bacteria 2599185292 2599907086 228
161 iso_pu_bacteria 2643221569 2643863292 228
162 iso_pu_bacteria 2643221594 2643978693 228
163 iso_pu_bacteria 2643221621 2644125132 228
164 iso_pu_bacteria 2643221651 2644289788 228
165 iso_pu_bacteria 2808606395 2809036550 228
166 iso_pu_bacteria 2857537821 2857541259 228
167 iso_pu_bacteria 2858950400 2858950423 228
168 iso_pu_bacteria 2941479691 2941481138 228
169 3300005436 Ga0070713_100277959 Ga0070713_1002779592 229
170 3300005445 Ga0070708_100135184 Ga0070708_1001351842 229
171 3300005468 Ga0070707_100230363 Ga0070707_1002303632 229
172 3300005471 Ga0070698_100050031 Ga0070698_1000500314 229
173 3300005518 Ga0070699_100073941 Ga0070699_1000739412 229
174 3300005536 Ga0070697_100298218 Ga0070697_1002982181 229
175 3300006173 Ga0070716_100184583 Ga0070716_1001845832 229
176 3300009093 Ga0105240_10829593 Ga0105240_108295931 229
177 3300009147 Ga0114129_10126778 Ga0114129_101267784 229
178 3300010375 Ga0105239_10000061 Ga0105239_10000061109 229
179 3300025910 Ga0207684_10274831 Ga0207684_102748312 229
180 3300025913 Ga0207695_10199978 Ga0207695_101999782 229
181 3300025922 Ga0207646_10036118 Ga0207646_100361182 229
182 3300025928 Ga0207700_10261112 Ga0207700_102611122 229
183 3300025939 Ga0207665_10103521 Ga0207665_101035212 229
184 3300028381 Ga0268264_10700146 Ga0268264_107001462 229
185 3300037471 Ga0395905_0002061 Ga0395905_0002061_12784_13473 229
186 3300048921 Ga0496118_0049197 Ga0496118_0049197_1143_1835 229
187 3300048924 Ga0496121_0000173 Ga0496121_0000173_34829_35521 229
188 3300048924 Ga0496121_0129175 Ga0496121_0129175_1181_1873 229
189 3300048929 Ga0496126_0019718 Ga0496126_0019718_106_798 229
190 3300050507 nmdc:mga05p37_105884_c1 nmdc:mga05p37_105884_c1_1317_2012 229
191 3300050512 nmdc:mga0n895_59314_c1 nmdc:mga0n895_59314_c1_848_1543 229
192 iso_pu_bacteria 2511231221 2512036416 229
193 iso_pu_bacteria 2595698237 2596377029 229
194 iso_pu_bacteria 2738541281 2738746443 229
195 iso_pu_bacteria 2738543032 2739355673 229
196 iso_pu_bacteria 2829745981 2829749506 229
197 iso_pu_bacteria 2861691609 2861693658 229
198 iso_pu_bacteria 2889306138 2889308323 229
199 iso_pu_bacteria 2897803580 2897807484 229
200 iso_pu_bacteria 2902330777 2902334699 229
201 iso_pu_bacteria 2902405164 2902405744 229
202 iso_pu_bacteria 2928125067 2928125094 229
203 iso_pu_bacteria 8054002106 8054003091 229
204 3300005435 Ga0070714_100012973 Ga0070714_1000129733 230
205 3300009177 Ga0105248_10163778 Ga0105248_101637782 230
206 3300009545 Ga0105237_10537236 Ga0105237_105372362 230
207 3300028379 Ga0268266_10489735 Ga0268266_104897351 230
208 3300046501 Ga0495607_0041643 Ga0495607_0041643_661_1356 230
209 3300046507 Ga0495606_0042688 Ga0495606_0042688_81_776 230
210 3300046513 Ga0495616_0140170 Ga0495616_0140170_329_1024 230
211 3300046519 Ga0495632_0140243 Ga0495632_0140243_196_891 230
212 3300046615 Ga0495656_0012426 Ga0495656_0012426_342_1034 230
213 3300046691 Ga0495670_0315938 Ga0495670_0315938_32_724 230
214 3300047318 Ga0495636_0122880 Ga0495636_0122880_116_808 230
215 3300047470 Ga0495681_0093144 Ga0495681_0093144_531_1226 230
216 3300048918 Ga0496115_0265384 Ga0496115_0265384_389_1105 230
217 3300048927 Ga0496124_0000022 Ga0496124_0000022_113533_114225 230
218 3300053087 Ga0500643_019636 Ga0500643_019636_856_1551 230
219 3300053178 Ga0500637_0001497 Ga0500637_0001497_8763_9476 230
220 3300001990 JGI24737J22298_10005705 JGI24737J22298_100057053 231
221 3300002705 JGI25156J39149_1008700 JGI25156J39149_10087001 231
222 3300002737 JGI25162J39368_1001129 JGI25162J39368_100112912 231
223 3300002737 JGI25162J39368_1002121 JGI25162J39368_10021212 231
224 3300002741 JGI25157J39369_1000584 JGI25157J39369_10005843 231
225 3300002771 JGI25163J39215_1000647 JGI25163J39215_10006471 231
226 3300002772 JGI25164J39214_1000428 JGI25164J39214_10004283 231
227 3300003214 JGI25165J46597_1000832 JGI25165J46597_10008322 231
228 3300003215 JGI25153J46596_10009999 JGI25153J46596_100099992 231
229 3300003322 rootL2_10007589 rootL2_100075892 231
230 3300003756 Ga0055533_1000439 Ga0055533_100043913 231
231 3300003759 Ga0055525_1000306 Ga0055525_100030631 231
232 3300003760 Ga0055527_1000060 Ga0055527_100006051 231
233 3300003761 Ga0055535_1000412 Ga0055535_100041231 231
234 3300003761 Ga0055535_1000907 Ga0055535_10009073 231
235 3300003762 Ga0055542_1000171 Ga0055542_100017138 231
236 3300003762 Ga0055542_1001114 Ga0055542_100111412 231
237 3300003762 Ga0055542_1001281 Ga0055542_100128110 231
238 3300003763 Ga0055529_1000388 Ga0055529_100038829 231
239 3300003763 Ga0055529_1000752 Ga0055529_10007523 231
240 3300005328 Ga0070676_10108474 Ga0070676_101084742 231
241 3300005330 Ga0070690_100012375 Ga0070690_1000123753 231
242 3300005336 Ga0070680_100184429 Ga0070680_1001844292 231
243 3300005336 Ga0070680_100197460 Ga0070680_1001974603 231
244 3300005339 Ga0070660_100218849 Ga0070660_1002188492 231
245 3300005340 Ga0070689_100001554 Ga0070689_1000015542 231
246 3300005353 Ga0070669_100237250 Ga0070669_1002372502 231
247 3300005354 Ga0070675_100050457 Ga0070675_1000504572 231
248 3300005364 Ga0070673_100101216 Ga0070673_1001012162 231
249 3300005366 Ga0070659_100073529 Ga0070659_1000735292 231
250 3300005436 Ga0070713_100324765 Ga0070713_1003247652 231
251 3300005439 Ga0070711_100236284 Ga0070711_1002362842 231
252 3300005445 Ga0070708_100009962 Ga0070708_1000099624 231
253 3300005455 Ga0070663_100028585 Ga0070663_1000285852 231
254 3300005455 Ga0070663_100075221 Ga0070663_1000752213 231
255 3300005455 Ga0070663_100102607 Ga0070663_1001026072 231
256 3300005457 Ga0070662_100355077 Ga0070662_1003550771 231
257 3300005458 Ga0070681_10035542 Ga0070681_100355424 231
258 3300005458 Ga0070681_10139023 Ga0070681_101390233 231
259 3300005458 Ga0070681_10157745 Ga0070681_101577455 231
260 3300005466 Ga0070685_10027920 Ga0070685_100279204 231
261 3300005468 Ga0070707_100017177 Ga0070707_1000171772 231
262 3300005530 Ga0070679_100017201 Ga0070679_1000172013 231
263 3300005530 Ga0070679_100330913 Ga0070679_1003309131 231
264 3300005536 Ga0070697_100133026 Ga0070697_1001330263 231
265 3300005539 Ga0068853_100337729 Ga0068853_1003377292 231
266 3300005563 Ga0068855_100020179 Ga0068855_1000201792 231
267 3300005563 Ga0068855_100108896 Ga0068855_1001088962 231
268 3300005563 Ga0068855_100142567 Ga0068855_1001425673 231
269 3300005578 Ga0068854_100002653 Ga0068854_1000026537 231
270 3300005578 Ga0068854_100015938 Ga0068854_1000159385 231
271 3300005615 Ga0070702_100253162 Ga0070702_1002531622 231
272 3300005616 Ga0068852_100137729 Ga0068852_1001377292 231
273 3300005834 Ga0068851_10000936 Ga0068851_100009367 231
274 3300005842 Ga0068858_100698750 Ga0068858_1006987502 231
275 3300005937 Ga0081455_10150107 Ga0081455_101501072 231
276 3300006175 Ga0070712_100230697 Ga0070712_1002306971 231
277 3300006847 Ga0075431_100019988 Ga0075431_1000199888 231
278 3300006852 Ga0075433_10265919 Ga0075433_102659192 231
279 3300006871 Ga0075434_100005412 Ga0075434_1000054127 231
280 3300006871 Ga0075434_100058711 Ga0075434_1000587113 231
281 3300007076 Ga0075435_100199657 Ga0075435_1001996572 231
282 3300009093 Ga0105240_10045931 Ga0105240_100459313 231
283 3300009093 Ga0105240_10054121 Ga0105240_100541215 231
284 3300009093 Ga0105240_10074999 Ga0105240_100749994 231
285 3300009147 Ga0114129_10576911 Ga0114129_105769113 231
286 3300009545 Ga0105237_10000112 Ga0105237_1000011288 231
287 3300009545 Ga0105237_10093677 Ga0105237_100936773 231
288 3300009551 Ga0105238_10097305 Ga0105238_100973054 231
289 3300009551 Ga0105238_10196312 Ga0105238_101963122 231
290 3300009982 Ga0105147_107285 Ga0105147_1072851 231
291 3300010375 Ga0105239_10117019 Ga0105239_101170193 231
292 3300012500 Ga0157314_1000010 Ga0157314_100001016 231
293 3300013100 Ga0157373_10182862 Ga0157373_101828621 231
294 3300013105 Ga0157369_10117285 Ga0157369_101172853 231
295 3300013306 Ga0163162_10060208 Ga0163162_100602083 231
296 3300014745 Ga0157377_10253111 Ga0157377_102531112 231
297 3300014969 Ga0157376_10098462 Ga0157376_100984622 231
298 3300015262 Ga0182007_10069049 Ga0182007_100690491 231
299 3300015687 Ga0183368_1002 Ga0183368_10021537 231
300 3300021361 Ga0213872_10002401 Ga0213872_1000240111 231
301 3300021361 Ga0213872_10029959 Ga0213872_100299592 231
302 3300021361 Ga0213872_10104153 Ga0213872_101041531 231
303 3300022734 Ga0224571_105624 Ga0224571_1056241 231
304 3300025206 Ga0209435_102319 Ga0209435_1023192 231
305 3300025206 Ga0209435_108715 Ga0209435_1087151 231
306 3300025207 Ga0209760_100718 Ga0209760_1007183 231
307 3300025224 Ga0209784_100074 Ga0209784_10007437 231
308 3300025225 Ga0209566_102088 Ga0209566_1020883 231
309 3300025226 Ga0209674_100068 Ga0209674_100068112 231
310 3300025228 Ga0209672_100043 Ga0209672_100043165 231
311 3300025228 Ga0209672_103526 Ga0209672_1035262 231
312 3300025230 Ga0209563_100062 Ga0209563_100062156 231
313 3300025231 Ga0207427_100079 Ga0207427_1000793 231
314 3300025231 Ga0207427_101437 Ga0207427_1014377 231
315 3300025233 Ga0209437_100163 Ga0209437_1001633 231
316 3300025233 Ga0209437_100379 Ga0209437_10037934 231
317 3300025233 Ga0209437_103389 Ga0209437_1033892 231
318 3300025242 Ga0209258_100076 Ga0209258_100076165 231
319 3300025242 Ga0209258_100671 Ga0209258_10067117 231
320 3300025242 Ga0209258_101469 Ga0209258_1014694 231
321 3300025242 Ga0209258_102547 Ga0209258_1025472 231
322 3300025246 Ga0209646_1002310 Ga0209646_10023104 231
323 3300025246 Ga0209646_1006223 Ga0209646_10062231 231
324 3300025250 Ga0209026_1000109 Ga0209026_1000109135 231
325 3300025250 Ga0209026_1001248 Ga0209026_10012487 231
326 3300025254 Ga0209148_1000001 Ga0209148_1000001135 231
327 3300025254 Ga0209148_1000002 Ga0209148_1000002124 231
328 3300025254 Ga0209148_1000082 Ga0209148_1000082165 231
329 3300025256 Ga0209759_1000441 Ga0209759_100044137 231
330 3300025256 Ga0209759_1008589 Ga0209759_10085891 231
331 3300025258 Ga0209129_1000696 Ga0209129_100069613 231
332 3300025261 Ga0209233_1000002 Ga0209233_10000022096 231
333 3300025261 Ga0209233_1028130 Ga0209233_10281301 231
334 3300025272 Ga0209455_1000078 Ga0209455_1000078165 231
335 3300025272 Ga0209455_1000079 Ga0209455_1000079216 231
336 3300025272 Ga0209455_1014346 Ga0209455_10143462 231
337 3300025297 Ga0209758_1000726 Ga0209758_100072638 231
338 3300025297 Ga0209758_1011013 Ga0209758_10110135 231
339 3300025321 Ga0207656_10021530 Ga0207656_100215302 231
340 3300025904 Ga0207647_10040567 Ga0207647_100405674 231
341 3300025912 Ga0207707_10008510 Ga0207707_100085105 231
342 3300025912 Ga0207707_10316013 Ga0207707_103160132 231
343 3300025913 Ga0207695_10004175 Ga0207695_100041755 231
344 3300025913 Ga0207695_10017482 Ga0207695_100174822 231
345 3300025913 Ga0207695_10049748 Ga0207695_100497484 231
346 3300025914 Ga0207671_10000009 Ga0207671_10000009125 231
347 3300025915 Ga0207693_10336810 Ga0207693_103368102 231
348 3300025917 Ga0207660_10017740 Ga0207660_100177401 231
349 3300025921 Ga0207652_10018181 Ga0207652_100181815 231
350 3300025921 Ga0207652_10028627 Ga0207652_100286271 231
351 3300025922 Ga0207646_10006618 Ga0207646_1000661811 231
352 3300025924 Ga0207694_10033668 Ga0207694_100336684 231
353 3300025926 Ga0207659_10061379 Ga0207659_100613793 231
354 3300025926 Ga0207659_10464961 Ga0207659_104649612 231
355 3300025933 Ga0207706_10015120 Ga0207706_100151204 231
356 3300025933 Ga0207706_10043672 Ga0207706_100436725 231
357 3300025936 Ga0207670_10040837 Ga0207670_100408374 231
358 3300025936 Ga0207670_10236785 Ga0207670_102367852 231
359 3300025939 Ga0207665_10146425 Ga0207665_101464252 231
360 3300025939 Ga0207665_10568814 Ga0207665_105688142 231
361 3300025949 Ga0207667_10001194 Ga0207667_100011945 231
362 3300025949 Ga0207667_10002016 Ga0207667_1000201617 231
363 3300025949 Ga0207667_10320992 Ga0207667_103209922 231
364 3300025981 Ga0207640_10001472 Ga0207640_100014727 231
365 3300025981 Ga0207640_10015593 Ga0207640_100155934 231
366 3300026067 Ga0207678_10049073 Ga0207678_100490733 231
367 3300026067 Ga0207678_10050297 Ga0207678_100502972 231
368 3300026067 Ga0207678_10090238 Ga0207678_100902382 231
369 3300026116 Ga0207674_10000145 Ga0207674_100001457 231
370 3300026142 Ga0207698_10005538 Ga0207698_100055383 231
371 3300026142 Ga0207698_10202622 Ga0207698_102026221 231
372 3300027907 Ga0207428_10050882 Ga0207428_100508823 231
373 3300027907 Ga0207428_10306359 Ga0207428_103063591 231
374 3300028380 Ga0268265_10085066 Ga0268265_100850663 231
375 3300028381 Ga0268264_10255248 Ga0268264_102552481 231
376 3300028381 Ga0268264_10718655 Ga0268264_107186552 231
377 3300030760 Ga0265762_1027671 Ga0265762_10276711 231
378 3300030763 Ga0265763_1000757 Ga0265763_10007572 231
379 3300031090 Ga0265760_10002084 Ga0265760_100020842 231
380 3300031711 Ga0265314_10008509 Ga0265314_100085093 231
381 3300031995 Ga0307409_100298389 Ga0307409_1002983893 231
382 3300035091 Ga0373951_0093135 Ga0373951_0093135_53_775 231
383 3300035113 Ga0373936_0039182 Ga0373936_0039182_588_1283 231
384 3300035115 Ga0373941_0041906 Ga0373941_0041906_192_887 231
385 3300035410 Ga0373924_0265187 Ga0373924_0265187_15_713 231
386 3300035724 Ga0373933_0452755 Ga0373933_0452755_18_722 231
387 3300036401 Ga0373937_0330237 Ga0373937_0330237_74_772 231
388 3300036401 Ga0373937_0546154 Ga0373937_0546154_330_1034 231
389 3300039437 Ga0436365_1638281 Ga0436365_1638281_249_956 231
390 3300039437 Ga0436365_1902360 Ga0436365_1902360_107_814 231
391 3300039447 Ga0436361_0049588 Ga0436361_0049588_661_1371 231
392 3300039447 Ga0436361_0205650 Ga0436361_0205650_203_910 231
393 3300039447 Ga0436361_0472131 Ga0436361_0472131_3693_4391 231
394 3300039447 Ga0436361_1106151 Ga0436361_1106151_1067_1762 231
395 3300044656 Ga0466969_0132900 Ga0466969_0132900_114_812 231
396 3300044658 Ga0466972_0044091 Ga0466972_0044091_70_768 231
397 3300044672 Ga0466982_0000006 Ga0466982_0000006_227934_228632 231
398 3300044683 Ga0466965_0128484 Ga0466965_0128484_160_858 231
399 3300044684 Ga0466966_0001181 Ga0466966_0001181_2051_2749 231
400 3300044706 Ga0466964_0010610 Ga0466964_0010610_2142_2840 231
401 3300044712 Ga0453684_0175244 Ga0453684_0175244_1586_2281 231
402 3300044765 Ga0466970_0039366 Ga0466970_0039366_1421_2119 231
403 3300044901 Ga0466960_0042067 Ga0466960_0042067_1115_1813 231
404 3300045049 Ga0466959_0388619 Ga0466959_0388619_166_864 231
405 3300045051 Ga0451576_0208489 Ga0451576_0208489_78_773 231
406 3300045976 Ga0466967_0176951 Ga0466967_0176951_1109_1807 231
407 3300046460 Ga0495638_0000541 Ga0495638_0000541_17305_18003 231
408 3300046460 Ga0495638_0001761 Ga0495638_0001761_8199_8897 231
409 3300046471 Ga0495650_0000333 Ga0495650_0000333_25397_26095 231
410 3300046501 Ga0495607_0022701 Ga0495607_0022701_2195_2890 231
411 3300046507 Ga0495606_0000746 Ga0495606_0000746_46844_47542 231
412 3300046536 Ga0495587_0042600 Ga0495587_0042600_116_814 231
413 3300046542 Ga0495597_0043110 Ga0495597_0043110_694_1392 231
414 3300046557 Ga0495622_0015305 Ga0495622_0015305_1281_1979 231
415 3300046660 Ga0495625_0024884 Ga0495625_0024884_1587_2285 231
416 3300046660 Ga0495625_0122986 Ga0495625_0122986_956_1654 231
417 3300046678 Ga0495599_0304711 Ga0495599_0304711_227_931 231
418 3300046694 Ga0495649_0001096 Ga0495649_0001096_14145_14843 231
419 3300047320 Ga0495672_0000019 Ga0495672_0000019_395306_396016 231
420 3300048905 Ga0496102_0848208 Ga0496102_0848208_48_743 231
421 3300048907 Ga0496104_0292752 Ga0496104_0292752_752_1450 231
422 3300048911 Ga0496108_0405257 Ga0496108_0405257_373_1068 231
423 3300048916 Ga0496113_0006522 Ga0496113_0006522_2436_3134 231
424 3300048917 Ga0496114_0207266 Ga0496114_0207266_622_1320 231
425 3300048918 Ga0496115_0000804 Ga0496115_0000804_15323_16021 231
426 3300048918 Ga0496115_0004756 Ga0496115_0004756_6229_6927 231
427 3300048928 Ga0496125_0000251 Ga0496125_0000251_28431_29129 231
428 3300048929 Ga0496126_0032547 Ga0496126_0032547_1517_2215 231
429 3300048929 Ga0496126_0338248 Ga0496126_0338248_59_757 231
430 3300049459 Ga0495678_025175 Ga0495678_025175_1152_1862 231
431 3300049459 Ga0495678_039654 Ga0495678_039654_589_1287 231
432 3300049580 Ga0501046_0006258 Ga0501046_0006258_4544_5278 231
433 3300049581 Ga0501047_0288352 Ga0501047_0288352_131_865 231
434 3300050509 nmdc:mga0qj67_757989_c1 nmdc:mga0qj67_757989_c1_28_723 231
435 3300050512 nmdc:mga0n895_220793_c1 nmdc:mga0n895_220793_c1_767_1468 231
436 3300050512 nmdc:mga0n895_8703_c1 nmdc:mga0n895_8703_c1_5807_6502 231
437 3300053077 Ga0495601_0161324 Ga0495601_0161324_130_828 231
438 3300060353 Ga0501082_0001081 Ga0501082_0001081_8024_8758 231
439 3300061719 Ga0466962_0000351 Ga0466962_0000351_5618_6316 231
440 3300061734 Ga0530510_0691989 Ga0530510_0691989_51_746 231
441 iso_pu_bacteria 2643221609 2644060220 231
442 iso_pu_bacteria 2643221611 2644076017 231
443 3300005295 Ga0065707_10100611 Ga0065707_101006112 232
444 3300005364 Ga0070673_100163402 Ga0070673_1001634022 232
445 3300005434 Ga0070709_10214040 Ga0070709_102140402 232
446 3300005435 Ga0070714_100171241 Ga0070714_1001712412 232
447 3300005436 Ga0070713_100001562 Ga0070713_1000015624 232
448 3300005536 Ga0070697_100419715 Ga0070697_1004197152 232
449 3300005547 Ga0070693_100012025 Ga0070693_1000120255 232
450 3300005842 Ga0068858_100144312 Ga0068858_1001443122 232
451 3300006051 Ga0075364_10035088 Ga0075364_100350883 232
452 3300006186 Ga0075369_10030921 Ga0075369_100309212 232
453 3300006195 Ga0075366_10003143 Ga0075366_100031432 232
454 3300006237 Ga0097621_100024293 Ga0097621_1000242933 232
455 3300006358 Ga0068871_100007696 Ga0068871_1000076967 232
456 3300006847 Ga0075431_100042754 Ga0075431_1000427543 232
457 3300006852 Ga0075433_10395832 Ga0075433_103958322 232
458 3300006871 Ga0075434_100009536 Ga0075434_1000095362 232
459 3300006880 Ga0075429_100115587 Ga0075429_1001155871 232
460 3300006914 Ga0075436_100005990 Ga0075436_1000059906 232
461 3300009011 Ga0105251_10002726 Ga0105251_1000272612 232
462 3300009036 Ga0105244_10080285 Ga0105244_100802852 232
463 3300009093 Ga0105240_10031713 Ga0105240_100317133 232
464 3300009098 Ga0105245_10111298 Ga0105245_101112982 232
465 3300009147 Ga0114129_10058975 Ga0114129_100589754 232
466 3300009147 Ga0114129_10533595 Ga0114129_105335952 232
467 3300009148 Ga0105243_10125125 Ga0105243_101251253 232
468 3300009176 Ga0105242_10017145 Ga0105242_100171455 232
469 3300009176 Ga0105242_10143183 Ga0105242_101431832 232
470 3300009176 Ga0105242_10349991 Ga0105242_103499912 232
471 3300009177 Ga0105248_10092018 Ga0105248_100920185 232
472 3300009177 Ga0105248_10457848 Ga0105248_104578483 232
473 3300009553 Ga0105249_10252758 Ga0105249_102527583 232
474 3300013297 Ga0157378_10052337 Ga0157378_100523375 232
475 3300013306 Ga0163162_10051973 Ga0163162_100519732 232
476 3300013307 Ga0157372_10002320 Ga0157372_1000232010 232
477 3300013308 Ga0157375_11194103 Ga0157375_111941031 232
478 3300014326 Ga0157380_10008810 Ga0157380_100088108 232
479 3300014326 Ga0157380_10053656 Ga0157380_100536563 232
480 3300025292 Ga0209676_1017627 Ga0209676_10176272 232
481 3300025298 Ga0209050_1002993 Ga0209050_10029934 232
482 3300025728 Ga0207655_1011838 Ga0207655_10118382 232
483 3300025728 Ga0207655_1055154 Ga0207655_10551542 232
484 3300025735 Ga0207713_1000078 Ga0207713_100007828 232
485 3300025906 Ga0207699_10114972 Ga0207699_101149722 232
486 3300025909 Ga0207705_10033478 Ga0207705_100334783 232
487 3300025909 Ga0207705_10069160 Ga0207705_100691602 232
488 3300025913 Ga0207695_10069643 Ga0207695_100696432 232
489 3300025918 Ga0207662_10101193 Ga0207662_101011931 232
490 3300025918 Ga0207662_10187892 Ga0207662_101878922 232
491 3300025922 Ga0207646_10409019 Ga0207646_104090191 232
492 3300025928 Ga0207700_10311770 Ga0207700_103117702 232
493 3300025934 Ga0207686_10137772 Ga0207686_101377722 232
494 3300025934 Ga0207686_10145005 Ga0207686_101450052 232
495 3300025942 Ga0207689_10218151 Ga0207689_102181512 232
496 3300025960 Ga0207651_10212591 Ga0207651_102125912 232
497 3300025981 Ga0207640_10472812 Ga0207640_104728122 232
498 3300026035 Ga0207703_10010532 Ga0207703_100105327 232
499 3300027907 Ga0207428_10150156 Ga0207428_101501562 232
500 3300027907 Ga0207428_10152719 Ga0207428_101527192 232
501 3300031911 Ga0307412_10001318 Ga0307412_100013182 232
502 3300036401 Ga0373937_0016031 Ga0373937_0016031_1274_2008 232
503 3300037312 Ga0395899_0179696 Ga0395899_0179696_759_1466 232
504 3300037418 Ga0395900_0124721 Ga0395900_0124721_539_1270 232
505 3300038443 Ga0395901_0015566 Ga0395901_0015566_4906_5637 232
506 3300046453 Ga0495627_002096 Ga0495627_002096_4368_5078 232
507 3300046454 Ga0495592_0070495 Ga0495592_0070495_851_1585 232
508 3300046458 Ga0495591_000755 Ga0495591_000755_4950_5660 232
509 3300046462 Ga0495651_0064916 Ga0495651_0064916_1397_2131 232
510 3300046477 Ga0495664_0029070 Ga0495664_0029070_1567_2307 232
511 3300046513 Ga0495616_0000017 Ga0495616_0000017_144907_145683 232
512 3300046516 Ga0495628_0038088 Ga0495628_0038088_1579_2313 232
513 3300046536 Ga0495587_0005777 Ga0495587_0005777_5143_5877 232
514 3300046543 Ga0495645_0000615 Ga0495645_0000615_771_1505 232
515 3300046559 Ga0495667_0011017 Ga0495667_0011017_2284_3018 232
516 3300046679 Ga0495623_0035123 Ga0495623_0035123_655_1389 232
517 3300046680 Ga0495646_0197122 Ga0495646_0197122_175_909 232
518 3300046691 Ga0495670_0012637 Ga0495670_0012637_3396_4106 232
519 3300046809 Ga0495600_0055926 Ga0495600_0055926_958_1692 232
520 3300047317 Ga0495604_0127161 Ga0495604_0127161_640_1341 232
521 3300047322 Ga0495680_0307881 Ga0495680_0307881_180_914 232
522 3300048916 Ga0496113_0449165 Ga0496113_0449165_153_863 232
523 3300048919 Ga0496116_0000963 Ga0496116_0000963_14861_15562 232
524 3300048920 Ga0496117_0055735 Ga0496117_0055735_628_1338 232
525 3300048921 Ga0496118_0034179 Ga0496118_0034179_2523_3224 232
526 3300048921 Ga0496118_0118265 Ga0496118_0118265_793_1503 232
527 3300048923 Ga0496120_0001845 Ga0496120_0001845_1683_2405 232
528 3300048924 Ga0496121_0000124 Ga0496121_0000124_49377_50078 232
529 3300048924 Ga0496121_0001793 Ga0496121_0001793_6506_7213 232
530 3300048924 Ga0496121_0007834 Ga0496121_0007834_3301_4011 232
531 3300048924 Ga0496121_0222469 Ga0496121_0222469_574_1275 232
532 3300048925 Ga0496122_0000316 Ga0496122_0000316_46168_46869 232
533 3300048925 Ga0496122_0001658 Ga0496122_0001658_11555_12265 232
534 3300048926 Ga0496123_0000297 Ga0496123_0000297_46168_46869 232
535 3300048926 Ga0496123_0000891 Ga0496123_0000891_19523_20233 232
536 3300048927 Ga0496124_0106993 Ga0496124_0106993_639_1340 232
537 3300048927 Ga0496124_0315709 Ga0496124_0315709_140_841 232
538 3300048928 Ga0496125_0000116 Ga0496125_0000116_1691_2392 232
539 3300048928 Ga0496125_0004591 Ga0496125_0004591_4121_4822 232
540 3300048928 Ga0496125_0114148 Ga0496125_0114148_71_772 232
541 3300048929 Ga0496126_0018569 Ga0496126_0018569_6153_6857 232
542 3300048929 Ga0496126_0028900 Ga0496126_0028900_1884_2585 232
543 3300048929 Ga0496126_0047418 Ga0496126_0047418_348_1079 232
544 3300048929 Ga0496126_0564237 Ga0496126_0564237_103_804 232
545 3300049568 Ga0501031_0044965 Ga0501031_0044965_515_1216 232
546 3300049568 Ga0501031_0244118 Ga0501031_0244118_27_737 232
547 3300049569 Ga0501032_0074725 Ga0501032_0074725_1252_1995 232
548 3300049570 Ga0501033_0001220 Ga0501033_0001220_5084_5785 232
549 3300049572 Ga0501036_0047624 Ga0501036_0047624_1684_2427 232
550 3300049573 Ga0501037_0109328 Ga0501037_0109328_794_1537 232
551 3300049573 Ga0501037_0359594 Ga0501037_0359594_176_877 232
552 3300049579 Ga0501043_0118681 Ga0501043_0118681_815_1516 232
553 3300049579 Ga0501043_0275619 Ga0501043_0275619_17_760 232
554 3300049580 Ga0501046_0320072 Ga0501046_0320072_136_837 232
555 3300049581 Ga0501047_0091049 Ga0501047_0091049_318_1019 232
556 3300049581 Ga0501047_0711528 Ga0501047_0711528_98_796 232
557 3300049586 Ga0501070_0287040 Ga0501070_0287040_625_1323 232
558 3300049591 Ga0501075_0269397 Ga0501075_0269397_379_1077 232
559 3300049592 Ga0501076_0471865 Ga0501076_0471865_200_898 232
560 3300049592 Ga0501076_0672753 Ga0501076_0672753_85_783 232
561 3300049743 Ga0501081_0134808 Ga0501081_0134808_179_877 232
562 3300049744 Ga0501083_0145130 Ga0501083_0145130_702_1445 232
563 3300049822 Ga0501035_0058713 Ga0501035_0058713_2498_3202 232
564 3300049823 Ga0501044_0116589 Ga0501044_0116589_1875_2576 232
565 3300049823 Ga0501044_0238399 Ga0501044_0238399_278_979 232
566 3300049823 Ga0501044_0240696 Ga0501044_0240696_543_1286 232
567 3300050510 nmdc:mga06r32_105824_c1 nmdc:mga06r32_105824_c1_2032_2736 232
568 3300050512 nmdc:mga0n895_144431_c1 nmdc:mga0n895_144431_c1_1270_2004 232
569 3300050513 nmdc:mga0rr50_23915_c1 nmdc:mga0rr50_23915_c1_271_1005 232
570 3300050514 nmdc:mga08x19_19639_c1 nmdc:mga08x19_19639_c1_3233_3967 232
571 3300050515 nmdc:mga0a205_389547_c1 nmdc:mga0a205_389547_c1_537_1238 232
572 3300050515 nmdc:mga0a205_432957_c1 nmdc:mga0a205_432957_c1_359_1093 232
573 3300050515 nmdc:mga0a205_84048_c1 nmdc:mga0a205_84048_c1_1499_2197 232
574 3300053077 Ga0495601_0048292 Ga0495601_0048292_428_1162 232
575 3300053079 Ga0500610_0000245 Ga0500610_0000245_5443_6198 232
576 3300053084 Ga0495595_0076997 Ga0495595_0076997_167_901 232
577 3300053087 Ga0500643_000907 Ga0500643_000907_5058_5777 232
578 3300053151 Ga0500604_0008443 Ga0500604_0008443_1301_2017 232
579 3300053153 Ga0500616_0000048 Ga0500616_0000048_193908_194609 232
580 3300003320 rootH2_10006370 rootH2_100063707 233
581 3300005355 Ga0070671_100228133 Ga0070671_1002281332 233
582 3300006051 Ga0075364_10318975 Ga0075364_103189752 233
583 3300009093 Ga0105240_10000197 Ga0105240_1000019714 233
584 3300009093 Ga0105240_10000199 Ga0105240_1000019912 233
585 3300010375 Ga0105239_10000054 Ga0105239_1000005480 233
586 3300025228 Ga0209672_100416 Ga0209672_1004164 233
587 3300025913 Ga0207695_10000207 Ga0207695_10000207106 233
588 3300025913 Ga0207695_10000746 Ga0207695_1000074619 233
589 3300025922 Ga0207646_10411577 Ga0207646_104115772 233
590 3300028379 Ga0268266_10000002 Ga0268266_100000022665 233
591 3300031903 Ga0307407_10018217 Ga0307407_100182173 233
592 3300037418 Ga0395900_0285532 Ga0395900_0285532_401_1246 233
593 3300037466 Ga0395898_0731258 Ga0395898_0731258_20_727 233
594 3300044735 Ga0466968_0089163 Ga0466968_0089163_186_893 233
595 3300045051 Ga0451576_0001130 Ga0451576_0001130_11215_11940 233
596 3300048904 Ga0496101_0025249 Ga0496101_0025249_1791_2495 233
597 3300048905 Ga0496102_0446357 Ga0496102_0446357_399_1103 233
598 3300048905 Ga0496102_0581823 Ga0496102_0581823_51_755 233
599 3300048906 Ga0496103_0120378 Ga0496103_0120378_792_1496 233
600 3300048907 Ga0496104_0046169 Ga0496104_0046169_2093_2797 233
601 3300048908 Ga0496105_0001283 Ga0496105_0001283_6847_7551 233
602 3300048909 Ga0496106_0037410 Ga0496106_0037410_1144_1848 233
603 3300048910 Ga0496107_0146647 Ga0496107_0146647_444_1148 233
604 3300048918 Ga0496115_0007399 Ga0496115_0007399_1707_2411 233
605 3300048920 Ga0496117_0000873 Ga0496117_0000873_10336_11040 233
606 3300048920 Ga0496117_0023471 Ga0496117_0023471_2502_3206 233
607 3300048921 Ga0496118_0004285 Ga0496118_0004285_12252_12956 233
608 3300048921 Ga0496118_0010232 Ga0496118_0010232_5961_6665 233
609 3300048922 Ga0496119_0000149 Ga0496119_0000149_86695_87399 233
610 3300048922 Ga0496119_0008280 Ga0496119_0008280_6541_7245 233
611 3300048923 Ga0496120_0000841 Ga0496120_0000841_22187_22891 233
612 3300048923 Ga0496120_0000982 Ga0496120_0000982_2419_3123 233
613 3300048924 Ga0496121_0000542 Ga0496121_0000542_24240_24941 233
614 3300048924 Ga0496121_0000543 Ga0496121_0000543_19170_19874 233
615 3300048924 Ga0496121_0037774 Ga0496121_0037774_3077_3781 233
616 3300048924 Ga0496121_0059126 Ga0496121_0059126_403_1107 233
617 3300048925 Ga0496122_0060307 Ga0496122_0060307_1181_1888 233
618 3300048929 Ga0496126_0000259 Ga0496126_0000259_13895_14599 233
619 3300048929 Ga0496126_0054167 Ga0496126_0054167_1322_2026 233
620 3300048929 Ga0496126_0120884 Ga0496126_0120884_430_1140 233
621 3300049570 Ga0501033_0318287 Ga0501033_0318287_48_758 233
622 3300049571 Ga0501034_0132424 Ga0501034_0132424_1373_2077 233
623 3300049572 Ga0501036_0029254 Ga0501036_0029254_1362_2072 233
624 3300049577 Ga0501041_0052101 Ga0501041_0052101_867_1577 233
625 3300049578 Ga0501042_0004920 Ga0501042_0004920_4891_5601 233
626 3300049581 Ga0501047_0032550 Ga0501047_0032550_3444_4148 233
627 3300049581 Ga0501047_0416996 Ga0501047_0416996_240_947 233
628 3300049587 Ga0501071_0101632 Ga0501071_0101632_1078_1788 233
629 3300049592 Ga0501076_0339609 Ga0501076_0339609_97_807 233
630 3300049822 Ga0501035_0129494 Ga0501035_0129494_550_1254 233
631 3300049824 Ga0501045_0187853 Ga0501045_0187853_625_1335 233
632 3300050511 nmdc:mga08y16_381559_c1 nmdc:mga08y16_381559_c1_556_1257 233
633 3300054114 Ga0501084_0021045 Ga0501084_0021045_1426_2136 233
634 3300006880 Ga0075429_100228905 Ga0075429_1002289052 234
635 3300050508 nmdc:mga09592_224349_c1 nmdc:mga09592_224349_c1_639_1349 234
636 3300001989 JGI24739J22299_10017019 JGI24739J22299_100170193 235
637 3300005434 Ga0070709_10013558 Ga0070709_100135584 235
638 3300005435 Ga0070714_100028985 Ga0070714_1000289851 235
639 3300005539 Ga0068853_100110363 Ga0068853_1001103633 235
640 3300005563 Ga0068855_100042682 Ga0068855_1000426823 235
641 3300005577 Ga0068857_100056162 Ga0068857_1000561623 235
642 3300005614 Ga0068856_100069266 Ga0068856_1000692663 235
643 3300005843 Ga0068860_100000548 Ga0068860_10000054825 235
644 3300006237 Ga0097621_100090181 Ga0097621_1000901812 235
645 3300009093 Ga0105240_10107999 Ga0105240_101079993 235
646 3300009101 Ga0105247_10032660 Ga0105247_100326601 235
647 3300009174 Ga0105241_10133884 Ga0105241_101338842 235
648 3300009545 Ga0105237_10272967 Ga0105237_102729672 235
649 3300011119 Ga0105246_10009096 Ga0105246_100090965 235
650 3300013105 Ga0157369_10009042 Ga0157369_1000904212 235
651 3300020077 Ga0206351_10683695 Ga0206351_106836952 235
652 3300025900 Ga0207710_10015747 Ga0207710_100157475 235
653 3300025904 Ga0207647_10002237 Ga0207647_100022373 235
654 3300025913 Ga0207695_10247819 Ga0207695_102478193 235
655 3300025924 Ga0207694_10074422 Ga0207694_100744223 235
656 3300025949 Ga0207667_10096775 Ga0207667_100967752 235
657 3300026041 Ga0207639_10066797 Ga0207639_100667971 235
658 3300026067 Ga0207678_10060739 Ga0207678_100607393 235
659 3300026078 Ga0207702_10030769 Ga0207702_100307693 235
660 3300026116 Ga0207674_10004815 Ga0207674_100048153 235
661 3300026142 Ga0207698_10345082 Ga0207698_103450821 235
662 3300030521 Ga0307511_10055431 Ga0307511_100554315 235
663 3300031616 Ga0307508_10048633 Ga0307508_100486331 235
664 3300031730 Ga0307516_10085295 Ga0307516_100852953 235
665 3300033179 Ga0307507_10070636 Ga0307507_100706363 235
666 3300035692 Ga0373935_0030160 Ga0373935_0030160_1775_2482 235
667 3300037068 Ga0373925_0057500 Ga0373925_0057500_412_1119 235
668 3300039437 Ga0436365_0402584 Ga0436365_0402584_163_870 235
669 3300039447 Ga0436361_0211450 Ga0436361_0211450_29_736 235
670 3300039450 Ga0436363_0124313 Ga0436363_0124313_713_1420 235
671 3300046557 Ga0495622_0016634 Ga0495622_0016634_217_924 235
672 3300047320 Ga0495672_0010209 Ga0495672_0010209_1067_1843 235
673 3300048909 Ga0496106_0106223 Ga0496106_0106223_735_1442 235
674 3300048921 Ga0496118_0054089 Ga0496118_0054089_1997_2704 235
675 3300048922 Ga0496119_0253243 Ga0496119_0253243_27_734 235
676 3300048924 Ga0496121_0042695 Ga0496121_0042695_2225_2932 235
677 3300048927 Ga0496124_0041712 Ga0496124_0041712_235_942 235
678 3300048929 Ga0496126_0112122 Ga0496126_0112122_318_1025 235
679 3300048929 Ga0496126_0172737 Ga0496126_0172737_213_920 235
680 3300053080 Ga0500635_0003989 Ga0500635_0003989_607_1314 235
681 3300053087 Ga0500643_000013 Ga0500643_000013_212520_213227 235
682 3300053094 Ga0500566_0195178 Ga0500566_0195178_113_820 235
683 3300053178 Ga0500637_0268437 Ga0500637_0268437_58_765 235
684 3300053733 Ga0500552_016032 Ga0500552_016032_107_814 235

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

46

127

0.94

PF00043

GST_C

Glutathione S-transferase, C-terminal domain

157

243

0.91

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

55

128

0.89

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

50

131

0.88

PF13410

GST_C_2

Glutathione S-transferase, C-terminal domain

173

238

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
5hfk-assembly1.cif.gz_B crystal structure of a glutathione s-transferase protein from escherichia coli och 157:h7 str. sakai (ecs3186, target efi-507414) with bound glutathione 0.9905 1 203
3gx0-assembly1.cif.gz_A-2 crystal structure of gsh-dependent disulfide bond oxidoreductase 0.9862 1 202
4l8e-assembly1.cif.gz_A-2 crystal structure of a glutathione transferase family member from xenorhabdus nematophila, target efi-507418, with two gsh per subunit 0.9775 3 202
5hfk-assembly1.cif.gz_B crystal structure of a glutathione s-transferase protein from escherichia coli och 157:h7 str. sakai (ecs3186, target efi-507414) with bound glutathione 0.9762 1 203
6tah-assembly1.cif.gz_CAA crystal structure of a nu-class glutathione-s-transferase from pseudomonas aeruginosa pacs2 bound to glutathione 0.9739 1 201
ID Description Score Start End Superfamily
af_P77526_1_85_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9917 1 84 3.40.30.10
af_P77526_93_209_1.20.1050.130 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9907 94 207 1.20.1050.130
4l8eA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9888 3 86 3.40.30.10
af_P77526_87_192_1.20.1050.10 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9882 87 190 1.20.1050.10
4f0bB02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9825 93 195 1.20.1050.10
ID Description Score Start End GO Terms
AF-A0A4Q5PD99-F1-model_v4 Thiol:disulfide oxidoreductase 0.9982 76 208
AF-A0A2A2TBE1-F1-model_v4 Thiol:disulfide oxidoreductase 0.9975 1 209
AF-T1D8R9-F1-model_v4 Glutathione S-transferase domain-containing protein 0.9964 1 139 GO:0016740
AF-A0A0S8AWI8-F1-model_v4 Glutathione S-transferase 0.9959 1 100 GO:0016740
AF-A0A3M4YC52-F1-model_v4 Glutathione S-transferase 0.9954 1 210 GO:0016740

Feature Viewer

pLDDT pTM Quality
95.06 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map