F475016

General Info

Members Datasets Scaffolds Average Seq Length
683 253 683 289

Family's Representative Sequence

Representative Sequence 3300050508|nmdc:mga09592_76681_c1|nmdc:mga09592_76681_c1_136_1035
Length 267
Sequence MLFLFAEAEHAEEAAHHAPIIVRLVNQYFGEYVYNLEMKYTYPRWKWFLAKFGTTPEAAFGAYTPENAIPWYTIMFVIACILSVLIIWVLKGKLSEDEPGGGQQTLEASVLAVRGMLQDIVGPHGLQYFPVVMTFAVLILVSNLMALGLSSFLYYNYIGIKENGIVKHLAHLAGPIWWIAPLIFPIELISNFIRPFSLGIRLFGNMFADEQVMETISHLIPGITYWIVPVLIMPLSLFVCFIQTFVFVLLSQLYLSEVSHAAVAVAA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300001432 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
72 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
83 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
161 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
165 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
166 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
167 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
168 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
169 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
170 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
171 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
172 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
173 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
174 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
176 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
177 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
178 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
179 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
180 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
181 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
182 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
183 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
184 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
185 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
186 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
187 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
188 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
189 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
190 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
191 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
192 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
193 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
194 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
195 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
196 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
197 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
198 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
199 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
200 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
201 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
202 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
203 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
204 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
205 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
206 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
207 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
208 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
209 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
210 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
211 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
212 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
213 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
214 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
215 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
216 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
217 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
218 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
219 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
220 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
221 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
222 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
223 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
224 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
225 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
226 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
227 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
228 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
229 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
230 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
231 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
232 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
233 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
234 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
235 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
236 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
237 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
238 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
239 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
240 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
241 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
242 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
243 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
244 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
245 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
246 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
247 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
248 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
249 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
250 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
251 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
252 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
253 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.46
Rhizosphere 98.24
Stem 0
Stem Tuber 0
Unclassified 0.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1039737 2162886007 Unclassified 2616
2 JGI24034J14986_100205 3300001432 Unclassified 3110
3 JGI24737J22298_10020719 3300001990 Unclassified 2097
4 JGI24748J21848_1000020 3300002074 Bacteria 114324
5 JGI24034J26672_10000002 3300002239 Bacteria 925353
6 JGI24751J29686_10000006 3300002459 Bacteria 134556
7 rootH2_10113728 3300003320 Bacteria 1548
8 rootL2_10085343 3300003322 Bacteria 2356
9 Ga0065714_10064454 3300005288 Bacteria 72991
10 Ga0065704_10020787 3300005289 Unclassified 1469
11 Ga0065704_10075229 3300005289 Bacteria 5716
12 Ga0065712_10000129 3300005290 Bacteria 72972
13 Ga0065712_10002929 3300005290 Unclassified 4389
14 Ga0065715_10094019 3300005293 Unclassified 4470
15 Ga0065715_10094065 3300005293 Bacteria 4455
16 Ga0065715_10094761 3300005293 Unclassified 4247
17 Ga0065715_10108203 3300005293 Unclassified 2726
18 Ga0065715_10145744 3300005293 Bacteria 1783
19 Ga0065707_10001198 3300005295 Bacteria 15411
20 Ga0065707_10010192 3300005295 Bacteria 2204
21 Ga0065707_10040848 3300005295 Unclassified 1083
22 Ga0065707_10120641 3300005295 Unclassified 2129
23 Ga0065707_10171915 3300005295 Bacteria 1462
24 Ga0065707_10247540 3300005295 Unclassified 1135
25 Ga0070690_100022746 3300005330 Unclassified 3838
26 Ga0070670_100000739 3300005331 Bacteria 25384
27 Ga0070670_100027974 3300005331 Bacteria 4852
28 Ga0070670_100057214 3300005331 Unclassified 3348
29 Ga0070670_100057826 3300005331 Bacteria 3328
30 Ga0070670_100142637 3300005331 Unclassified 2072
31 Ga0070670_100285306 3300005331 Unclassified 1442
32 Ga0068869_100006951 3300005334 Bacteria 7202
33 Ga0068869_100049526 3300005334 Bacteria 3041
34 Ga0068869_100053833 3300005334 Unclassified 2927
35 Ga0068869_100058635 3300005334 Unclassified 2816
36 Ga0070666_10086651 3300005335 Bacteria 2146
37 Ga0070666_10287327 3300005335 Bacteria 1170
38 Ga0070680_100005606 3300005336 Bacteria 9508
39 Ga0070682_100000053 3300005337 Bacteria 114824
40 Ga0070682_100110224 3300005337 Unclassified 1833
41 Ga0068868_100036486 3300005338 Unclassified 3805
42 Ga0068868_100097169 3300005338 Unclassified 2380
43 Ga0068868_100149230 3300005338 Bacteria 1924
44 Ga0070660_100031027 3300005339 Unclassified 4012
45 Ga0070689_100000228 3300005340 Bacteria 33646
46 Ga0070689_100043886 3300005340 Bacteria 3439
47 Ga0070689_100166012 3300005340 Bacteria 1787
48 Ga0070689_100301283 3300005340 Unclassified 1334
49 Ga0070687_100019746 3300005343 Bacteria 3140
50 Ga0070687_100079243 3300005343 Unclassified 1787
51 Ga0070692_10014359 3300005345 Unclassified 3719
52 Ga0070692_10017150 3300005345 Bacteria 3457
53 Ga0070692_10040676 3300005345 Bacteria 2379
54 Ga0070692_10139726 3300005345 Bacteria 1370
55 Ga0070668_100033984 3300005347 Bacteria 3886
56 Ga0070669_100020321 3300005353 Bacteria 4742
57 Ga0070669_100132319 3300005353 Unclassified 1915
58 Ga0070669_100399354 3300005353 Bacteria 1124
59 Ga0070675_100202969 3300005354 Unclassified 1721
60 Ga0070675_100304982 3300005354 Bacteria 1404
61 Ga0070671_100022472 3300005355 Bacteria 5150
62 Ga0070673_100047029 3300005364 Bacteria 3355
63 Ga0070673_100094126 3300005364 Unclassified 2455
64 Ga0070673_100155206 3300005364 Bacteria 1942
65 Ga0070688_100110756 3300005365 Bacteria 1825
66 Ga0070659_100002273 3300005366 Bacteria 13683
67 Ga0070703_10000048 3300005406 Bacteria 58117
68 Ga0070703_10006463 3300005406 Unclassified 3286
69 Ga0070709_10120586 3300005434 Unclassified 1777
70 Ga0070701_10003449 3300005438 Bacteria 6262
71 Ga0070701_10024550 3300005438 Unclassified 2917
72 Ga0070705_100006565 3300005440 Bacteria 5712
73 Ga0070705_100171790 3300005440 Bacteria 1460
74 Ga0070705_100176643 3300005440 Bacteria 1442
75 Ga0070705_100424576 3300005440 Unclassified 991
76 Ga0070700_100000569 3300005441 Bacteria 18502
77 Ga0070700_100006434 3300005441 Bacteria 6283
78 Ga0070700_100030220 3300005441 Bacteria 3236
79 Ga0070700_100031495 3300005441 Unclassified 3179
80 Ga0070700_100047449 3300005441 Unclassified 2658
81 Ga0070694_100003766 3300005444 Bacteria 9045
82 Ga0070694_100011628 3300005444 Bacteria 5449
83 Ga0070694_100016906 3300005444 Unclassified 4600
84 Ga0070694_100018636 3300005444 Bacteria 4407
85 Ga0070694_100023777 3300005444 Unclassified 3946
86 Ga0070694_100036698 3300005444 Bacteria 3247
87 Ga0070694_100089542 3300005444 Bacteria 2156
88 Ga0070694_100184015 3300005444 Bacteria 1547
89 Ga0070708_100031524 3300005445 Bacteria 4589
90 Ga0070708_100244638 3300005445 Bacteria 1684
91 Ga0070708_100319610 3300005445 Bacteria 1462
92 Ga0070662_100095102 3300005457 Bacteria 2245
93 Ga0070662_100173507 3300005457 Bacteria 1695
94 Ga0070681_10000362 3300005458 Bacteria 36657
95 Ga0070681_10002416 3300005458 Bacteria 17095
96 Ga0070681_10015191 3300005458 Bacteria 7658
97 Ga0068867_100087157 3300005459 Unclassified 2363
98 Ga0070706_100000044 3300005467 Bacteria 146303
99 Ga0070706_100023122 3300005467 Bacteria 5723
100 Ga0070706_100023837 3300005467 Bacteria 5634
101 Ga0070706_100046926 3300005467 Bacteria 3986
102 Ga0070706_100083782 3300005467 Bacteria 2954
103 Ga0070706_100089013 3300005467 Unclassified 2862
104 Ga0070706_100203414 3300005467 Bacteria 1850
105 Ga0070707_100000761 3300005468 Bacteria 31798
106 Ga0070707_100028094 3300005468 Bacteria 5352
107 Ga0070707_100069107 3300005468 Bacteria 3400
108 Ga0070707_100182363 3300005468 Bacteria 2047
109 Ga0070707_100213229 3300005468 Unclassified 1882
110 Ga0070707_100544291 3300005468 Unclassified 1123
111 Ga0070698_100000143 3300005471 Bacteria 64748
112 Ga0070698_100000857 3300005471 Bacteria 33406
113 Ga0070698_100005210 3300005471 Bacteria 14215
114 Ga0070698_100015234 3300005471 Bacteria 8130
115 Ga0070698_100034683 3300005471 Bacteria 5221
116 Ga0070698_100045288 3300005471 Unclassified 4503
117 Ga0070698_100048394 3300005471 Bacteria 4344
118 Ga0070698_100240948 3300005471 Bacteria 1742
119 Ga0070698_100502047 3300005471 Unclassified 1151
120 Ga0070699_100002843 3300005518 Bacteria 15446
121 Ga0070699_100009363 3300005518 Bacteria 8483
122 Ga0070699_100009653 3300005518 Bacteria 8354
123 Ga0070699_100146166 3300005518 Unclassified 2089
124 Ga0070699_100216316 3300005518 Bacteria 1707
125 Ga0070699_100221637 3300005518 Bacteria 1686
126 Ga0070679_100000540 3300005530 Bacteria 32202
127 Ga0070679_100030221 3300005530 Bacteria 5348
128 Ga0070679_100134864 3300005530 Bacteria 2450
129 Ga0070697_100000047 3300005536 Bacteria 90650
130 Ga0070697_100000811 3300005536 Bacteria 23439
131 Ga0070697_100035763 3300005536 Bacteria 4009
132 Ga0070697_100051508 3300005536 Bacteria 3344
133 Ga0070697_100301340 3300005536 Unclassified 1378
134 Ga0070697_100390015 3300005536 Unclassified 1207
135 Ga0068853_100035104 3300005539 Unclassified 4259
136 Ga0068853_100055465 3300005539 Unclassified 3416
137 Ga0070672_100179266 3300005543 Bacteria 1765
138 Ga0070672_100207047 3300005543 Bacteria 1642
139 Ga0070686_100005298 3300005544 Bacteria 7129
140 Ga0070686_100016452 3300005544 Bacteria 4303
141 Ga0070686_100024497 3300005544 Bacteria 3617
142 Ga0070686_100049811 3300005544 Unclassified 2659
143 Ga0070686_100100100 3300005544 Unclassified 1956
144 Ga0070686_100296894 3300005544 Bacteria 1197
145 Ga0070695_100048846 3300005545 Bacteria 2707
146 Ga0070695_100081856 3300005545 Unclassified 2137
147 Ga0070695_100129004 3300005545 Bacteria 1741
148 Ga0070695_100251008 3300005545 Bacteria 1288
149 Ga0070695_100333326 3300005545 Bacteria 1132
150 Ga0070696_100023432 3300005546 Unclassified 4195
151 Ga0070696_100034377 3300005546 Bacteria 3487
152 Ga0070696_100118521 3300005546 Unclassified 1914
153 Ga0070696_100138231 3300005546 Bacteria 1778
154 Ga0070696_100151830 3300005546 Bacteria 1701
155 Ga0070696_100180269 3300005546 Unclassified 1567
156 Ga0070693_100016399 3300005547 Unclassified 3834
157 Ga0070693_100186248 3300005547 Bacteria 1340
158 Ga0070693_100237383 3300005547 Unclassified 1202
159 Ga0070704_100008763 3300005549 Bacteria 6085
160 Ga0070704_100022565 3300005549 Bacteria 4098
161 Ga0070704_100026888 3300005549 Bacteria 3808
162 Ga0070704_100056765 3300005549 Bacteria 2781
163 Ga0070704_100077215 3300005549 Unclassified 2439
164 Ga0070704_100110134 3300005549 Bacteria 2094
165 Ga0070704_100130823 3300005549 Bacteria 1945
166 Ga0070704_100190932 3300005549 Bacteria 1646
167 Ga0070664_100003825 3300005564 Bacteria 12152
168 Ga0070664_100216216 3300005564 Unclassified 1714
169 Ga0068857_100003794 3300005577 Bacteria 12716
170 Ga0068857_100128807 3300005577 Bacteria 2282
171 Ga0068857_100215226 3300005577 Unclassified 1754
172 Ga0068857_100221247 3300005577 Bacteria 1729
173 Ga0068857_100461340 3300005577 Bacteria 1189
174 Ga0068856_100073874 3300005614 Bacteria 3376
175 Ga0070702_100021459 3300005615 Unclassified 3398
176 Ga0070702_100174764 3300005615 Unclassified 1400
177 Ga0070702_100188985 3300005615 Bacteria 1354
178 Ga0068859_100012155 3300005617 Bacteria 8652
179 Ga0068859_100014303 3300005617 Bacteria 7960
180 Ga0068859_100015317 3300005617 Bacteria 7702
181 Ga0068859_100029722 3300005617 Bacteria 5482
182 Ga0068859_100054636 3300005617 Bacteria 4017
183 Ga0068859_100055655 3300005617 Bacteria 3980
184 Ga0068859_100185557 3300005617 Bacteria 2164
185 Ga0068859_100219495 3300005617 Unclassified 1989
186 Ga0068859_100237128 3300005617 Unclassified 1913
187 Ga0068859_100244320 3300005617 Bacteria 1884
188 Ga0068859_100777818 3300005617 Unclassified 1045
189 Ga0068864_100100162 3300005618 Bacteria 2568
190 Ga0068864_100648731 3300005618 Unclassified 1028
191 Ga0068866_10003038 3300005718 Bacteria 6924
192 Ga0068866_10214190 3300005718 Bacteria 1158
193 Ga0068861_100022645 3300005719 Bacteria 4529
194 Ga0068861_100066551 3300005719 Unclassified 2778
195 Ga0068861_100097589 3300005719 Unclassified 2331
196 Ga0068861_100105847 3300005719 Unclassified 2246
197 Ga0068861_100136737 3300005719 Bacteria 1995
198 Ga0068870_10029713 3300005840 Bacteria 2755
199 Ga0068870_10114948 3300005840 Unclassified 1542
200 Ga0068870_10166421 3300005840 Unclassified 1312
201 Ga0068863_100089448 3300005841 Bacteria 2919
202 Ga0068863_100100105 3300005841 Bacteria 2754
203 Ga0068863_100123803 3300005841 Bacteria 2467
204 Ga0068863_100128534 3300005841 Unclassified 2418
205 Ga0068863_100543634 3300005841 Bacteria 1146
206 Ga0068858_100000008 3300005842 Bacteria 238361
207 Ga0068858_100044468 3300005842 Unclassified 4116
208 Ga0068858_100048180 3300005842 Bacteria 3949
209 Ga0068858_100060977 3300005842 Bacteria 3487
210 Ga0068858_100260384 3300005842 Unclassified 1648
211 Ga0068860_100013902 3300005843 Bacteria 7891
212 Ga0068860_100038636 3300005843 Unclassified 4566
213 Ga0068860_100092470 3300005843 Bacteria 2882
214 Ga0068860_100105967 3300005843 Bacteria 2685
215 Ga0068860_100138571 3300005843 Bacteria 2337
216 Ga0068860_100202519 3300005843 Bacteria 1924
217 Ga0068860_100255697 3300005843 Unclassified 1706
218 Ga0068860_100257601 3300005843 Bacteria 1700
219 Ga0068860_100314110 3300005843 Bacteria 1537
220 Ga0068862_100017697 3300005844 Bacteria 5932
221 Ga0068862_100066457 3300005844 Bacteria 3107
222 Ga0068862_100186187 3300005844 Bacteria 1866
223 Ga0081455_10311862 3300005937 Bacteria 1124
224 Ga0081540_1055775 3300005983 Bacteria 1922
225 Ga0081539_10004393 3300005985 Bacteria 15647
226 Ga0081539_10011645 3300005985 Bacteria 6922
227 Ga0070715_10000005 3300006163 Bacteria 298716
228 Ga0070716_100000034 3300006173 Bacteria 56620
229 Ga0070716_100117831 3300006173 Archaea 1657
230 Ga0097621_100002796 3300006237 Bacteria 11948
231 Ga0097621_100033755 3300006237 Unclassified 4078
232 Ga0097621_100146875 3300006237 Unclassified 2020
233 Ga0097621_100239472 3300006237 Bacteria 1586
234 Ga0068871_100007882 3300006358 Bacteria 7636
235 Ga0068871_100042557 3300006358 Unclassified 3646
236 Ga0068871_100170635 3300006358 Bacteria 1864
237 Ga0075428_100157367 3300006844 Bacteria 2467
238 Ga0075428_100354666 3300006844 Bacteria 1574
239 Ga0075430_100046477 3300006846 Bacteria 3666
240 Ga0075433_10064779 3300006852 Bacteria 3204
241 Ga0075433_10117076 3300006852 Bacteria 2364
242 Ga0075433_10188710 3300006852 Bacteria 1834
243 Ga0075433_10192584 3300006852 Bacteria 1814
244 Ga0075433_10318259 3300006852 Bacteria 1377
245 Ga0075433_10364892 3300006852 Bacteria 1275
246 Ga0075434_100017408 3300006871 Bacteria 6924
247 Ga0075434_100030724 3300006871 Bacteria 5292
248 Ga0075434_100064420 3300006871 Unclassified 3649
249 Ga0075434_100140720 3300006871 Unclassified 2432
250 Ga0075434_100159219 3300006871 Bacteria 2277
251 Ga0075434_100276147 3300006871 Bacteria 1700
252 Ga0075434_100487663 3300006871 Bacteria 1253
253 Ga0075434_100788566 3300006871 Bacteria 966
254 Ga0075436_100000012 3300006914 Bacteria 188052
255 Ga0075436_100286201 3300006914 Unclassified 1179
256 Ga0097620_100012155 3300006931 Bacteria 8652
257 Ga0097620_100014302 3300006931 Bacteria 7960
258 Ga0097620_100015315 3300006931 Bacteria 7702
259 Ga0097620_100029722 3300006931 Bacteria 5482
260 Ga0097620_100054635 3300006931 Bacteria 4017
261 Ga0097620_100055655 3300006931 Bacteria 3980
262 Ga0097620_100185559 3300006931 Bacteria 2164
263 Ga0097620_100219515 3300006931 Unclassified 1989
264 Ga0097620_100237133 3300006931 Unclassified 1913
265 Ga0097620_100244323 3300006931 Bacteria 1884
266 Ga0097620_100777859 3300006931 Unclassified 1045
267 Ga0075435_100001219 3300007076 Bacteria 16470
268 Ga0075435_100231520 3300007076 Unclassified 1570
269 Ga0099795_10088558 3300007788 Bacteria 1196
270 Ga0105251_10135732 3300009011 Bacteria 1114
271 Ga0105240_10078482 3300009093 Bacteria 4066
272 Ga0105240_10295873 3300009093 Bacteria 1854
273 Ga0105240_10840452 3300009093 Unclassified 992
274 Ga0111539_10001823 3300009094 Bacteria 28370
275 Ga0111539_10005448 3300009094 Bacteria 16464
276 Ga0111539_10068876 3300009094 Bacteria 4178
277 Ga0111539_10069877 3300009094 Bacteria 4146
278 Ga0111539_10591538 3300009094 Bacteria 1292
279 Ga0105247_10000001 3300009101 Bacteria 739726
280 Ga0105247_10005468 3300009101 Bacteria 8006
281 Ga0114129_10002864 3300009147 Bacteria 24130
282 Ga0114129_10037171 3300009147 Bacteria 6875
283 Ga0114129_10037695 3300009147 Bacteria 6824
284 Ga0114129_10037717 3300009147 Bacteria 6822
285 Ga0114129_10042987 3300009147 Bacteria 6360
286 Ga0114129_10159521 3300009147 Unclassified 3083
287 Ga0114129_10294483 3300009147 Unclassified 2165
288 Ga0114129_10527761 3300009147 Unclassified 1538
289 Ga0114129_10547180 3300009147 Bacteria 1506
290 Ga0105243_10000242 3300009148 Bacteria 62471
291 Ga0105243_10000646 3300009148 Bacteria 34469
292 Ga0105243_10012306 3300009148 Bacteria 6470
293 Ga0105243_10096012 3300009148 Unclassified 2451
294 Ga0105243_10123060 3300009148 Unclassified 2190
295 Ga0105243_10136056 3300009148 Bacteria 2091
296 Ga0105243_10196844 3300009148 Unclassified 1764
297 Ga0105243_10331091 3300009148 Unclassified 1391
298 Ga0105241_10033890 3300009174 Unclassified 3835
299 Ga0105241_10165777 3300009174 Bacteria 1820
300 Ga0105241_10320746 3300009174 Unclassified 1336
301 Ga0105242_10000092 3300009176 Bacteria 62471
302 Ga0105242_10000464 3300009176 Bacteria 32271
303 Ga0105242_10001645 3300009176 Bacteria 17657
304 Ga0105242_10071804 3300009176 Bacteria 2873
305 Ga0105242_10214885 3300009176 Unclassified 1715
306 Ga0105248_10007844 3300009177 Bacteria 11722
307 Ga0105248_10076483 3300009177 Bacteria 3763
308 Ga0105248_10168269 3300009177 Bacteria 2470
309 Ga0105248_10191193 3300009177 Unclassified 2306
310 Ga0105237_10031885 3300009545 Bacteria 5337
311 Ga0105237_10274366 3300009545 Bacteria 1689
312 Ga0105238_10003265 3300009551 Bacteria 16179
313 Ga0105238_10022347 3300009551 Bacteria 6448
314 Ga0105249_10000032 3300009553 Bacteria 215247
315 Ga0105249_10034607 3300009553 Bacteria 4579
316 Ga0105249_10053731 3300009553 Bacteria 3682
317 Ga0105249_10133657 3300009553 Bacteria 2371
318 Ga0105249_10139416 3300009553 Bacteria 2323
319 Ga0105249_10317775 3300009553 Bacteria 1568
320 Ga0105249_10389659 3300009553 Unclassified 1421
321 Ga0105249_10468382 3300009553 Bacteria 1301
322 Ga0105249_10690214 3300009553 Bacteria 1080
323 Ga0105246_10124288 3300011119 Unclassified 1917
324 Ga0105246_10182407 3300011119 Unclassified 1617
325 Ga0105246_10243567 3300011119 Bacteria 1423
326 Ga0105246_10265043 3300011119 Bacteria 1371
327 Ga0105246_10435807 3300011119 Unclassified 1098
328 Ga0157373_10046279 3300013100 Bacteria 3104
329 Ga0157373_10205382 3300013100 Unclassified 1389
330 Ga0157374_10021074 3300013296 Bacteria 5793
331 Ga0157378_10000019 3300013297 Bacteria 132704
332 Ga0157378_10040435 3300013297 Bacteria 4134
333 Ga0157378_10062314 3300013297 Unclassified 3330
334 Ga0157378_10067268 3300013297 Bacteria 3210
335 Ga0157378_10178768 3300013297 Bacteria 1995
336 Ga0157378_10219596 3300013297 Unclassified 1806
337 Ga0157378_10237920 3300013297 Unclassified 1738
338 Ga0157378_10432034 3300013297 Bacteria 1303
339 Ga0157378_10586028 3300013297 Unclassified 1125
340 Ga0163162_10000006 3300013306 Bacteria 410012
341 Ga0163162_10002140 3300013306 Bacteria 18529
342 Ga0163162_10007396 3300013306 Bacteria 10679
343 Ga0163162_10047531 3300013306 Unclassified 4301
344 Ga0163162_10193194 3300013306 Unclassified 2163
345 Ga0163162_10231671 3300013306 Bacteria 1977
346 Ga0163162_10257262 3300013306 Bacteria 1878
347 Ga0163162_10351952 3300013306 Bacteria 1606
348 Ga0163162_10439310 3300013306 Bacteria 1437
349 Ga0163162_10511897 3300013306 Unclassified 1330
350 Ga0163162_10780374 3300013306 Unclassified 1074
351 Ga0157372_10026279 3300013307 Bacteria 6334
352 Ga0157372_10128556 3300013307 Bacteria 2914
353 Ga0157372_10335976 3300013307 Bacteria 1760
354 Ga0157372_10342037 3300013307 Bacteria 1743
355 Ga0157372_10433739 3300013307 Unclassified 1532
356 Ga0157372_10891512 3300013307 Bacteria 1032
357 Ga0157375_10017803 3300013308 Bacteria 6425
358 Ga0157375_10044886 3300013308 Unclassified 4299
359 Ga0157375_10099018 3300013308 Bacteria 2994
360 Ga0157375_10176422 3300013308 Unclassified 2287
361 Ga0157375_10341273 3300013308 Bacteria 1663
362 Ga0163163_10000983 3300014325 Bacteria 24185
363 Ga0163163_10001332 3300014325 Bacteria 20826
364 Ga0163163_10007267 3300014325 Bacteria 9766
365 Ga0163163_10025718 3300014325 Bacteria 5614
366 Ga0163163_10038983 3300014325 Unclassified 4634
367 Ga0163163_10107477 3300014325 Unclassified 2817
368 Ga0163163_10144834 3300014325 Unclassified 2419
369 Ga0163163_10166567 3300014325 Unclassified 2250
370 Ga0163163_10191796 3300014325 Bacteria 2092
371 Ga0163163_10455406 3300014325 Bacteria 1340
372 Ga0163163_10625086 3300014325 Bacteria 1140
373 Ga0157380_10013736 3300014326 Bacteria 5912
374 Ga0157380_10047281 3300014326 Unclassified 3384
375 Ga0157380_10049392 3300014326 Unclassified 3318
376 Ga0157380_10087413 3300014326 Bacteria 2563
377 Ga0157380_10122756 3300014326 Unclassified 2203
378 Ga0157380_10209935 3300014326 Bacteria 1734
379 Ga0157377_10213353 3300014745 Bacteria 1232
380 Ga0157379_10026966 3300014968 Bacteria 5113
381 Ga0157379_10056084 3300014968 Unclassified 3521
382 Ga0157379_10061318 3300014968 Bacteria 3363
383 Ga0157376_10109332 3300014969 Bacteria 2430
384 Ga0157376_10227024 3300014969 Bacteria 1732
385 Ga0163161_10348762 3300017792 Bacteria 1176
386 Ga0207672_1000065 3300025223 Bacteria 14210
387 Ga0207653_10000175 3300025885 Bacteria 44967
388 Ga0207653_10005112 3300025885 Unclassified 4099
389 Ga0207642_10002264 3300025899 Bacteria 5988
390 Ga0207710_10000003 3300025900 Bacteria 1071597
391 Ga0207710_10002199 3300025900 Bacteria 9170
392 Ga0207710_10116277 3300025900 Bacteria 1273
393 Ga0207680_10184943 3300025903 Bacteria 1411
394 Ga0207680_10224625 3300025903 Bacteria 1289
395 Ga0207647_10003725 3300025904 Bacteria 11400
396 Ga0207685_10000026 3300025905 Bacteria 109892
397 Ga0207699_10183740 3300025906 Unclassified 1407
398 Ga0207645_10066030 3300025907 Unclassified 2313
399 Ga0207643_10014841 3300025908 Bacteria 4236
400 Ga0207643_10120339 3300025908 Unclassified 1555
401 Ga0207643_10192511 3300025908 Unclassified 1238
402 Ga0207684_10001881 3300025910 Bacteria 21837
403 Ga0207684_10007446 3300025910 Bacteria 9851
404 Ga0207684_10019404 3300025910 Bacteria 5818
405 Ga0207684_10060736 3300025910 Unclassified 3210
406 Ga0207684_10426565 3300025910 Bacteria 1139
407 Ga0207654_10063598 3300025911 Bacteria 2166
408 Ga0207654_10111425 3300025911 Bacteria 1703
409 Ga0207654_10190885 3300025911 Unclassified 1342
410 Ga0207654_10263774 3300025911 Viruses 1159
411 Ga0207707_10000031 3300025912 Bacteria 159505
412 Ga0207707_10027684 3300025912 Bacteria 4957
413 Ga0207695_10096136 3300025913 Bacteria 2964
414 Ga0207695_10224829 3300025913 Bacteria 1783
415 Ga0207671_10154199 3300025914 Bacteria 1776
416 Ga0207660_10004070 3300025917 Bacteria 9535
417 Ga0207660_10151392 3300025917 Unclassified 1782
418 Ga0207662_10009243 3300025918 Bacteria 5417
419 Ga0207662_10038701 3300025918 Bacteria 2795
420 Ga0207662_10052112 3300025918 Unclassified 2435
421 Ga0207662_10061884 3300025918 Bacteria 2248
422 Ga0207662_10087381 3300025918 Bacteria 1912
423 Ga0207657_10082494 3300025919 Unclassified 2699
424 Ga0207652_10000087 3300025921 Bacteria 99945
425 Ga0207652_10056228 3300025921 Bacteria 3387
426 Ga0207646_10000941 3300025922 Bacteria 37455
427 Ga0207646_10007403 3300025922 Bacteria 11162
428 Ga0207646_10116464 3300025922 Bacteria 2400
429 Ga0207646_10177494 3300025922 Bacteria 1924
430 Ga0207646_10207708 3300025922 Bacteria 1768
431 Ga0207646_10212540 3300025922 Unclassified 1747
432 Ga0207681_10000856 3300025923 Bacteria 19992
433 Ga0207681_10072676 3300025923 Bacteria 2403
434 Ga0207681_10175759 3300025923 Unclassified 1627
435 Ga0207681_10355927 3300025923 Unclassified 1173
436 Ga0207694_10022766 3300025924 Unclassified 4753
437 Ga0207694_10047565 3300025924 Bacteria 3318
438 Ga0207650_10000028 3300025925 Bacteria 236867
439 Ga0207650_10000526 3300025925 Bacteria 31386
440 Ga0207650_10018250 3300025925 Bacteria 4922
441 Ga0207659_10145187 3300025926 Bacteria 1847
442 Ga0207644_10001567 3300025931 Bacteria 14760
443 Ga0207644_10003719 3300025931 Bacteria 9887
444 Ga0207644_10044889 3300025931 Unclassified 3142
445 Ga0207690_10047556 3300025932 Unclassified 2847
446 Ga0207706_10032892 3300025933 Unclassified 4614
447 Ga0207706_10097554 3300025933 Unclassified 2585
448 Ga0207706_10129193 3300025933 Bacteria 2222
449 Ga0207686_10000004 3300025934 Bacteria 349251
450 Ga0207686_10000090 3300025934 Bacteria 74224
451 Ga0207686_10014586 3300025934 Bacteria 4378
452 Ga0207686_10171435 3300025934 Unclassified 1531
453 Ga0207686_10332276 3300025934 Bacteria 1139
454 Ga0207686_10347165 3300025934 Unclassified 1116
455 Ga0207709_10000028 3300025935 Bacteria 334429
456 Ga0207709_10001127 3300025935 Bacteria 19568
457 Ga0207709_10008381 3300025935 Bacteria 5719
458 Ga0207709_10130067 3300025935 Bacteria 1714
459 Ga0207709_10158028 3300025935 Unclassified 1578
460 Ga0207670_10000207 3300025936 Bacteria 38519
461 Ga0207670_10116026 3300025936 Bacteria 1938
462 Ga0207670_10167157 3300025936 Unclassified 1646
463 Ga0207704_10142521 3300025938 Bacteria 1679
464 Ga0207665_10000504 3300025939 Bacteria 26460
465 Ga0207665_10048508 3300025939 Bacteria 2850
466 Ga0207691_10115288 3300025940 Bacteria 2386
467 Ga0207691_10174318 3300025940 Unclassified 1882
468 Ga0207691_10216499 3300025940 Unclassified 1662
469 Ga0207711_10011318 3300025941 Bacteria 7411
470 Ga0207711_10053190 3300025941 Bacteria 3472
471 Ga0207711_10080204 3300025941 Bacteria 2850
472 Ga0207711_10328714 3300025941 Bacteria 1414
473 Ga0207711_10353801 3300025941 Bacteria 1360
474 Ga0207689_10009419 3300025942 Bacteria 8433
475 Ga0207689_10018025 3300025942 Bacteria 5963
476 Ga0207689_10081990 3300025942 Bacteria 2652
477 Ga0207689_10133714 3300025942 Bacteria 2042
478 Ga0207689_10470756 3300025942 Bacteria 1051
479 Ga0207679_10007697 3300025945 Bacteria 6843
480 Ga0207679_10077343 3300025945 Unclassified 2531
481 Ga0207667_10648551 3300025949 Unclassified 1061
482 Ga0207651_10256703 3300025960 Unclassified 1433
483 Ga0207712_10000145 3300025961 Bacteria 73520
484 Ga0207712_10025809 3300025961 Bacteria 3908
485 Ga0207712_10029128 3300025961 Bacteria 3701
486 Ga0207712_10085081 3300025961 Bacteria 2313
487 Ga0207712_10266274 3300025961 Bacteria 1392
488 Ga0207640_10251194 3300025981 Bacteria 1373
489 Ga0207658_10255740 3300025986 Bacteria 1490
490 Ga0207677_10022583 3300026023 Unclassified 3870
491 Ga0207677_10092440 3300026023 Bacteria 2203
492 Ga0207677_10310741 3300026023 Bacteria 1306
493 Ga0207703_10000109 3300026035 Bacteria 97743
494 Ga0207703_10059801 3300026035 Bacteria 3113
495 Ga0207703_10121334 3300026035 Bacteria 2244
496 Ga0207703_10209306 3300026035 Unclassified 1738
497 Ga0207703_10318821 3300026035 Bacteria 1423
498 Ga0207639_10063510 3300026041 Unclassified 2860
499 Ga0207639_10083296 3300026041 Unclassified 2538
500 Ga0207639_10326406 3300026041 Bacteria 1364
501 Ga0207708_10000386 3300026075 Bacteria 34516
502 Ga0207708_10030781 3300026075 Bacteria 4070
503 Ga0207708_10048883 3300026075 Bacteria 3220
504 Ga0207708_10072317 3300026075 Bacteria 2642
505 Ga0207708_10353663 3300026075 Unclassified 1206
506 Ga0207702_10196334 3300026078 Bacteria 1868
507 Ga0207641_10018996 3300026088 Bacteria 5638
508 Ga0207641_10095995 3300026088 Unclassified 2603
509 Ga0207641_10361535 3300026088 Bacteria 1386
510 Ga0207641_10422704 3300026088 Bacteria 1283
511 Ga0207641_10659245 3300026088 Unclassified 1028
512 Ga0207648_10083848 3300026089 Unclassified 2780
513 Ga0207648_10119943 3300026089 Unclassified 2312
514 Ga0207648_10232437 3300026089 Unclassified 1640
515 Ga0207648_10277882 3300026089 Bacteria 1497
516 Ga0207676_10012506 3300026095 Bacteria 6084
517 Ga0207676_10021600 3300026095 Bacteria 4723
518 Ga0207676_10242990 3300026095 Unclassified 1616
519 Ga0207676_10522614 3300026095 Unclassified 1130
520 Ga0207674_10000790 3300026116 Bacteria 41276
521 Ga0207674_10022062 3300026116 Bacteria 6845
522 Ga0207674_10071368 3300026116 Bacteria 3489
523 Ga0207674_10128585 3300026116 Unclassified 2498
524 Ga0207674_10566043 3300026116 Bacteria 1098
525 Ga0207675_100000727 3300026118 Bacteria 32691
526 Ga0207675_100016246 3300026118 Bacteria 6948
527 Ga0207675_100021791 3300026118 Bacteria 5965
528 Ga0207675_100073732 3300026118 Bacteria 3193
529 Ga0207675_100088490 3300026118 Bacteria 2909
530 Ga0207675_100226254 3300026118 Bacteria 1804
531 Ga0207675_100242720 3300026118 Bacteria 1741
532 Ga0207698_10513352 3300026142 Bacteria 1168
533 Ga0207428_10018667 3300027907 Bacteria 5920
534 Ga0207428_10024954 3300027907 Bacteria 5012
535 Ga0207428_10029261 3300027907 Bacteria 4568
536 Ga0268266_10050152 3300028379 Bacteria 3581
537 Ga0268265_10065299 3300028380 Bacteria 2808
538 Ga0268264_10057045 3300028381 Bacteria 3265
539 Ga0268264_10059846 3300028381 Bacteria 3192
540 Ga0268264_10060793 3300028381 Bacteria 3167
541 Ga0268264_10065262 3300028381 Unclassified 3067
542 Ga0268264_10266169 3300028381 Bacteria 1599
543 Ga0268264_10314636 3300028381 Bacteria 1478
544 Ga0307408_100112550 3300031548 Unclassified 2093
545 Ga0307405_10184330 3300031731 Unclassified 1501
546 Ga0307405_10319777 3300031731 Unclassified 1185
547 Ga0307413_10098334 3300031824 Unclassified 1926
548 Ga0307413_10144691 3300031824 Bacteria 1648
549 Ga0307406_10048055 3300031901 Unclassified 2692
550 Ga0307416_100096361 3300032002 Unclassified 2558
551 Ga0307416_100363332 3300032002 Bacteria 1470
552 Ga0307414_10002951 3300032004 Bacteria 8990
553 Ga0307414_10060626 3300032004 Unclassified 2677
554 Ga0307414_10228595 3300032004 Unclassified 1532
555 Ga0307411_10038838 3300032005 Unclassified 3007
556 Ga0307415_100034997 3300032126 Unclassified 3276
557 Ga0307415_100077921 3300032126 Unclassified 2355
558 Ga0373951_0001041 3300035091 Bacteria 7457
559 Ga0373941_0008165 3300035115 Bacteria 2592
560 Ga0373937_0098224 3300036401 Unclassified 2716
561 Ga0395900_0347998 3300037418 Bacteria 1456
562 Ga0395898_0078200 3300037466 Unclassified 3192
563 Ga0395905_0254600 3300037471 Bacteria 1640
564 Ga0395901_0531267 3300038443 Bacteria 1194
565 Ga0242422_00717 3300038699 Unclassified 2191
566 Ga0242420_016600 3300038996 Bacteria 1283
567 Ga0453683_0027779 3300044673 Bacteria 3585
568 Ga0453683_0169031 3300044673 Bacteria 1385
569 Ga0451576_0058806 3300045051 Bacteria 4014
570 Ga0451576_0255221 3300045051 Unclassified 1833
571 Ga0451576_0547752 3300045051 Bacteria 1215
572 Ga0495580_0121086 3300046472 Bacteria 1817
573 Ga0495663_0000223 3300046525 Bacteria 22614
574 Ga0495621_0001177 3300046539 Bacteria 6754
575 Ga0495621_0014966 3300046539 Bacteria 2466
576 Ga0495659_0025673 3300046664 Unclassified 2018
577 Ga0495588_0177170 3300046674 Bacteria 1127
578 Ga0495658_0070803 3300046683 Bacteria 2025
579 Ga0495636_0043236 3300047318 Bacteria 1874
580 Ga0495672_0011357 3300047320 Bacteria 6291
581 Ga0495615_0027223 3300048090 Bacteria 1340
582 Ga0496102_0076332 3300048905 Bacteria 3082
583 Ga0496104_0078629 3300048907 Bacteria 3143
584 Ga0496106_0024232 3300048909 Unclassified 4510
585 Ga0496106_0041010 3300048909 Bacteria 3468
586 Ga0496106_0121002 3300048909 Unclassified 2046
587 Ga0496107_0093478 3300048910 Unclassified 2199
588 Ga0496108_0321649 3300048911 Bacteria 1349
589 Ga0496110_0382437 3300048913 Bacteria 1283
590 Ga0496112_0109066 3300048915 Unclassified 2739
591 Ga0496114_0238727 3300048917 Bacteria 1598
592 Ga0501291_004717 3300049514 Bacteria 1748
593 Ga0501292_002422 3300049515 Unclassified 2410
594 Ga0501292_018931 3300049515 Bacteria 1098
595 Ga0501295_010415 3300049518 Bacteria 1460
596 Ga0501296_000693 3300049519 Unclassified 3335
597 Ga0501296_010620 3300049519 Unclassified 1094
598 Ga0501297_002180 3300049520 Unclassified 1878
599 Ga0501298_007803 3300049521 Unclassified 1783
600 Ga0501299_002470 3300049522 Unclassified 2561
601 Ga0501300_007608 3300049523 Unclassified 1588
602 Ga0501198_000685 3300049649 Unclassified 4212
603 Ga0501202_015716 3300049652 Unclassified 1461
604 Ga0501202_039618 3300049652 Bacteria 1013
605 Ga0501207_000631 3300049654 Unclassified 4082
606 Ga0501208_009527 3300049655 Bacteria 1344
607 Ga0501216_002558 3300049660 Unclassified 2595
608 Ga0501216_008005 3300049660 Unclassified 1656
609 Ga0501217_000250 3300049661 Bacteria 8329
610 Ga0501217_021929 3300049661 Bacteria 1511
611 Ga0501223_009413 3300049663 Unclassified 1980
612 Ga0501224_001815 3300049664 Bacteria 2875
613 Ga0501227_000481 3300049665 Bacteria 8499
614 Ga0501227_021042 3300049665 Unclassified 1501
615 Ga0501230_012163 3300049667 Bacteria 1374
616 Ga0501233_001016 3300049668 Bacteria 4769
617 Ga0501233_004653 3300049668 Unclassified 2526
618 Ga0501235_001823 3300049669 Unclassified 4567
619 Ga0501235_004086 3300049669 Bacteria 3159
620 Ga0501235_033273 3300049669 Bacteria 1167
621 Ga0501242_001899 3300049674 Unclassified 2155
622 Ga0501243_006371 3300049675 Bacteria 1786
623 Ga0501243_010575 3300049675 Bacteria 1441
624 Ga0501247_009044 3300049677 Bacteria 1171
625 Ga0501249_006039 3300049679 Unclassified 2486
626 Ga0501249_010084 3300049679 Bacteria 1970
627 Ga0501249_017137 3300049679 Unclassified 1560
628 Ga0501253_007822 3300049683 Unclassified 1510
629 Ga0501256_002644 3300049685 Unclassified 1437
630 Ga0501256_003433 3300049685 Bacteria 1316
631 Ga0501257_030064 3300049686 Unclassified 1306
632 Ga0501259_011875 3300049688 Unclassified 1446
633 Ga0501260_000580 3300049689 Unclassified 2820
634 Ga0501260_005429 3300049689 Unclassified 1200
635 Ga0501261_006149 3300049690 Bacteria 1523
636 Ga0501221_007386 3300049704 Unclassified 1884
637 Ga0501225_0006513 3300049705 Bacteria 3410
638 Ga0501225_0012705 3300049705 Unclassified 2363
639 Ga0501225_0022646 3300049705 Unclassified 1734
640 Ga0501229_005135 3300049706 Unclassified 1601
641 Ga0501234_004126 3300049707 Unclassified 2280
642 Ga0501234_004441 3300049707 Unclassified 2206
643 Ga0501234_006180 3300049707 Unclassified 1875
644 Ga0501234_009209 3300049707 Bacteria 1539
645 Ga0501245_001612 3300049708 Unclassified 2937
646 Ga0501241_004234 3300049758 Unclassified 2695
647 Ga0501266_011132 3300049763 Unclassified 1150
648 Ga0501268_019906 3300049765 Unclassified 1139
649 Ga0501273_000582 3300049770 Unclassified 3018
650 Ga0501283_001776 3300049779 Unclassified 2796
651 Ga0501212_005760 3300049851 Unclassified 1648
652 Ga0501212_021211 3300049851 Unclassified 1006
653 Ga0501226_001593 3300049853 Bacteria 2876
654 nmdc:mga05p37_125179_c1 3300050507 Bacteria 3156
655 nmdc:mga05p37_220378_c1 3300050507 Unclassified 2290
656 nmdc:mga05p37_425785_c1 3300050507 Bacteria 1543
657 nmdc:mga05p37_85382_c1 3300050507 Bacteria 3889
658 nmdc:mga09592_269100_c1 3300050508 Bacteria 1478
659 nmdc:mga09592_76681_c1 3300050508 Bacteria 2843
660 nmdc:mga0qj67_123711_c1 3300050509 Bacteria 2093
661 nmdc:mga06r32_326012_c1 3300050510 Unclassified 1521
662 nmdc:mga08y16_1720_c1 3300050511 Bacteria 22215
663 nmdc:mga08y16_91674_c1 3300050511 Bacteria 3167
664 nmdc:mga0n895_102393_c1 3300050512 Bacteria 2874
665 nmdc:mga0n895_112959_c1 3300050512 Unclassified 2734
666 nmdc:mga0n895_27814_c1 3300050512 Bacteria 5374
667 nmdc:mga0n895_305469_c1 3300050512 Bacteria 1613
668 nmdc:mga0n895_522691_c1 3300050512 Bacteria 1194
669 nmdc:mga0n895_664145_c1 3300050512 Bacteria 1040
670 nmdc:mga0rr50_14623_c1 3300050513 Bacteria 5154
671 nmdc:mga0rr50_223016_c1 3300050513 Unclassified 1557
672 nmdc:mga0rr50_450_c1 3300050513 Bacteria 21853
673 nmdc:mga08x19_5_c1 3300050514 Bacteria 464292
674 nmdc:mga0a205_190899_c1 3300050515 Bacteria 1941
675 nmdc:mga0a205_309082_c1 3300050515 Unclassified 1453
676 nmdc:mga0a205_49046_c1 3300050515 Bacteria 4075
677 nmdc:mga0a205_69352_c1 3300050515 Bacteria 3404
678 nmdc:mga0a205_83063_c1 3300050515 Bacteria 3094
679 nmdc:mga0a205_92926_c1 3300050515 Bacteria 2915
680 nmdc:mga0a205_98799_c1 3300050515 Bacteria 2817
681 Ga0495655_0010049 3300053083 Bacteria 1855
682 Ga0501084_0449824 3300054114 Unclassified 1089
683 Ga0530510_0108480 3300061734 Bacteria 2032

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005468 Ga0070707_100069107 Ga0070707_1000691073 226
2 3300009148 Ga0105243_10196844 Ga0105243_101968442 242
3 3300025935 Ga0207709_10158028 Ga0207709_101580282 242
4 3300005339 Ga0070660_100031027 Ga0070660_1000310274 243
5 3300005354 Ga0070675_100202969 Ga0070675_1002029692 243
6 3300005366 Ga0070659_100002273 Ga0070659_1000022735 243
7 3300005458 Ga0070681_10015191 Ga0070681_100151914 243
8 3300005530 Ga0070679_100030221 Ga0070679_1000302212 243
9 3300005539 Ga0068853_100055465 Ga0068853_1000554653 243
10 3300005564 Ga0070664_100003825 Ga0070664_1000038254 243
11 3300005577 Ga0068857_100003794 Ga0068857_10000379410 243
12 3300013307 Ga0157372_10433739 Ga0157372_104337391 243
13 3300025919 Ga0207657_10082494 Ga0207657_100824944 243
14 3300025932 Ga0207690_10047556 Ga0207690_100475562 243
15 3300025945 Ga0207679_10007697 Ga0207679_100076975 243
16 3300026041 Ga0207639_10083296 Ga0207639_100832962 243
17 3300026116 Ga0207674_10000790 Ga0207674_100007904 243
18 3300013307 Ga0157372_10891512 Ga0157372_108915121 245
19 3300014325 Ga0163163_10144834 Ga0163163_101448342 245
20 3300026088 Ga0207641_10018996 Ga0207641_100189964 246
21 3300005577 Ga0068857_100128807 Ga0068857_1001288072 248
22 3300011119 Ga0105246_10124288 Ga0105246_101242881 248
23 3300014325 Ga0163163_10107477 Ga0163163_101074771 248
24 3300025908 Ga0207643_10014841 Ga0207643_100148414 248
25 3300026116 Ga0207674_10071368 Ga0207674_100713683 248
26 3300049675 Ga0501243_010575 Ga0501243_010575_581_1417 249
27 3300050508 nmdc:mga09592_76681_c1 nmdc:mga09592_76681_c1_136_1035 249
28 3300005354 Ga0070675_100304982 Ga0070675_1003049821 252
29 3300009147 Ga0114129_10527761 Ga0114129_105277611 252
30 3300005444 Ga0070694_100016906 Ga0070694_1000169066 253
31 3300005549 Ga0070704_100130823 Ga0070704_1001308232 253
32 3300005843 Ga0068860_100202519 Ga0068860_1002025192 253
33 3300009094 Ga0111539_10069877 Ga0111539_100698773 253
34 3300009147 Ga0114129_10042987 Ga0114129_100429875 253
35 3300028381 Ga0268264_10060793 Ga0268264_100607933 253
36 3300049519 Ga0501296_010620 Ga0501296_010620_120_1040 253
37 3300049665 Ga0501227_021042 Ga0501227_021042_244_1164 253
38 3300049679 Ga0501249_017137 Ga0501249_017137_488_1408 253
39 3300049705 Ga0501225_0022646 Ga0501225_0022646_652_1572 253
40 3300049765 Ga0501268_019906 Ga0501268_019906_172_1092 253
41 3300049704 Ga0501221_007386 Ga0501221_007386_885_1805 254
42 3300049707 Ga0501234_004441 Ga0501234_004441_738_1658 254
43 3300005844 Ga0068862_100186187 Ga0068862_1001861872 257
44 3300006871 Ga0075434_100030724 Ga0075434_1000307243 258
45 3300013297 Ga0157378_10219596 Ga0157378_102195961 258
46 3300050512 nmdc:mga0n895_112959_c1 nmdc:mga0n895_112959_c1_1261_2181 258
47 3300050515 nmdc:mga0a205_49046_c1 nmdc:mga0a205_49046_c1_923_1843 258
48 3300009147 Ga0114129_10037717 Ga0114129_100377175 259
49 3300032004 Ga0307414_10228595 Ga0307414_102285951 259
50 3300049675 Ga0501243_006371 Ga0501243_006371_25_951 259
51 3300049763 Ga0501266_011132 Ga0501266_011132_73_999 259
52 3300049770 Ga0501273_000582 Ga0501273_000582_1669_2595 259
53 3300049851 Ga0501212_021211 Ga0501212_021211_52_978 259
54 3300050507 nmdc:mga05p37_85382_c1 nmdc:mga05p37_85382_c1_2044_2958 259
55 3300005293 Ga0065715_10094065 Ga0065715_100940654 260
56 3300005340 Ga0070689_100043886 Ga0070689_1000438862 260
57 3300005345 Ga0070692_10017150 Ga0070692_100171502 260
58 3300005347 Ga0070668_100033984 Ga0070668_1000339843 260
59 3300005365 Ga0070688_100110756 Ga0070688_1001107561 260
60 3300005406 Ga0070703_10006463 Ga0070703_100064633 260
61 3300005438 Ga0070701_10024550 Ga0070701_100245504 260
62 3300005440 Ga0070705_100006565 Ga0070705_1000065655 260
63 3300005441 Ga0070700_100031495 Ga0070700_1000314952 260
64 3300005444 Ga0070694_100003766 Ga0070694_1000037665 260
65 3300005444 Ga0070694_100011628 Ga0070694_1000116283 260
66 3300005467 Ga0070706_100023837 Ga0070706_1000238373 260
67 3300005544 Ga0070686_100024497 Ga0070686_1000244972 260
68 3300005546 Ga0070696_100138231 Ga0070696_1001382312 260
69 3300005547 Ga0070693_100016399 Ga0070693_1000163993 260
70 3300005549 Ga0070704_100008763 Ga0070704_1000087634 260
71 3300005615 Ga0070702_100021459 Ga0070702_1000214592 260
72 3300005841 Ga0068863_100089448 Ga0068863_1000894483 260
73 3300005842 Ga0068858_100048180 Ga0068858_1000481805 260
74 3300005843 Ga0068860_100038636 Ga0068860_1000386365 260
75 3300009093 Ga0105240_10840452 Ga0105240_108404521 260
76 3300009101 Ga0105247_10005468 Ga0105247_100054685 260
77 3300009148 Ga0105243_10000242 Ga0105243_100002426 260
78 3300009176 Ga0105242_10000092 Ga0105242_100000926 260
79 3300009177 Ga0105248_10191193 Ga0105248_101911932 260
80 3300009545 Ga0105237_10031885 Ga0105237_100318853 260
81 3300009553 Ga0105249_10000032 Ga0105249_10000032151 260
82 3300013306 Ga0163162_10000006 Ga0163162_10000006152 260
83 3300013306 Ga0163162_10257262 Ga0163162_102572623 260
84 3300014325 Ga0163163_10007267 Ga0163163_100072675 260
85 3300014326 Ga0157380_10049392 Ga0157380_100493922 260
86 3300025885 Ga0207653_10005112 Ga0207653_100051124 260
87 3300025900 Ga0207710_10002199 Ga0207710_100021995 260
88 3300025907 Ga0207645_10066030 Ga0207645_100660303 260
89 3300025910 Ga0207684_10019404 Ga0207684_100194045 260
90 3300025918 Ga0207662_10061884 Ga0207662_100618842 260
91 3300025918 Ga0207662_10087381 Ga0207662_100873811 260
92 3300025922 Ga0207646_10007403 Ga0207646_100074035 260
93 3300025926 Ga0207659_10145187 Ga0207659_101451872 260
94 3300025934 Ga0207686_10000004 Ga0207686_10000004215 260
95 3300025935 Ga0207709_10000028 Ga0207709_1000002840 260
96 3300025936 Ga0207670_10116026 Ga0207670_101160262 260
97 3300025940 Ga0207691_10216499 Ga0207691_102164991 260
98 3300025941 Ga0207711_10353801 Ga0207711_103538011 260
99 3300025942 Ga0207689_10133714 Ga0207689_101337141 260
100 3300025961 Ga0207712_10000145 Ga0207712_1000014521 260
101 3300026075 Ga0207708_10072317 Ga0207708_100723174 260
102 3300026095 Ga0207676_10021600 Ga0207676_100216005 260
103 3300028381 Ga0268264_10059846 Ga0268264_100598465 260
104 3300046539 Ga0495621_0014966 Ga0495621_0014966_235_1134 260
105 3300046664 Ga0495659_0025673 Ga0495659_0025673_565_1464 260
106 3300048909 Ga0496106_0041010 Ga0496106_0041010_2312_3223 260
107 3300048910 Ga0496107_0093478 Ga0496107_0093478_1153_2064 260
108 3300048913 Ga0496110_0382437 Ga0496110_0382437_116_1042 260
109 3300050512 nmdc:mga0n895_102393_c1 nmdc:mga0n895_102393_c1_1463_2386 260
110 3300050515 nmdc:mga0a205_190899_c1 nmdc:mga0a205_190899_c1_460_1383 260
111 3300002459 JGI24751J29686_10000006 JGI24751J29686_1000000651 261
112 3300005290 Ga0065712_10002929 Ga0065712_100029296 261
113 3300005331 Ga0070670_100000739 Ga0070670_1000007396 261
114 3300005331 Ga0070670_100027974 Ga0070670_1000279744 261
115 3300005340 Ga0070689_100166012 Ga0070689_1001660122 261
116 3300005440 Ga0070705_100171790 Ga0070705_1001717901 261
117 3300005441 Ga0070700_100006434 Ga0070700_1000064343 261
118 3300005444 Ga0070694_100089542 Ga0070694_1000895424 261
119 3300005518 Ga0070699_100002843 Ga0070699_10000284310 261
120 3300005545 Ga0070695_100333326 Ga0070695_1003333261 261
121 3300005546 Ga0070696_100151830 Ga0070696_1001518302 261
122 3300005617 Ga0068859_100029722 Ga0068859_1000297226 261
123 3300005719 Ga0068861_100105847 Ga0068861_1001058474 261
124 3300005843 Ga0068860_100255697 Ga0068860_1002556972 261
125 3300006358 Ga0068871_100170635 Ga0068871_1001706352 261
126 3300006931 Ga0097620_100029722 Ga0097620_1000297226 261
127 3300009148 Ga0105243_10123060 Ga0105243_101230603 261
128 3300009174 Ga0105241_10033890 Ga0105241_100338906 261
129 3300009174 Ga0105241_10165777 Ga0105241_101657773 261
130 3300009177 Ga0105248_10076483 Ga0105248_100764832 261
131 3300009551 Ga0105238_10022347 Ga0105238_100223474 261
132 3300013306 Ga0163162_10780374 Ga0163162_107803742 261
133 3300014325 Ga0163163_10000983 Ga0163163_1000098318 261
134 3300014325 Ga0163163_10625086 Ga0163163_106250861 261
135 3300025911 Ga0207654_10263774 Ga0207654_102637741 261
136 3300025924 Ga0207694_10047565 Ga0207694_100475653 261
137 3300025925 Ga0207650_10000028 Ga0207650_10000028135 261
138 3300025925 Ga0207650_10018250 Ga0207650_100182504 261
139 3300025934 Ga0207686_10014586 Ga0207686_100145864 261
140 3300025936 Ga0207670_10167157 Ga0207670_101671572 261
141 3300025940 Ga0207691_10115288 Ga0207691_101152882 261
142 3300025941 Ga0207711_10053190 Ga0207711_100531903 261
143 3300026035 Ga0207703_10318821 Ga0207703_103188212 261
144 3300026075 Ga0207708_10353663 Ga0207708_103536632 261
145 3300026116 Ga0207674_10566043 Ga0207674_105660431 261
146 3300026118 Ga0207675_100088490 Ga0207675_1000884904 261
147 3300026118 Ga0207675_100242720 Ga0207675_1002427202 261
148 3300031548 Ga0307408_100112550 Ga0307408_1001125502 261
149 3300031731 Ga0307405_10319777 Ga0307405_103197771 261
150 3300031824 Ga0307413_10098334 Ga0307413_100983342 261
151 3300031901 Ga0307406_10048055 Ga0307406_100480554 261
152 3300032002 Ga0307416_100096361 Ga0307416_1000963614 261
153 3300032004 Ga0307414_10002951 Ga0307414_100029519 261
154 3300032004 Ga0307414_10060626 Ga0307414_100606263 261
155 3300032126 Ga0307415_100077921 Ga0307415_1000779213 261
156 3300035115 Ga0373941_0008165 Ga0373941_0008165_1244_2164 261
157 3300037466 Ga0395898_0078200 Ga0395898_0078200_1772_2692 261
158 3300038699 Ga0242422_00717 Ga0242422_00717_284_1210 261
159 3300038996 Ga0242420_016600 Ga0242420_016600_306_1232 261
160 3300045051 Ga0451576_0547752 Ga0451576_0547752_143_1069 261
161 3300049649 Ga0501198_000685 Ga0501198_000685_2621_3541 261
162 3300049652 Ga0501202_015716 Ga0501202_015716_173_1093 261
163 3300049654 Ga0501207_000631 Ga0501207_000631_2422_3342 261
164 3300049660 Ga0501216_008005 Ga0501216_008005_491_1411 261
165 3300049661 Ga0501217_000250 Ga0501217_000250_6019_6939 261
166 3300049663 Ga0501223_009413 Ga0501223_009413_356_1276 261
167 3300049664 Ga0501224_001815 Ga0501224_001815_1368_2288 261
168 3300049665 Ga0501227_000481 Ga0501227_000481_6167_7087 261
169 3300049668 Ga0501233_001016 Ga0501233_001016_2219_3139 261
170 3300049669 Ga0501235_004086 Ga0501235_004086_395_1315 261
171 3300049679 Ga0501249_006039 Ga0501249_006039_339_1259 261
172 3300049683 Ga0501253_007822 Ga0501253_007822_315_1235 261
173 3300049685 Ga0501256_002644 Ga0501256_002644_271_1191 261
174 3300049686 Ga0501257_030064 Ga0501257_030064_138_1058 261
175 3300049688 Ga0501259_011875 Ga0501259_011875_387_1307 261
176 3300049689 Ga0501260_005429 Ga0501260_005429_228_1148 261
177 3300049705 Ga0501225_0006513 Ga0501225_0006513_1714_2634 261
178 3300049706 Ga0501229_005135 Ga0501229_005135_93_1013 261
179 3300049707 Ga0501234_004126 Ga0501234_004126_359_1279 261
180 3300049758 Ga0501241_004234 Ga0501241_004234_558_1478 261
181 3300049851 Ga0501212_005760 Ga0501212_005760_258_1178 261
182 3300049853 Ga0501226_001593 Ga0501226_001593_602_1522 261
183 3300050507 nmdc:mga05p37_125179_c1 nmdc:mga05p37_125179_c1_128_1054 261
184 3300005467 Ga0070706_100000044 Ga0070706_10000004458 262
185 3300005468 Ga0070707_100544291 Ga0070707_1005442911 262
186 3300005544 Ga0070686_100049811 Ga0070686_1000498112 262
187 3300006914 Ga0075436_100286201 Ga0075436_1002862012 262
188 3300009147 Ga0114129_10294483 Ga0114129_102944832 262
189 3300009553 Ga0105249_10034607 Ga0105249_100346076 262
190 3300025910 Ga0207684_10001881 Ga0207684_1000188113 262
191 3300025911 Ga0207654_10111425 Ga0207654_101114253 262
192 3300025961 Ga0207712_10029128 Ga0207712_100291285 262
193 3300036401 Ga0373937_0098224 Ga0373937_0098224_25_942 262
194 3300049514 Ga0501291_004717 Ga0501291_004717_565_1503 262
195 3300049515 Ga0501292_018931 Ga0501292_018931_110_1048 262
196 3300049518 Ga0501295_010415 Ga0501295_010415_334_1272 262
197 3300049519 Ga0501296_000693 Ga0501296_000693_400_1338 262
198 3300049520 Ga0501297_002180 Ga0501297_002180_234_1172 262
199 3300049521 Ga0501298_007803 Ga0501298_007803_392_1330 262
200 3300049523 Ga0501300_007608 Ga0501300_007608_595_1533 262
201 3300049668 Ga0501233_004653 Ga0501233_004653_1352_2290 262
202 3300049669 Ga0501235_001823 Ga0501235_001823_1943_2881 262
203 3300049674 Ga0501242_001899 Ga0501242_001899_388_1326 262
204 3300049685 Ga0501256_003433 Ga0501256_003433_243_1181 262
205 3300049689 Ga0501260_000580 Ga0501260_000580_509_1447 262
206 3300049707 Ga0501234_006180 Ga0501234_006180_192_1130 262
207 3300049708 Ga0501245_001612 Ga0501245_001612_202_1140 262
208 3300049779 Ga0501283_001776 Ga0501283_001776_1170_2108 262
209 3300050513 nmdc:mga0rr50_14623_c1 nmdc:mga0rr50_14623_c1_2337_3245 262
210 3300005337 Ga0070682_100110224 Ga0070682_1001102242 263
211 3300005617 Ga0068859_100244320 Ga0068859_1002443202 263
212 3300005985 Ga0081539_10004393 Ga0081539_100043934 263
213 3300006173 Ga0070716_100117831 Ga0070716_1001178312 263
214 3300006931 Ga0097620_100244323 Ga0097620_1002443232 263
215 3300009553 Ga0105249_10690214 Ga0105249_106902141 263
216 3300014326 Ga0157380_10087413 Ga0157380_100874131 263
217 3300025939 Ga0207665_10048508 Ga0207665_100485082 263
218 3300026095 Ga0207676_10522614 Ga0207676_105226141 263
219 3300005295 Ga0065707_10171915 Ga0065707_101719152 264
220 3300005331 Ga0070670_100142637 Ga0070670_1001426372 264
221 3300005353 Ga0070669_100399354 Ga0070669_1003993542 264
222 3300005471 Ga0070698_100005210 Ga0070698_1000052102 264
223 3300005518 Ga0070699_100216316 Ga0070699_1002163161 264
224 3300005545 Ga0070695_100251008 Ga0070695_1002510082 264
225 3300005546 Ga0070696_100023432 Ga0070696_1000234324 264
226 3300005985 Ga0081539_10011645 Ga0081539_100116452 264
227 3300006871 Ga0075434_100017408 Ga0075434_1000174083 264
228 3300013308 Ga0157375_10044886 Ga0157375_100448863 264
229 3300026116 Ga0207674_10128585 Ga0207674_101285854 264
230 3300050512 nmdc:mga0n895_27814_c1 nmdc:mga0n895_27814_c1_2037_2975 264
231 3300001990 JGI24737J22298_10020719 JGI24737J22298_100207192 265
232 3300003320 rootH2_10113728 rootH2_101137281 265
233 3300005293 Ga0065715_10094019 Ga0065715_100940194 265
234 3300005340 Ga0070689_100000228 Ga0070689_10000022816 265
235 3300005345 Ga0070692_10014359 Ga0070692_100143592 265
236 3300005345 Ga0070692_10040676 Ga0070692_100406763 265
237 3300005441 Ga0070700_100000569 Ga0070700_10000056919 265
238 3300005468 Ga0070707_100000761 Ga0070707_1000007617 265
239 3300005539 Ga0068853_100035104 Ga0068853_1000351043 265
240 3300005549 Ga0070704_100056765 Ga0070704_1000567653 265
241 3300005617 Ga0068859_100015317 Ga0068859_1000153174 265
242 3300005840 Ga0068870_10114948 Ga0068870_101149482 265
243 3300005841 Ga0068863_100100105 Ga0068863_1001001051 265
244 3300005842 Ga0068858_100060977 Ga0068858_1000609774 265
245 3300005843 Ga0068860_100092470 Ga0068860_1000924703 265
246 3300005844 Ga0068862_100066457 Ga0068862_1000664574 265
247 3300006237 Ga0097621_100033755 Ga0097621_1000337554 265
248 3300006871 Ga0075434_100140720 Ga0075434_1001407203 265
249 3300006931 Ga0097620_100015315 Ga0097620_1000153157 265
250 3300009551 Ga0105238_10003265 Ga0105238_100032656 265
251 3300011119 Ga0105246_10182407 Ga0105246_101824072 265
252 3300013100 Ga0157373_10046279 Ga0157373_100462793 265
253 3300013100 Ga0157373_10205382 Ga0157373_102053822 265
254 3300025900 Ga0207710_10116277 Ga0207710_101162771 265
255 3300025904 Ga0207647_10003725 Ga0207647_100037253 265
256 3300025908 Ga0207643_10120339 Ga0207643_101203392 265
257 3300025922 Ga0207646_10000941 Ga0207646_100009414 265
258 3300025924 Ga0207694_10022766 Ga0207694_100227665 265
259 3300025936 Ga0207670_10000207 Ga0207670_100002077 265
260 3300025949 Ga0207667_10648551 Ga0207667_106485511 265
261 3300026035 Ga0207703_10059801 Ga0207703_100598015 265
262 3300026041 Ga0207639_10063510 Ga0207639_100635104 265
263 3300026075 Ga0207708_10000386 Ga0207708_1000038630 265
264 3300028380 Ga0268265_10065299 Ga0268265_100652992 265
265 3300028381 Ga0268264_10065262 Ga0268264_100652622 265
266 3300005295 Ga0065707_10247540 Ga0065707_102475402 266
267 3300005331 Ga0070670_100057214 Ga0070670_1000572142 266
268 3300005364 Ga0070673_100047029 Ga0070673_1000470292 266
269 3300005617 Ga0068859_100185557 Ga0068859_1001855573 266
270 3300005841 Ga0068863_100543634 Ga0068863_1005436341 266
271 3300006844 Ga0075428_100157367 Ga0075428_1001573672 266
272 3300006852 Ga0075433_10188710 Ga0075433_101887102 266
273 3300006931 Ga0097620_100185559 Ga0097620_1001855592 266
274 3300009094 Ga0111539_10068876 Ga0111539_100688762 266
275 3300014326 Ga0157380_10209935 Ga0157380_102099352 266
276 3300025911 Ga0207654_10063598 Ga0207654_100635982 266
277 3300027907 Ga0207428_10029261 Ga0207428_100292615 266
278 3300044673 Ga0453683_0169031 Ga0453683_0169031_479_1375 266
279 3300005444 Ga0070694_100184015 Ga0070694_1001840152 267
280 3300005445 Ga0070708_100319610 Ga0070708_1003196101 267
281 3300005471 Ga0070698_100240948 Ga0070698_1002409482 267
282 3300005577 Ga0068857_100221247 Ga0068857_1002212473 267
283 3300005617 Ga0068859_100054636 Ga0068859_1000546363 267
284 3300005840 Ga0068870_10166421 Ga0068870_101664211 267
285 3300005844 Ga0068862_100017697 Ga0068862_1000176977 267
286 3300006237 Ga0097621_100239472 Ga0097621_1002394722 267
287 3300006931 Ga0097620_100054635 Ga0097620_1000546353 267
288 3300009011 Ga0105251_10135732 Ga0105251_101357322 267
289 3300009148 Ga0105243_10012306 Ga0105243_100123063 267
290 3300009176 Ga0105242_10214885 Ga0105242_102148852 267
291 3300009553 Ga0105249_10389659 Ga0105249_103896592 267
292 3300011119 Ga0105246_10243567 Ga0105246_102435672 267
293 3300013297 Ga0157378_10237920 Ga0157378_102379202 267
294 3300025908 Ga0207643_10192511 Ga0207643_101925111 267
295 3300025911 Ga0207654_10190885 Ga0207654_101908851 267
296 3300025935 Ga0207709_10008381 Ga0207709_100083815 267
297 3300025945 Ga0207679_10077343 Ga0207679_100773431 267
298 3300026088 Ga0207641_10659245 Ga0207641_106592451 267
299 3300026089 Ga0207648_10083848 Ga0207648_100838482 267
300 3300026116 Ga0207674_10022062 Ga0207674_100220624 267
301 3300053083 Ga0495655_0010049 Ga0495655_0010049_865_1758 267
302 3300001432 JGI24034J14986_100205 JGI24034J14986_1002053 268
303 3300002074 JGI24748J21848_1000020 JGI24748J21848_100002055 268
304 3300002239 JGI24034J26672_10000002 JGI24034J26672_10000002233 268
305 3300005295 Ga0065707_10040848 Ga0065707_100408481 268
306 3300005340 Ga0070689_100301283 Ga0070689_1003012832 268
307 3300005355 Ga0070671_100022472 Ga0070671_1000224725 268
308 3300005364 Ga0070673_100094126 Ga0070673_1000941262 268
309 3300005518 Ga0070699_100146166 Ga0070699_1001461661 268
310 3300005536 Ga0070697_100000047 Ga0070697_10000004740 268
311 3300005546 Ga0070696_100180269 Ga0070696_1001802692 268
312 3300005615 Ga0070702_100188985 Ga0070702_1001889852 268
313 3300005617 Ga0068859_100237128 Ga0068859_1002371283 268
314 3300005842 Ga0068858_100000008 Ga0068858_10000000876 268
315 3300006852 Ga0075433_10318259 Ga0075433_103182592 268
316 3300006931 Ga0097620_100237133 Ga0097620_1002371333 268
317 3300009101 Ga0105247_10000001 Ga0105247_10000001407 268
318 3300009147 Ga0114129_10002864 Ga0114129_100028648 268
319 3300009148 Ga0105243_10000646 Ga0105243_100006461 268
320 3300009176 Ga0105242_10001645 Ga0105242_1000164513 268
321 3300013297 Ga0157378_10000019 Ga0157378_1000001963 268
322 3300013307 Ga0157372_10342037 Ga0157372_103420371 268
323 3300013308 Ga0157375_10017803 Ga0157375_100178034 268
324 3300014325 Ga0163163_10191796 Ga0163163_101917962 268
325 3300014968 Ga0157379_10061318 Ga0157379_100613184 268
326 3300025223 Ga0207672_1000065 Ga0207672_100006514 268
327 3300025900 Ga0207710_10000003 Ga0207710_10000003229 268
328 3300025931 Ga0207644_10001567 Ga0207644_100015674 268
329 3300025931 Ga0207644_10003719 Ga0207644_100037193 268
330 3300025934 Ga0207686_10171435 Ga0207686_101714352 268
331 3300025935 Ga0207709_10001127 Ga0207709_100011273 268
332 3300026023 Ga0207677_10310741 Ga0207677_103107412 268
333 3300026035 Ga0207703_10000109 Ga0207703_1000010913 268
334 3300026095 Ga0207676_10242990 Ga0207676_102429902 268
335 3300048909 Ga0496106_0024232 Ga0496106_0024232_2581_3519 268
336 3300050515 nmdc:mga0a205_98799_c1 nmdc:mga0a205_98799_c1_46_966 268
337 3300005293 Ga0065715_10094761 Ga0065715_100947612 269
338 3300005334 Ga0068869_100058635 Ga0068869_1000586353 269
339 3300005335 Ga0070666_10086651 Ga0070666_100866512 269
340 3300005338 Ga0068868_100036486 Ga0068868_1000364862 269
341 3300005364 Ga0070673_100155206 Ga0070673_1001552063 269
342 3300005406 Ga0070703_10000048 Ga0070703_1000004844 269
343 3300005441 Ga0070700_100030220 Ga0070700_1000302202 269
344 3300005459 Ga0068867_100087157 Ga0068867_1000871571 269
345 3300005543 Ga0070672_100179266 Ga0070672_1001792662 269
346 3300005545 Ga0070695_100129004 Ga0070695_1001290042 269
347 3300005546 Ga0070696_100034377 Ga0070696_1000343773 269
348 3300005549 Ga0070704_100190932 Ga0070704_1001909322 269
349 3300005617 Ga0068859_100012155 Ga0068859_1000121557 269
350 3300005618 Ga0068864_100100162 Ga0068864_1001001623 269
351 3300005718 Ga0068866_10214190 Ga0068866_102141902 269
352 3300005841 Ga0068863_100123803 Ga0068863_1001238033 269
353 3300005842 Ga0068858_100044468 Ga0068858_1000444685 269
354 3300005843 Ga0068860_100013902 Ga0068860_1000139027 269
355 3300005843 Ga0068860_100257601 Ga0068860_1002576013 269
356 3300006237 Ga0097621_100002796 Ga0097621_10000279610 269
357 3300006358 Ga0068871_100007882 Ga0068871_1000078827 269
358 3300006844 Ga0075428_100354666 Ga0075428_1003546662 269
359 3300006871 Ga0075434_100487663 Ga0075434_1004876632 269
360 3300006931 Ga0097620_100012155 Ga0097620_1000121557 269
361 3300009176 Ga0105242_10071804 Ga0105242_100718043 269
362 3300009553 Ga0105249_10317775 Ga0105249_103177752 269
363 3300013296 Ga0157374_10021074 Ga0157374_100210742 269
364 3300013297 Ga0157378_10067268 Ga0157378_100672683 269
365 3300013297 Ga0157378_10586028 Ga0157378_105860281 269
366 3300013306 Ga0163162_10007396 Ga0163162_100073965 269
367 3300013306 Ga0163162_10511897 Ga0163162_105118972 269
368 3300013308 Ga0157375_10099018 Ga0157375_100990184 269
369 3300013308 Ga0157375_10341273 Ga0157375_103412732 269
370 3300014325 Ga0163163_10001332 Ga0163163_1000133211 269
371 3300014325 Ga0163163_10025718 Ga0163163_100257184 269
372 3300014325 Ga0163163_10455406 Ga0163163_104554061 269
373 3300014968 Ga0157379_10056084 Ga0157379_100560842 269
374 3300014969 Ga0157376_10109332 Ga0157376_101093322 269
375 3300014969 Ga0157376_10227024 Ga0157376_102270242 269
376 3300025885 Ga0207653_10000175 Ga0207653_100001753 269
377 3300025903 Ga0207680_10184943 Ga0207680_101849431 269
378 3300025931 Ga0207644_10044889 Ga0207644_100448893 269
379 3300025938 Ga0207704_10142521 Ga0207704_101425212 269
380 3300025941 Ga0207711_10080204 Ga0207711_100802042 269
381 3300025941 Ga0207711_10328714 Ga0207711_103287142 269
382 3300025986 Ga0207658_10255740 Ga0207658_102557401 269
383 3300026035 Ga0207703_10121334 Ga0207703_101213343 269
384 3300026075 Ga0207708_10048883 Ga0207708_100488833 269
385 3300026088 Ga0207641_10422704 Ga0207641_104227042 269
386 3300026089 Ga0207648_10119943 Ga0207648_101199433 269
387 3300026095 Ga0207676_10012506 Ga0207676_100125065 269
388 3300026118 Ga0207675_100000727 Ga0207675_1000007273 269
389 3300028379 Ga0268266_10050152 Ga0268266_100501522 269
390 3300028381 Ga0268264_10057045 Ga0268264_100570454 269
391 3300028381 Ga0268264_10314636 Ga0268264_103146362 269
392 3300038443 Ga0395901_0531267 Ga0395901_0531267_259_1182 269
393 3300046472 Ga0495580_0121086 Ga0495580_0121086_684_1601 269
394 3300046674 Ga0495588_0177170 Ga0495588_0177170_128_1045 269
395 3300048917 Ga0496114_0238727 Ga0496114_0238727_159_1076 269
396 3300050512 nmdc:mga0n895_522691_c1 nmdc:mga0n895_522691_c1_158_1057 269
397 3300050515 nmdc:mga0a205_309082_c1 nmdc:mga0a205_309082_c1_518_1417 269
398 3300005288 Ga0065714_10064454 Ga0065714_1006445452 270
399 3300005290 Ga0065712_10000129 Ga0065712_1000012917 270
400 3300005293 Ga0065715_10108203 Ga0065715_101082034 270
401 3300005334 Ga0068869_100049526 Ga0068869_1000495263 270
402 3300005337 Ga0070682_100000053 Ga0070682_10000005331 270
403 3300005338 Ga0068868_100149230 Ga0068868_1001492302 270
404 3300005434 Ga0070709_10120586 Ga0070709_101205863 270
405 3300005444 Ga0070694_100018636 Ga0070694_1000186362 270
406 3300005468 Ga0070707_100213229 Ga0070707_1002132294 270
407 3300005471 Ga0070698_100000143 Ga0070698_10000014328 270
408 3300005471 Ga0070698_100048394 Ga0070698_1000483943 270
409 3300005544 Ga0070686_100296894 Ga0070686_1002968941 270
410 3300005547 Ga0070693_100237383 Ga0070693_1002373832 270
411 3300005719 Ga0068861_100022645 Ga0068861_1000226451 270
412 3300006237 Ga0097621_100146875 Ga0097621_1001468753 270
413 3300006358 Ga0068871_100042557 Ga0068871_1000425574 270
414 3300006914 Ga0075436_100000012 Ga0075436_10000001275 270
415 3300007076 Ga0075435_100001219 Ga0075435_1000012192 270
416 3300007076 Ga0075435_100231520 Ga0075435_1002315201 270
417 3300009148 Ga0105243_10096012 Ga0105243_100960122 270
418 3300009553 Ga0105249_10139416 Ga0105249_101394163 270
419 3300013306 Ga0163162_10047531 Ga0163162_100475312 270
420 3300025906 Ga0207699_10183740 Ga0207699_101837402 270
421 3300025922 Ga0207646_10116464 Ga0207646_101164643 270
422 3300025935 Ga0207709_10130067 Ga0207709_101300672 270
423 3300025942 Ga0207689_10081990 Ga0207689_100819903 270
424 3300025942 Ga0207689_10470756 Ga0207689_104707562 270
425 3300026023 Ga0207677_10092440 Ga0207677_100924402 270
426 3300044673 Ga0453683_0027779 Ga0453683_0027779_217_1155 270
427 3300045051 Ga0451576_0058806 Ga0451576_0058806_645_1583 270
428 3300046525 Ga0495663_0000223 Ga0495663_0000223_5667_6593 270
429 3300046539 Ga0495621_0001177 Ga0495621_0001177_751_1677 270
430 3300048090 Ga0495615_0027223 Ga0495615_0027223_195_1118 270
431 3300050513 nmdc:mga0rr50_223016_c1 nmdc:mga0rr50_223016_c1_151_1065 270
432 3300050513 nmdc:mga0rr50_450_c1 nmdc:mga0rr50_450_c1_15229_16131 270
433 3300050514 nmdc:mga08x19_5_c1 nmdc:mga08x19_5_c1_328710_329612 270
434 3300005295 Ga0065707_10120641 Ga0065707_101206411 271
435 3300005331 Ga0070670_100285306 Ga0070670_1002853062 271
436 3300005334 Ga0068869_100053833 Ga0068869_1000538333 271
437 3300005343 Ga0070687_100019746 Ga0070687_1000197463 271
438 3300005467 Ga0070706_100203414 Ga0070706_1002034143 271
439 3300005544 Ga0070686_100100100 Ga0070686_1001001002 271
440 3300005564 Ga0070664_100216216 Ga0070664_1002162163 271
441 3300005577 Ga0068857_100215226 Ga0068857_1002152261 271
442 3300005937 Ga0081455_10311862 Ga0081455_103118621 271
443 3300006871 Ga0075434_100276147 Ga0075434_1002761472 271
444 3300007788 Ga0099795_10088558 Ga0099795_100885581 271
445 3300009094 Ga0111539_10005448 Ga0111539_100054485 271
446 3300009094 Ga0111539_10591538 Ga0111539_105915382 271
447 3300009147 Ga0114129_10037695 Ga0114129_100376951 271
448 3300009148 Ga0105243_10331091 Ga0105243_103310912 271
449 3300009176 Ga0105242_10000464 Ga0105242_100004647 271
450 3300011119 Ga0105246_10435807 Ga0105246_104358071 271
451 3300013306 Ga0163162_10193194 Ga0163162_101931942 271
452 3300013306 Ga0163162_10439310 Ga0163162_104393102 271
453 3300014325 Ga0163163_10166567 Ga0163163_101665671 271
454 3300017792 Ga0163161_10348762 Ga0163161_103487621 271
455 3300025918 Ga0207662_10009243 Ga0207662_100092433 271
456 3300025923 Ga0207681_10355927 Ga0207681_103559271 271
457 3300025934 Ga0207686_10000090 Ga0207686_1000009034 271
458 3300025934 Ga0207686_10347165 Ga0207686_103471651 271
459 3300025942 Ga0207689_10009419 Ga0207689_100094192 271
460 3300027907 Ga0207428_10024954 Ga0207428_100249544 271
461 3300037471 Ga0395905_0254600 Ga0395905_0254600_264_1172 271
462 3300047318 Ga0495636_0043236 Ga0495636_0043236_355_1293 271
463 3300050511 nmdc:mga08y16_91674_c1 nmdc:mga08y16_91674_c1_2103_3020 271
464 3300054114 Ga0501084_0449824 Ga0501084_0449824_76_990 271
465 3300061734 Ga0530510_0108480 Ga0530510_0108480_215_1129 271
466 3300005334 Ga0068869_100006951 Ga0068869_1000069513 272
467 3300005353 Ga0070669_100132319 Ga0070669_1001323192 272
468 3300005441 Ga0070700_100047449 Ga0070700_1000474492 272
469 3300005445 Ga0070708_100031524 Ga0070708_1000315242 272
470 3300005471 Ga0070698_100000857 Ga0070698_10000085718 272
471 3300005545 Ga0070695_100048846 Ga0070695_1000488463 272
472 3300005615 Ga0070702_100174764 Ga0070702_1001747642 272
473 3300005617 Ga0068859_100014303 Ga0068859_1000143034 272
474 3300005719 Ga0068861_100066551 Ga0068861_1000665511 272
475 3300005843 Ga0068860_100105967 Ga0068860_1001059673 272
476 3300006846 Ga0075430_100046477 Ga0075430_1000464774 272
477 3300006852 Ga0075433_10364892 Ga0075433_103648922 272
478 3300006931 Ga0097620_100014302 Ga0097620_1000143024 272
479 3300009147 Ga0114129_10547180 Ga0114129_105471801 272
480 3300013297 Ga0157378_10432034 Ga0157378_104320342 272
481 3300013308 Ga0157375_10176422 Ga0157375_101764222 272
482 3300025917 Ga0207660_10151392 Ga0207660_101513922 272
483 3300025923 Ga0207681_10175759 Ga0207681_101757592 272
484 3300025933 Ga0207706_10032892 Ga0207706_100328925 272
485 3300025940 Ga0207691_10174318 Ga0207691_101743182 272
486 3300025942 Ga0207689_10018025 Ga0207689_100180255 272
487 3300025960 Ga0207651_10256703 Ga0207651_102567032 272
488 3300025981 Ga0207640_10251194 Ga0207640_102511942 272
489 3300026075 Ga0207708_10030781 Ga0207708_100307814 272
490 3300026118 Ga0207675_100073732 Ga0207675_1000737323 272
491 3300047320 Ga0495672_0011357 Ga0495672_0011357_4258_5190 272
492 3300050507 nmdc:mga05p37_425785_c1 nmdc:mga05p37_425785_c1_510_1424 272
493 3300050508 nmdc:mga09592_269100_c1 nmdc:mga09592_269100_c1_238_1146 272
494 3300050510 nmdc:mga06r32_326012_c1 nmdc:mga06r32_326012_c1_463_1371 272
495 3300003322 rootL2_10085343 rootL2_100853432 273
496 3300005331 Ga0070670_100057826 Ga0070670_1000578264 273
497 3300005353 Ga0070669_100020321 Ga0070669_1000203215 273
498 3300005438 Ga0070701_10003449 Ga0070701_100034492 273
499 3300005440 Ga0070705_100176643 Ga0070705_1001766431 273
500 3300005444 Ga0070694_100036698 Ga0070694_1000366983 273
501 3300005445 Ga0070708_100244638 Ga0070708_1002446382 273
502 3300005467 Ga0070706_100046926 Ga0070706_1000469264 273
503 3300005467 Ga0070706_100083782 Ga0070706_1000837824 273
504 3300005471 Ga0070698_100015234 Ga0070698_1000152345 273
505 3300005518 Ga0070699_100009363 Ga0070699_1000093633 273
506 3300005536 Ga0070697_100000811 Ga0070697_10000081121 273
507 3300005536 Ga0070697_100390015 Ga0070697_1003900151 273
508 3300005544 Ga0070686_100005298 Ga0070686_1000052984 273
509 3300005546 Ga0070696_100118521 Ga0070696_1001185211 273
510 3300005549 Ga0070704_100026888 Ga0070704_1000268883 273
511 3300005549 Ga0070704_100110134 Ga0070704_1001101343 273
512 3300005718 Ga0068866_10003038 Ga0068866_100030383 273
513 3300005841 Ga0068863_100128534 Ga0068863_1001285344 273
514 3300005983 Ga0081540_1055775 Ga0081540_10557753 273
515 3300006852 Ga0075433_10117076 Ga0075433_101170762 273
516 3300006871 Ga0075434_100064420 Ga0075434_1000644202 273
517 3300009148 Ga0105243_10136056 Ga0105243_101360562 273
518 3300009553 Ga0105249_10133657 Ga0105249_101336571 273
519 3300013297 Ga0157378_10062314 Ga0157378_100623145 273
520 3300013306 Ga0163162_10231671 Ga0163162_102316713 273
521 3300014325 Ga0163163_10038983 Ga0163163_100389833 273
522 3300014326 Ga0157380_10013736 Ga0157380_100137365 273
523 3300025899 Ga0207642_10002264 Ga0207642_100022644 273
524 3300025910 Ga0207684_10007446 Ga0207684_100074469 273
525 3300025923 Ga0207681_10000856 Ga0207681_1000085612 273
526 3300025925 Ga0207650_10000526 Ga0207650_1000052619 273
527 3300025934 Ga0207686_10332276 Ga0207686_103322762 273
528 3300025961 Ga0207712_10025809 Ga0207712_100258092 273
529 3300026088 Ga0207641_10095995 Ga0207641_100959954 273
530 3300026089 Ga0207648_10277882 Ga0207648_102778822 273
531 3300031731 Ga0307405_10184330 Ga0307405_101843302 273
532 3300031824 Ga0307413_10144691 Ga0307413_101446912 273
533 3300032002 Ga0307416_100363332 Ga0307416_1003633322 273
534 3300032005 Ga0307411_10038838 Ga0307411_100388384 273
535 3300032126 Ga0307415_100034997 Ga0307415_1000349973 273
536 3300045051 Ga0451576_0255221 Ga0451576_0255221_580_1512 273
537 3300049515 Ga0501292_002422 Ga0501292_002422_1396_2313 273
538 3300049522 Ga0501299_002470 Ga0501299_002470_725_1642 273
539 3300049652 Ga0501202_039618 Ga0501202_039618_80_997 273
540 3300049655 Ga0501208_009527 Ga0501208_009527_222_1139 273
541 3300049660 Ga0501216_002558 Ga0501216_002558_1190_2107 273
542 3300049661 Ga0501217_021929 Ga0501217_021929_479_1396 273
543 3300049667 Ga0501230_012163 Ga0501230_012163_254_1171 273
544 3300049669 Ga0501235_033273 Ga0501235_033273_114_1031 273
545 3300049677 Ga0501247_009044 Ga0501247_009044_214_1131 273
546 3300049679 Ga0501249_010084 Ga0501249_010084_26_943 273
547 3300049690 Ga0501261_006149 Ga0501261_006149_12_929 273
548 3300049705 Ga0501225_0012705 Ga0501225_0012705_720_1637 273
549 3300049707 Ga0501234_009209 Ga0501234_009209_334_1251 273
550 3300050512 nmdc:mga0n895_305469_c1 nmdc:mga0n895_305469_c1_631_1548 273
551 3300050515 nmdc:mga0a205_83063_c1 nmdc:mga0a205_83063_c1_190_1107 273
552 3300005289 Ga0065704_10020787 Ga0065704_100207872 274
553 3300005293 Ga0065715_10145744 Ga0065715_101457441 274
554 3300005295 Ga0065707_10010192 Ga0065707_100101922 274
555 3300005330 Ga0070690_100022746 Ga0070690_1000227461 274
556 3300005335 Ga0070666_10287327 Ga0070666_102873271 274
557 3300005336 Ga0070680_100005606 Ga0070680_1000056065 274
558 3300005338 Ga0068868_100097169 Ga0068868_1000971692 274
559 3300005343 Ga0070687_100079243 Ga0070687_1000792432 274
560 3300005345 Ga0070692_10139726 Ga0070692_101397261 274
561 3300005440 Ga0070705_100424576 Ga0070705_1004245761 274
562 3300005444 Ga0070694_100023777 Ga0070694_1000237774 274
563 3300005457 Ga0070662_100095102 Ga0070662_1000951023 274
564 3300005457 Ga0070662_100173507 Ga0070662_1001735071 274
565 3300005458 Ga0070681_10000362 Ga0070681_100003627 274
566 3300005458 Ga0070681_10002416 Ga0070681_1000241614 274
567 3300005467 Ga0070706_100023122 Ga0070706_1000231224 274
568 3300005467 Ga0070706_100089013 Ga0070706_1000890132 274
569 3300005468 Ga0070707_100182363 Ga0070707_1001823633 274
570 3300005471 Ga0070698_100045288 Ga0070698_1000452883 274
571 3300005471 Ga0070698_100502047 Ga0070698_1005020472 274
572 3300005518 Ga0070699_100221637 Ga0070699_1002216372 274
573 3300005530 Ga0070679_100000540 Ga0070679_10000054026 274
574 3300005536 Ga0070697_100051508 Ga0070697_1000515083 274
575 3300005536 Ga0070697_100301340 Ga0070697_1003013401 274
576 3300005543 Ga0070672_100207047 Ga0070672_1002070472 274
577 3300005544 Ga0070686_100016452 Ga0070686_1000164522 274
578 3300005545 Ga0070695_100081856 Ga0070695_1000818563 274
579 3300005547 Ga0070693_100186248 Ga0070693_1001862481 274
580 3300005549 Ga0070704_100022565 Ga0070704_1000225653 274
581 3300005549 Ga0070704_100077215 Ga0070704_1000772153 274
582 3300005614 Ga0068856_100073874 Ga0068856_1000738742 274
583 3300005617 Ga0068859_100055655 Ga0068859_1000556553 274
584 3300005617 Ga0068859_100219495 Ga0068859_1002194952 274
585 3300005618 Ga0068864_100648731 Ga0068864_1006487312 274
586 3300005719 Ga0068861_100097589 Ga0068861_1000975892 274
587 3300005719 Ga0068861_100136737 Ga0068861_1001367372 274
588 3300005842 Ga0068858_100260384 Ga0068858_1002603841 274
589 3300005843 Ga0068860_100138571 Ga0068860_1001385712 274
590 3300005843 Ga0068860_100314110 Ga0068860_1003141102 274
591 3300006163 Ga0070715_10000005 Ga0070715_10000005204 274
592 3300006173 Ga0070716_100000034 Ga0070716_10000003423 274
593 3300006852 Ga0075433_10064779 Ga0075433_100647794 274
594 3300006871 Ga0075434_100159219 Ga0075434_1001592193 274
595 3300006871 Ga0075434_100788566 Ga0075434_1007885661 274
596 3300006931 Ga0097620_100055655 Ga0097620_1000556553 274
597 3300006931 Ga0097620_100219515 Ga0097620_1002195152 274
598 3300009093 Ga0105240_10078482 Ga0105240_100784824 274
599 3300009093 Ga0105240_10295873 Ga0105240_102958732 274
600 3300009147 Ga0114129_10037171 Ga0114129_100371715 274
601 3300009147 Ga0114129_10159521 Ga0114129_101595213 274
602 3300009174 Ga0105241_10320746 Ga0105241_103207462 274
603 3300009177 Ga0105248_10168269 Ga0105248_101682693 274
604 3300009545 Ga0105237_10274366 Ga0105237_102743662 274
605 3300009553 Ga0105249_10053731 Ga0105249_100537313 274
606 3300009553 Ga0105249_10468382 Ga0105249_104683821 274
607 3300011119 Ga0105246_10265043 Ga0105246_102650432 274
608 3300013297 Ga0157378_10040435 Ga0157378_100404354 274
609 3300013297 Ga0157378_10178768 Ga0157378_101787682 274
610 3300013306 Ga0163162_10002140 Ga0163162_1000214012 274
611 3300013306 Ga0163162_10351952 Ga0163162_103519522 274
612 3300013307 Ga0157372_10026279 Ga0157372_100262795 274
613 3300013307 Ga0157372_10128556 Ga0157372_101285562 274
614 3300013307 Ga0157372_10335976 Ga0157372_103359762 274
615 3300014326 Ga0157380_10047281 Ga0157380_100472813 274
616 3300014326 Ga0157380_10122756 Ga0157380_101227561 274
617 3300014968 Ga0157379_10026966 Ga0157379_100269663 274
618 3300025903 Ga0207680_10224625 Ga0207680_102246251 274
619 3300025905 Ga0207685_10000026 Ga0207685_1000002678 274
620 3300025910 Ga0207684_10060736 Ga0207684_100607362 274
621 3300025910 Ga0207684_10426565 Ga0207684_104265651 274
622 3300025912 Ga0207707_10000031 Ga0207707_1000003140 274
623 3300025912 Ga0207707_10027684 Ga0207707_100276845 274
624 3300025913 Ga0207695_10096136 Ga0207695_100961363 274
625 3300025913 Ga0207695_10224829 Ga0207695_102248292 274
626 3300025914 Ga0207671_10154199 Ga0207671_101541992 274
627 3300025917 Ga0207660_10004070 Ga0207660_100040706 274
628 3300025918 Ga0207662_10038701 Ga0207662_100387014 274
629 3300025918 Ga0207662_10052112 Ga0207662_100521122 274
630 3300025921 Ga0207652_10000087 Ga0207652_1000008789 274
631 3300025922 Ga0207646_10177494 Ga0207646_101774944 274
632 3300025922 Ga0207646_10212540 Ga0207646_102125402 274
633 3300025923 Ga0207681_10072676 Ga0207681_100726763 274
634 3300025933 Ga0207706_10097554 Ga0207706_100975542 274
635 3300025933 Ga0207706_10129193 Ga0207706_101291933 274
636 3300025939 Ga0207665_10000504 Ga0207665_100005044 274
637 3300025961 Ga0207712_10085081 Ga0207712_100850814 274
638 3300025961 Ga0207712_10266274 Ga0207712_102662741 274
639 3300026023 Ga0207677_10022583 Ga0207677_100225834 274
640 3300026035 Ga0207703_10209306 Ga0207703_102093062 274
641 3300026041 Ga0207639_10326406 Ga0207639_103264062 274
642 3300026078 Ga0207702_10196334 Ga0207702_101963343 274
643 3300026088 Ga0207641_10361535 Ga0207641_103615352 274
644 3300026089 Ga0207648_10232437 Ga0207648_102324372 274
645 3300026118 Ga0207675_100016246 Ga0207675_1000162464 274
646 3300026118 Ga0207675_100021791 Ga0207675_1000217915 274
647 3300026118 Ga0207675_100226254 Ga0207675_1002262542 274
648 3300026142 Ga0207698_10513352 Ga0207698_105133521 274
649 3300028381 Ga0268264_10266169 Ga0268264_102661692 274
650 3300035091 Ga0373951_0001041 Ga0373951_0001041_5363_6304 274
651 3300037418 Ga0395900_0347998 Ga0395900_0347998_416_1342 274
652 3300046683 Ga0495658_0070803 Ga0495658_0070803_515_1432 274
653 3300048905 Ga0496102_0076332 Ga0496102_0076332_1800_2717 274
654 3300048907 Ga0496104_0078629 Ga0496104_0078629_829_1746 274
655 3300048911 Ga0496108_0321649 Ga0496108_0321649_58_975 274
656 3300048915 Ga0496112_0109066 Ga0496112_0109066_1560_2477 274
657 3300050507 nmdc:mga05p37_220378_c1 nmdc:mga05p37_220378_c1_598_1542 274
658 3300050509 nmdc:mga0qj67_123711_c1 nmdc:mga0qj67_123711_c1_383_1294 274
659 3300050512 nmdc:mga0n895_664145_c1 nmdc:mga0n895_664145_c1_11_952 274
660 3300050515 nmdc:mga0a205_92926_c1 nmdc:mga0a205_92926_c1_52_969 274
661 2162886007 SwRhRL2b_contig_1039737 SwRhRL2b_0360.00002470 275
662 3300005289 Ga0065704_10075229 Ga0065704_100752293 275
663 3300005295 Ga0065707_10001198 Ga0065707_100011984 275
664 3300005468 Ga0070707_100028094 Ga0070707_1000280944 275
665 3300005471 Ga0070698_100034683 Ga0070698_1000346833 275
666 3300005518 Ga0070699_100009653 Ga0070699_1000096537 275
667 3300005530 Ga0070679_100134864 Ga0070679_1001348643 275
668 3300005536 Ga0070697_100035763 Ga0070697_1000357632 275
669 3300005577 Ga0068857_100461340 Ga0068857_1004613401 275
670 3300005617 Ga0068859_100777818 Ga0068859_1007778181 275
671 3300005840 Ga0068870_10029713 Ga0068870_100297131 275
672 3300006852 Ga0075433_10192584 Ga0075433_101925841 275
673 3300006931 Ga0097620_100777859 Ga0097620_1007778591 275
674 3300009094 Ga0111539_10001823 Ga0111539_1000182316 275
675 3300009177 Ga0105248_10007844 Ga0105248_100078448 275
676 3300014745 Ga0157377_10213353 Ga0157377_102133531 275
677 3300025921 Ga0207652_10056228 Ga0207652_100562283 275
678 3300025922 Ga0207646_10207708 Ga0207646_102077083 275
679 3300025941 Ga0207711_10011318 Ga0207711_100113185 275
680 3300027907 Ga0207428_10018667 Ga0207428_100186675 275
681 3300048909 Ga0496106_0121002 Ga0496106_0121002_946_1875 275
682 3300050511 nmdc:mga08y16_1720_c1 nmdc:mga08y16_1720_c1_20128_21054 275
683 3300050515 nmdc:mga0a205_69352_c1 nmdc:mga0a205_69352_c1_1501_2427 275

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00119

ATP-synt_A

ATP synthase A chain

72

256

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
6vol-assembly1.cif.gz_a chloroplast atp synthase (r2, cf1fo) 0.5982 80 257
7tjy-assembly1.cif.gz_T yeast atp synthase state 1catalytic(a) without exogenous atp backbone model 0.5935 80 258
8g08-assembly1.cif.gz_a cryo-em structure of sq31f-bound mycobacterium smegmatis atp synthase rotational state 1 (backbone model) 0.5769 77 263
8g07-assembly1.cif.gz_a cryo-em structure of sq31f-bound mycobacterium smegmatis atp synthase fo region 0.5769 77 263
6fkh-assembly1.cif.gz_a chloroplast f1fo conformation 2 0.5701 80 256
ID Description Score Start End Superfamily
af_P00854_92_259_1.20.120.220 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);ATP synthase, F0 complex, subunit A 0.4999 132 258 1.20.120.220
af_M1FN39_66_236_1.20.120.220 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);ATP synthase, F0 complex, subunit A 0.4928 129 265 1.20.120.220
af_P24888_3_199_1.20.120.220 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);ATP synthase, F0 complex, subunit A 0.4708 80 263 1.20.120.220
af_Q8N5U1_73_165_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.4613 163 258 1.20.140.150
af_P24888_3_199_1.20.120.220 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);ATP synthase, F0 complex, subunit A 0.4458 80 263 1.20.120.220
ID Description Score Start End GO Terms
AF-A0A0F9JX90-F1-model_v4 F0F1 ATP synthase subunit A 0.8068 74 177 GO:0005886
GO:0042777
GO:0045263
GO:0046933
AF-A0A7C3GJX7-F1-model_v4 F0F1 ATP synthase subunit A 0.7821 77 193 GO:0005886
GO:0042777
GO:0045263
GO:0046933
AF-C4FK81-F1-model_v4 ATP synthase, A subunit 0.7788 77 203 GO:0005886
GO:0042777
GO:0045263
GO:0046933
AF-A0A2V6XE48-F1-model_v4 F0F1 ATP synthase subunit A 0.7697 74 198 GO:0005886
GO:0042777
GO:0045263
GO:0046933
AF-A0A2V9SW82-F1-model_v4 F0F1 ATP synthase subunit A 0.7681 27 223 GO:0005886
GO:0042777
GO:0045263
GO:0046933

Feature Viewer

pLDDT pTM Quality
64.02 0.51 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map