F475016
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 683 | 253 | 683 | 289 |
Family's Representative Sequence
| Representative Sequence | 3300050508|nmdc:mga09592_76681_c1|nmdc:mga09592_76681_c1_136_1035 |
| Length | 267 |
| Sequence | MLFLFAEAEHAEEAAHHAPIIVRLVNQYFGEYVYNLEMKYTYPRWKWFLAKFGTTPEAAFGAYTPENAIPWYTIMFVIACILSVLIIWVLKGKLSEDEPGGGQQTLEASVLAVRGMLQDIVGPHGLQYFPVVMTFAVLILVSNLMALGLSSFLYYNYIGIKENGIVKHLAHLAGPIWWIAPLIFPIELISNFIRPFSLGIRLFGNMFADEQVMETISHLIPGITYWIVPVLIMPLSLFVCFIQTFVFVLLSQLYLSEVSHAAVAVAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 3300001432 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 5 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 6 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 7 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 8 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 9 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 12 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 42 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 49 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 57 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 58 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 60 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 61 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 62 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 63 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 64 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 65 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 66 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 67 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 68 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 69 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 70 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 71 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 75 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 76 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 77 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 78 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 79 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 80 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 82 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 83 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 161 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 165 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 166 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 167 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 168 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 169 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 170 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 171 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 172 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 173 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 174 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 175 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 176 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 177 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 178 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 179 | 3300038699 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 | Metagenome | Rhizosphere |
| 180 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 181 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 182 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 183 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 193 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 194 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 195 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 196 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 197 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 198 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 199 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 200 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 201 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 202 | 3300049518 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control | Metagenome | Rhizosphere |
| 203 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 204 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 205 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 206 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 207 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 208 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 209 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 210 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 211 | 3300049655 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought | Metagenome | Rhizosphere |
| 212 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 213 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 214 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 215 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 216 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 217 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 218 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 219 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 220 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 221 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 222 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 223 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 224 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 225 | 3300049685 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control | Metagenome | Rhizosphere |
| 226 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 227 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 228 | 3300049689 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought | Metagenome | Rhizosphere |
| 229 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 230 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 231 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 232 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 233 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 234 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 235 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 236 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 237 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 238 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 239 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 240 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 241 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 242 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 243 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 244 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 245 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 246 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 247 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 248 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 249 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 250 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 251 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.46 |
| Rhizosphere | 98.24 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.29 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1039737 | 2162886007 | Unclassified | 2616 |
| 2 | JGI24034J14986_100205 | 3300001432 | Unclassified | 3110 |
| 3 | JGI24737J22298_10020719 | 3300001990 | Unclassified | 2097 |
| 4 | JGI24748J21848_1000020 | 3300002074 | Bacteria | 114324 |
| 5 | JGI24034J26672_10000002 | 3300002239 | Bacteria | 925353 |
| 6 | JGI24751J29686_10000006 | 3300002459 | Bacteria | 134556 |
| 7 | rootH2_10113728 | 3300003320 | Bacteria | 1548 |
| 8 | rootL2_10085343 | 3300003322 | Bacteria | 2356 |
| 9 | Ga0065714_10064454 | 3300005288 | Bacteria | 72991 |
| 10 | Ga0065704_10020787 | 3300005289 | Unclassified | 1469 |
| 11 | Ga0065704_10075229 | 3300005289 | Bacteria | 5716 |
| 12 | Ga0065712_10000129 | 3300005290 | Bacteria | 72972 |
| 13 | Ga0065712_10002929 | 3300005290 | Unclassified | 4389 |
| 14 | Ga0065715_10094019 | 3300005293 | Unclassified | 4470 |
| 15 | Ga0065715_10094065 | 3300005293 | Bacteria | 4455 |
| 16 | Ga0065715_10094761 | 3300005293 | Unclassified | 4247 |
| 17 | Ga0065715_10108203 | 3300005293 | Unclassified | 2726 |
| 18 | Ga0065715_10145744 | 3300005293 | Bacteria | 1783 |
| 19 | Ga0065707_10001198 | 3300005295 | Bacteria | 15411 |
| 20 | Ga0065707_10010192 | 3300005295 | Bacteria | 2204 |
| 21 | Ga0065707_10040848 | 3300005295 | Unclassified | 1083 |
| 22 | Ga0065707_10120641 | 3300005295 | Unclassified | 2129 |
| 23 | Ga0065707_10171915 | 3300005295 | Bacteria | 1462 |
| 24 | Ga0065707_10247540 | 3300005295 | Unclassified | 1135 |
| 25 | Ga0070690_100022746 | 3300005330 | Unclassified | 3838 |
| 26 | Ga0070670_100000739 | 3300005331 | Bacteria | 25384 |
| 27 | Ga0070670_100027974 | 3300005331 | Bacteria | 4852 |
| 28 | Ga0070670_100057214 | 3300005331 | Unclassified | 3348 |
| 29 | Ga0070670_100057826 | 3300005331 | Bacteria | 3328 |
| 30 | Ga0070670_100142637 | 3300005331 | Unclassified | 2072 |
| 31 | Ga0070670_100285306 | 3300005331 | Unclassified | 1442 |
| 32 | Ga0068869_100006951 | 3300005334 | Bacteria | 7202 |
| 33 | Ga0068869_100049526 | 3300005334 | Bacteria | 3041 |
| 34 | Ga0068869_100053833 | 3300005334 | Unclassified | 2927 |
| 35 | Ga0068869_100058635 | 3300005334 | Unclassified | 2816 |
| 36 | Ga0070666_10086651 | 3300005335 | Bacteria | 2146 |
| 37 | Ga0070666_10287327 | 3300005335 | Bacteria | 1170 |
| 38 | Ga0070680_100005606 | 3300005336 | Bacteria | 9508 |
| 39 | Ga0070682_100000053 | 3300005337 | Bacteria | 114824 |
| 40 | Ga0070682_100110224 | 3300005337 | Unclassified | 1833 |
| 41 | Ga0068868_100036486 | 3300005338 | Unclassified | 3805 |
| 42 | Ga0068868_100097169 | 3300005338 | Unclassified | 2380 |
| 43 | Ga0068868_100149230 | 3300005338 | Bacteria | 1924 |
| 44 | Ga0070660_100031027 | 3300005339 | Unclassified | 4012 |
| 45 | Ga0070689_100000228 | 3300005340 | Bacteria | 33646 |
| 46 | Ga0070689_100043886 | 3300005340 | Bacteria | 3439 |
| 47 | Ga0070689_100166012 | 3300005340 | Bacteria | 1787 |
| 48 | Ga0070689_100301283 | 3300005340 | Unclassified | 1334 |
| 49 | Ga0070687_100019746 | 3300005343 | Bacteria | 3140 |
| 50 | Ga0070687_100079243 | 3300005343 | Unclassified | 1787 |
| 51 | Ga0070692_10014359 | 3300005345 | Unclassified | 3719 |
| 52 | Ga0070692_10017150 | 3300005345 | Bacteria | 3457 |
| 53 | Ga0070692_10040676 | 3300005345 | Bacteria | 2379 |
| 54 | Ga0070692_10139726 | 3300005345 | Bacteria | 1370 |
| 55 | Ga0070668_100033984 | 3300005347 | Bacteria | 3886 |
| 56 | Ga0070669_100020321 | 3300005353 | Bacteria | 4742 |
| 57 | Ga0070669_100132319 | 3300005353 | Unclassified | 1915 |
| 58 | Ga0070669_100399354 | 3300005353 | Bacteria | 1124 |
| 59 | Ga0070675_100202969 | 3300005354 | Unclassified | 1721 |
| 60 | Ga0070675_100304982 | 3300005354 | Bacteria | 1404 |
| 61 | Ga0070671_100022472 | 3300005355 | Bacteria | 5150 |
| 62 | Ga0070673_100047029 | 3300005364 | Bacteria | 3355 |
| 63 | Ga0070673_100094126 | 3300005364 | Unclassified | 2455 |
| 64 | Ga0070673_100155206 | 3300005364 | Bacteria | 1942 |
| 65 | Ga0070688_100110756 | 3300005365 | Bacteria | 1825 |
| 66 | Ga0070659_100002273 | 3300005366 | Bacteria | 13683 |
| 67 | Ga0070703_10000048 | 3300005406 | Bacteria | 58117 |
| 68 | Ga0070703_10006463 | 3300005406 | Unclassified | 3286 |
| 69 | Ga0070709_10120586 | 3300005434 | Unclassified | 1777 |
| 70 | Ga0070701_10003449 | 3300005438 | Bacteria | 6262 |
| 71 | Ga0070701_10024550 | 3300005438 | Unclassified | 2917 |
| 72 | Ga0070705_100006565 | 3300005440 | Bacteria | 5712 |
| 73 | Ga0070705_100171790 | 3300005440 | Bacteria | 1460 |
| 74 | Ga0070705_100176643 | 3300005440 | Bacteria | 1442 |
| 75 | Ga0070705_100424576 | 3300005440 | Unclassified | 991 |
| 76 | Ga0070700_100000569 | 3300005441 | Bacteria | 18502 |
| 77 | Ga0070700_100006434 | 3300005441 | Bacteria | 6283 |
| 78 | Ga0070700_100030220 | 3300005441 | Bacteria | 3236 |
| 79 | Ga0070700_100031495 | 3300005441 | Unclassified | 3179 |
| 80 | Ga0070700_100047449 | 3300005441 | Unclassified | 2658 |
| 81 | Ga0070694_100003766 | 3300005444 | Bacteria | 9045 |
| 82 | Ga0070694_100011628 | 3300005444 | Bacteria | 5449 |
| 83 | Ga0070694_100016906 | 3300005444 | Unclassified | 4600 |
| 84 | Ga0070694_100018636 | 3300005444 | Bacteria | 4407 |
| 85 | Ga0070694_100023777 | 3300005444 | Unclassified | 3946 |
| 86 | Ga0070694_100036698 | 3300005444 | Bacteria | 3247 |
| 87 | Ga0070694_100089542 | 3300005444 | Bacteria | 2156 |
| 88 | Ga0070694_100184015 | 3300005444 | Bacteria | 1547 |
| 89 | Ga0070708_100031524 | 3300005445 | Bacteria | 4589 |
| 90 | Ga0070708_100244638 | 3300005445 | Bacteria | 1684 |
| 91 | Ga0070708_100319610 | 3300005445 | Bacteria | 1462 |
| 92 | Ga0070662_100095102 | 3300005457 | Bacteria | 2245 |
| 93 | Ga0070662_100173507 | 3300005457 | Bacteria | 1695 |
| 94 | Ga0070681_10000362 | 3300005458 | Bacteria | 36657 |
| 95 | Ga0070681_10002416 | 3300005458 | Bacteria | 17095 |
| 96 | Ga0070681_10015191 | 3300005458 | Bacteria | 7658 |
| 97 | Ga0068867_100087157 | 3300005459 | Unclassified | 2363 |
| 98 | Ga0070706_100000044 | 3300005467 | Bacteria | 146303 |
| 99 | Ga0070706_100023122 | 3300005467 | Bacteria | 5723 |
| 100 | Ga0070706_100023837 | 3300005467 | Bacteria | 5634 |
| 101 | Ga0070706_100046926 | 3300005467 | Bacteria | 3986 |
| 102 | Ga0070706_100083782 | 3300005467 | Bacteria | 2954 |
| 103 | Ga0070706_100089013 | 3300005467 | Unclassified | 2862 |
| 104 | Ga0070706_100203414 | 3300005467 | Bacteria | 1850 |
| 105 | Ga0070707_100000761 | 3300005468 | Bacteria | 31798 |
| 106 | Ga0070707_100028094 | 3300005468 | Bacteria | 5352 |
| 107 | Ga0070707_100069107 | 3300005468 | Bacteria | 3400 |
| 108 | Ga0070707_100182363 | 3300005468 | Bacteria | 2047 |
| 109 | Ga0070707_100213229 | 3300005468 | Unclassified | 1882 |
| 110 | Ga0070707_100544291 | 3300005468 | Unclassified | 1123 |
| 111 | Ga0070698_100000143 | 3300005471 | Bacteria | 64748 |
| 112 | Ga0070698_100000857 | 3300005471 | Bacteria | 33406 |
| 113 | Ga0070698_100005210 | 3300005471 | Bacteria | 14215 |
| 114 | Ga0070698_100015234 | 3300005471 | Bacteria | 8130 |
| 115 | Ga0070698_100034683 | 3300005471 | Bacteria | 5221 |
| 116 | Ga0070698_100045288 | 3300005471 | Unclassified | 4503 |
| 117 | Ga0070698_100048394 | 3300005471 | Bacteria | 4344 |
| 118 | Ga0070698_100240948 | 3300005471 | Bacteria | 1742 |
| 119 | Ga0070698_100502047 | 3300005471 | Unclassified | 1151 |
| 120 | Ga0070699_100002843 | 3300005518 | Bacteria | 15446 |
| 121 | Ga0070699_100009363 | 3300005518 | Bacteria | 8483 |
| 122 | Ga0070699_100009653 | 3300005518 | Bacteria | 8354 |
| 123 | Ga0070699_100146166 | 3300005518 | Unclassified | 2089 |
| 124 | Ga0070699_100216316 | 3300005518 | Bacteria | 1707 |
| 125 | Ga0070699_100221637 | 3300005518 | Bacteria | 1686 |
| 126 | Ga0070679_100000540 | 3300005530 | Bacteria | 32202 |
| 127 | Ga0070679_100030221 | 3300005530 | Bacteria | 5348 |
| 128 | Ga0070679_100134864 | 3300005530 | Bacteria | 2450 |
| 129 | Ga0070697_100000047 | 3300005536 | Bacteria | 90650 |
| 130 | Ga0070697_100000811 | 3300005536 | Bacteria | 23439 |
| 131 | Ga0070697_100035763 | 3300005536 | Bacteria | 4009 |
| 132 | Ga0070697_100051508 | 3300005536 | Bacteria | 3344 |
| 133 | Ga0070697_100301340 | 3300005536 | Unclassified | 1378 |
| 134 | Ga0070697_100390015 | 3300005536 | Unclassified | 1207 |
| 135 | Ga0068853_100035104 | 3300005539 | Unclassified | 4259 |
| 136 | Ga0068853_100055465 | 3300005539 | Unclassified | 3416 |
| 137 | Ga0070672_100179266 | 3300005543 | Bacteria | 1765 |
| 138 | Ga0070672_100207047 | 3300005543 | Bacteria | 1642 |
| 139 | Ga0070686_100005298 | 3300005544 | Bacteria | 7129 |
| 140 | Ga0070686_100016452 | 3300005544 | Bacteria | 4303 |
| 141 | Ga0070686_100024497 | 3300005544 | Bacteria | 3617 |
| 142 | Ga0070686_100049811 | 3300005544 | Unclassified | 2659 |
| 143 | Ga0070686_100100100 | 3300005544 | Unclassified | 1956 |
| 144 | Ga0070686_100296894 | 3300005544 | Bacteria | 1197 |
| 145 | Ga0070695_100048846 | 3300005545 | Bacteria | 2707 |
| 146 | Ga0070695_100081856 | 3300005545 | Unclassified | 2137 |
| 147 | Ga0070695_100129004 | 3300005545 | Bacteria | 1741 |
| 148 | Ga0070695_100251008 | 3300005545 | Bacteria | 1288 |
| 149 | Ga0070695_100333326 | 3300005545 | Bacteria | 1132 |
| 150 | Ga0070696_100023432 | 3300005546 | Unclassified | 4195 |
| 151 | Ga0070696_100034377 | 3300005546 | Bacteria | 3487 |
| 152 | Ga0070696_100118521 | 3300005546 | Unclassified | 1914 |
| 153 | Ga0070696_100138231 | 3300005546 | Bacteria | 1778 |
| 154 | Ga0070696_100151830 | 3300005546 | Bacteria | 1701 |
| 155 | Ga0070696_100180269 | 3300005546 | Unclassified | 1567 |
| 156 | Ga0070693_100016399 | 3300005547 | Unclassified | 3834 |
| 157 | Ga0070693_100186248 | 3300005547 | Bacteria | 1340 |
| 158 | Ga0070693_100237383 | 3300005547 | Unclassified | 1202 |
| 159 | Ga0070704_100008763 | 3300005549 | Bacteria | 6085 |
| 160 | Ga0070704_100022565 | 3300005549 | Bacteria | 4098 |
| 161 | Ga0070704_100026888 | 3300005549 | Bacteria | 3808 |
| 162 | Ga0070704_100056765 | 3300005549 | Bacteria | 2781 |
| 163 | Ga0070704_100077215 | 3300005549 | Unclassified | 2439 |
| 164 | Ga0070704_100110134 | 3300005549 | Bacteria | 2094 |
| 165 | Ga0070704_100130823 | 3300005549 | Bacteria | 1945 |
| 166 | Ga0070704_100190932 | 3300005549 | Bacteria | 1646 |
| 167 | Ga0070664_100003825 | 3300005564 | Bacteria | 12152 |
| 168 | Ga0070664_100216216 | 3300005564 | Unclassified | 1714 |
| 169 | Ga0068857_100003794 | 3300005577 | Bacteria | 12716 |
| 170 | Ga0068857_100128807 | 3300005577 | Bacteria | 2282 |
| 171 | Ga0068857_100215226 | 3300005577 | Unclassified | 1754 |
| 172 | Ga0068857_100221247 | 3300005577 | Bacteria | 1729 |
| 173 | Ga0068857_100461340 | 3300005577 | Bacteria | 1189 |
| 174 | Ga0068856_100073874 | 3300005614 | Bacteria | 3376 |
| 175 | Ga0070702_100021459 | 3300005615 | Unclassified | 3398 |
| 176 | Ga0070702_100174764 | 3300005615 | Unclassified | 1400 |
| 177 | Ga0070702_100188985 | 3300005615 | Bacteria | 1354 |
| 178 | Ga0068859_100012155 | 3300005617 | Bacteria | 8652 |
| 179 | Ga0068859_100014303 | 3300005617 | Bacteria | 7960 |
| 180 | Ga0068859_100015317 | 3300005617 | Bacteria | 7702 |
| 181 | Ga0068859_100029722 | 3300005617 | Bacteria | 5482 |
| 182 | Ga0068859_100054636 | 3300005617 | Bacteria | 4017 |
| 183 | Ga0068859_100055655 | 3300005617 | Bacteria | 3980 |
| 184 | Ga0068859_100185557 | 3300005617 | Bacteria | 2164 |
| 185 | Ga0068859_100219495 | 3300005617 | Unclassified | 1989 |
| 186 | Ga0068859_100237128 | 3300005617 | Unclassified | 1913 |
| 187 | Ga0068859_100244320 | 3300005617 | Bacteria | 1884 |
| 188 | Ga0068859_100777818 | 3300005617 | Unclassified | 1045 |
| 189 | Ga0068864_100100162 | 3300005618 | Bacteria | 2568 |
| 190 | Ga0068864_100648731 | 3300005618 | Unclassified | 1028 |
| 191 | Ga0068866_10003038 | 3300005718 | Bacteria | 6924 |
| 192 | Ga0068866_10214190 | 3300005718 | Bacteria | 1158 |
| 193 | Ga0068861_100022645 | 3300005719 | Bacteria | 4529 |
| 194 | Ga0068861_100066551 | 3300005719 | Unclassified | 2778 |
| 195 | Ga0068861_100097589 | 3300005719 | Unclassified | 2331 |
| 196 | Ga0068861_100105847 | 3300005719 | Unclassified | 2246 |
| 197 | Ga0068861_100136737 | 3300005719 | Bacteria | 1995 |
| 198 | Ga0068870_10029713 | 3300005840 | Bacteria | 2755 |
| 199 | Ga0068870_10114948 | 3300005840 | Unclassified | 1542 |
| 200 | Ga0068870_10166421 | 3300005840 | Unclassified | 1312 |
| 201 | Ga0068863_100089448 | 3300005841 | Bacteria | 2919 |
| 202 | Ga0068863_100100105 | 3300005841 | Bacteria | 2754 |
| 203 | Ga0068863_100123803 | 3300005841 | Bacteria | 2467 |
| 204 | Ga0068863_100128534 | 3300005841 | Unclassified | 2418 |
| 205 | Ga0068863_100543634 | 3300005841 | Bacteria | 1146 |
| 206 | Ga0068858_100000008 | 3300005842 | Bacteria | 238361 |
| 207 | Ga0068858_100044468 | 3300005842 | Unclassified | 4116 |
| 208 | Ga0068858_100048180 | 3300005842 | Bacteria | 3949 |
| 209 | Ga0068858_100060977 | 3300005842 | Bacteria | 3487 |
| 210 | Ga0068858_100260384 | 3300005842 | Unclassified | 1648 |
| 211 | Ga0068860_100013902 | 3300005843 | Bacteria | 7891 |
| 212 | Ga0068860_100038636 | 3300005843 | Unclassified | 4566 |
| 213 | Ga0068860_100092470 | 3300005843 | Bacteria | 2882 |
| 214 | Ga0068860_100105967 | 3300005843 | Bacteria | 2685 |
| 215 | Ga0068860_100138571 | 3300005843 | Bacteria | 2337 |
| 216 | Ga0068860_100202519 | 3300005843 | Bacteria | 1924 |
| 217 | Ga0068860_100255697 | 3300005843 | Unclassified | 1706 |
| 218 | Ga0068860_100257601 | 3300005843 | Bacteria | 1700 |
| 219 | Ga0068860_100314110 | 3300005843 | Bacteria | 1537 |
| 220 | Ga0068862_100017697 | 3300005844 | Bacteria | 5932 |
| 221 | Ga0068862_100066457 | 3300005844 | Bacteria | 3107 |
| 222 | Ga0068862_100186187 | 3300005844 | Bacteria | 1866 |
| 223 | Ga0081455_10311862 | 3300005937 | Bacteria | 1124 |
| 224 | Ga0081540_1055775 | 3300005983 | Bacteria | 1922 |
| 225 | Ga0081539_10004393 | 3300005985 | Bacteria | 15647 |
| 226 | Ga0081539_10011645 | 3300005985 | Bacteria | 6922 |
| 227 | Ga0070715_10000005 | 3300006163 | Bacteria | 298716 |
| 228 | Ga0070716_100000034 | 3300006173 | Bacteria | 56620 |
| 229 | Ga0070716_100117831 | 3300006173 | Archaea | 1657 |
| 230 | Ga0097621_100002796 | 3300006237 | Bacteria | 11948 |
| 231 | Ga0097621_100033755 | 3300006237 | Unclassified | 4078 |
| 232 | Ga0097621_100146875 | 3300006237 | Unclassified | 2020 |
| 233 | Ga0097621_100239472 | 3300006237 | Bacteria | 1586 |
| 234 | Ga0068871_100007882 | 3300006358 | Bacteria | 7636 |
| 235 | Ga0068871_100042557 | 3300006358 | Unclassified | 3646 |
| 236 | Ga0068871_100170635 | 3300006358 | Bacteria | 1864 |
| 237 | Ga0075428_100157367 | 3300006844 | Bacteria | 2467 |
| 238 | Ga0075428_100354666 | 3300006844 | Bacteria | 1574 |
| 239 | Ga0075430_100046477 | 3300006846 | Bacteria | 3666 |
| 240 | Ga0075433_10064779 | 3300006852 | Bacteria | 3204 |
| 241 | Ga0075433_10117076 | 3300006852 | Bacteria | 2364 |
| 242 | Ga0075433_10188710 | 3300006852 | Bacteria | 1834 |
| 243 | Ga0075433_10192584 | 3300006852 | Bacteria | 1814 |
| 244 | Ga0075433_10318259 | 3300006852 | Bacteria | 1377 |
| 245 | Ga0075433_10364892 | 3300006852 | Bacteria | 1275 |
| 246 | Ga0075434_100017408 | 3300006871 | Bacteria | 6924 |
| 247 | Ga0075434_100030724 | 3300006871 | Bacteria | 5292 |
| 248 | Ga0075434_100064420 | 3300006871 | Unclassified | 3649 |
| 249 | Ga0075434_100140720 | 3300006871 | Unclassified | 2432 |
| 250 | Ga0075434_100159219 | 3300006871 | Bacteria | 2277 |
| 251 | Ga0075434_100276147 | 3300006871 | Bacteria | 1700 |
| 252 | Ga0075434_100487663 | 3300006871 | Bacteria | 1253 |
| 253 | Ga0075434_100788566 | 3300006871 | Bacteria | 966 |
| 254 | Ga0075436_100000012 | 3300006914 | Bacteria | 188052 |
| 255 | Ga0075436_100286201 | 3300006914 | Unclassified | 1179 |
| 256 | Ga0097620_100012155 | 3300006931 | Bacteria | 8652 |
| 257 | Ga0097620_100014302 | 3300006931 | Bacteria | 7960 |
| 258 | Ga0097620_100015315 | 3300006931 | Bacteria | 7702 |
| 259 | Ga0097620_100029722 | 3300006931 | Bacteria | 5482 |
| 260 | Ga0097620_100054635 | 3300006931 | Bacteria | 4017 |
| 261 | Ga0097620_100055655 | 3300006931 | Bacteria | 3980 |
| 262 | Ga0097620_100185559 | 3300006931 | Bacteria | 2164 |
| 263 | Ga0097620_100219515 | 3300006931 | Unclassified | 1989 |
| 264 | Ga0097620_100237133 | 3300006931 | Unclassified | 1913 |
| 265 | Ga0097620_100244323 | 3300006931 | Bacteria | 1884 |
| 266 | Ga0097620_100777859 | 3300006931 | Unclassified | 1045 |
| 267 | Ga0075435_100001219 | 3300007076 | Bacteria | 16470 |
| 268 | Ga0075435_100231520 | 3300007076 | Unclassified | 1570 |
| 269 | Ga0099795_10088558 | 3300007788 | Bacteria | 1196 |
| 270 | Ga0105251_10135732 | 3300009011 | Bacteria | 1114 |
| 271 | Ga0105240_10078482 | 3300009093 | Bacteria | 4066 |
| 272 | Ga0105240_10295873 | 3300009093 | Bacteria | 1854 |
| 273 | Ga0105240_10840452 | 3300009093 | Unclassified | 992 |
| 274 | Ga0111539_10001823 | 3300009094 | Bacteria | 28370 |
| 275 | Ga0111539_10005448 | 3300009094 | Bacteria | 16464 |
| 276 | Ga0111539_10068876 | 3300009094 | Bacteria | 4178 |
| 277 | Ga0111539_10069877 | 3300009094 | Bacteria | 4146 |
| 278 | Ga0111539_10591538 | 3300009094 | Bacteria | 1292 |
| 279 | Ga0105247_10000001 | 3300009101 | Bacteria | 739726 |
| 280 | Ga0105247_10005468 | 3300009101 | Bacteria | 8006 |
| 281 | Ga0114129_10002864 | 3300009147 | Bacteria | 24130 |
| 282 | Ga0114129_10037171 | 3300009147 | Bacteria | 6875 |
| 283 | Ga0114129_10037695 | 3300009147 | Bacteria | 6824 |
| 284 | Ga0114129_10037717 | 3300009147 | Bacteria | 6822 |
| 285 | Ga0114129_10042987 | 3300009147 | Bacteria | 6360 |
| 286 | Ga0114129_10159521 | 3300009147 | Unclassified | 3083 |
| 287 | Ga0114129_10294483 | 3300009147 | Unclassified | 2165 |
| 288 | Ga0114129_10527761 | 3300009147 | Unclassified | 1538 |
| 289 | Ga0114129_10547180 | 3300009147 | Bacteria | 1506 |
| 290 | Ga0105243_10000242 | 3300009148 | Bacteria | 62471 |
| 291 | Ga0105243_10000646 | 3300009148 | Bacteria | 34469 |
| 292 | Ga0105243_10012306 | 3300009148 | Bacteria | 6470 |
| 293 | Ga0105243_10096012 | 3300009148 | Unclassified | 2451 |
| 294 | Ga0105243_10123060 | 3300009148 | Unclassified | 2190 |
| 295 | Ga0105243_10136056 | 3300009148 | Bacteria | 2091 |
| 296 | Ga0105243_10196844 | 3300009148 | Unclassified | 1764 |
| 297 | Ga0105243_10331091 | 3300009148 | Unclassified | 1391 |
| 298 | Ga0105241_10033890 | 3300009174 | Unclassified | 3835 |
| 299 | Ga0105241_10165777 | 3300009174 | Bacteria | 1820 |
| 300 | Ga0105241_10320746 | 3300009174 | Unclassified | 1336 |
| 301 | Ga0105242_10000092 | 3300009176 | Bacteria | 62471 |
| 302 | Ga0105242_10000464 | 3300009176 | Bacteria | 32271 |
| 303 | Ga0105242_10001645 | 3300009176 | Bacteria | 17657 |
| 304 | Ga0105242_10071804 | 3300009176 | Bacteria | 2873 |
| 305 | Ga0105242_10214885 | 3300009176 | Unclassified | 1715 |
| 306 | Ga0105248_10007844 | 3300009177 | Bacteria | 11722 |
| 307 | Ga0105248_10076483 | 3300009177 | Bacteria | 3763 |
| 308 | Ga0105248_10168269 | 3300009177 | Bacteria | 2470 |
| 309 | Ga0105248_10191193 | 3300009177 | Unclassified | 2306 |
| 310 | Ga0105237_10031885 | 3300009545 | Bacteria | 5337 |
| 311 | Ga0105237_10274366 | 3300009545 | Bacteria | 1689 |
| 312 | Ga0105238_10003265 | 3300009551 | Bacteria | 16179 |
| 313 | Ga0105238_10022347 | 3300009551 | Bacteria | 6448 |
| 314 | Ga0105249_10000032 | 3300009553 | Bacteria | 215247 |
| 315 | Ga0105249_10034607 | 3300009553 | Bacteria | 4579 |
| 316 | Ga0105249_10053731 | 3300009553 | Bacteria | 3682 |
| 317 | Ga0105249_10133657 | 3300009553 | Bacteria | 2371 |
| 318 | Ga0105249_10139416 | 3300009553 | Bacteria | 2323 |
| 319 | Ga0105249_10317775 | 3300009553 | Bacteria | 1568 |
| 320 | Ga0105249_10389659 | 3300009553 | Unclassified | 1421 |
| 321 | Ga0105249_10468382 | 3300009553 | Bacteria | 1301 |
| 322 | Ga0105249_10690214 | 3300009553 | Bacteria | 1080 |
| 323 | Ga0105246_10124288 | 3300011119 | Unclassified | 1917 |
| 324 | Ga0105246_10182407 | 3300011119 | Unclassified | 1617 |
| 325 | Ga0105246_10243567 | 3300011119 | Bacteria | 1423 |
| 326 | Ga0105246_10265043 | 3300011119 | Bacteria | 1371 |
| 327 | Ga0105246_10435807 | 3300011119 | Unclassified | 1098 |
| 328 | Ga0157373_10046279 | 3300013100 | Bacteria | 3104 |
| 329 | Ga0157373_10205382 | 3300013100 | Unclassified | 1389 |
| 330 | Ga0157374_10021074 | 3300013296 | Bacteria | 5793 |
| 331 | Ga0157378_10000019 | 3300013297 | Bacteria | 132704 |
| 332 | Ga0157378_10040435 | 3300013297 | Bacteria | 4134 |
| 333 | Ga0157378_10062314 | 3300013297 | Unclassified | 3330 |
| 334 | Ga0157378_10067268 | 3300013297 | Bacteria | 3210 |
| 335 | Ga0157378_10178768 | 3300013297 | Bacteria | 1995 |
| 336 | Ga0157378_10219596 | 3300013297 | Unclassified | 1806 |
| 337 | Ga0157378_10237920 | 3300013297 | Unclassified | 1738 |
| 338 | Ga0157378_10432034 | 3300013297 | Bacteria | 1303 |
| 339 | Ga0157378_10586028 | 3300013297 | Unclassified | 1125 |
| 340 | Ga0163162_10000006 | 3300013306 | Bacteria | 410012 |
| 341 | Ga0163162_10002140 | 3300013306 | Bacteria | 18529 |
| 342 | Ga0163162_10007396 | 3300013306 | Bacteria | 10679 |
| 343 | Ga0163162_10047531 | 3300013306 | Unclassified | 4301 |
| 344 | Ga0163162_10193194 | 3300013306 | Unclassified | 2163 |
| 345 | Ga0163162_10231671 | 3300013306 | Bacteria | 1977 |
| 346 | Ga0163162_10257262 | 3300013306 | Bacteria | 1878 |
| 347 | Ga0163162_10351952 | 3300013306 | Bacteria | 1606 |
| 348 | Ga0163162_10439310 | 3300013306 | Bacteria | 1437 |
| 349 | Ga0163162_10511897 | 3300013306 | Unclassified | 1330 |
| 350 | Ga0163162_10780374 | 3300013306 | Unclassified | 1074 |
| 351 | Ga0157372_10026279 | 3300013307 | Bacteria | 6334 |
| 352 | Ga0157372_10128556 | 3300013307 | Bacteria | 2914 |
| 353 | Ga0157372_10335976 | 3300013307 | Bacteria | 1760 |
| 354 | Ga0157372_10342037 | 3300013307 | Bacteria | 1743 |
| 355 | Ga0157372_10433739 | 3300013307 | Unclassified | 1532 |
| 356 | Ga0157372_10891512 | 3300013307 | Bacteria | 1032 |
| 357 | Ga0157375_10017803 | 3300013308 | Bacteria | 6425 |
| 358 | Ga0157375_10044886 | 3300013308 | Unclassified | 4299 |
| 359 | Ga0157375_10099018 | 3300013308 | Bacteria | 2994 |
| 360 | Ga0157375_10176422 | 3300013308 | Unclassified | 2287 |
| 361 | Ga0157375_10341273 | 3300013308 | Bacteria | 1663 |
| 362 | Ga0163163_10000983 | 3300014325 | Bacteria | 24185 |
| 363 | Ga0163163_10001332 | 3300014325 | Bacteria | 20826 |
| 364 | Ga0163163_10007267 | 3300014325 | Bacteria | 9766 |
| 365 | Ga0163163_10025718 | 3300014325 | Bacteria | 5614 |
| 366 | Ga0163163_10038983 | 3300014325 | Unclassified | 4634 |
| 367 | Ga0163163_10107477 | 3300014325 | Unclassified | 2817 |
| 368 | Ga0163163_10144834 | 3300014325 | Unclassified | 2419 |
| 369 | Ga0163163_10166567 | 3300014325 | Unclassified | 2250 |
| 370 | Ga0163163_10191796 | 3300014325 | Bacteria | 2092 |
| 371 | Ga0163163_10455406 | 3300014325 | Bacteria | 1340 |
| 372 | Ga0163163_10625086 | 3300014325 | Bacteria | 1140 |
| 373 | Ga0157380_10013736 | 3300014326 | Bacteria | 5912 |
| 374 | Ga0157380_10047281 | 3300014326 | Unclassified | 3384 |
| 375 | Ga0157380_10049392 | 3300014326 | Unclassified | 3318 |
| 376 | Ga0157380_10087413 | 3300014326 | Bacteria | 2563 |
| 377 | Ga0157380_10122756 | 3300014326 | Unclassified | 2203 |
| 378 | Ga0157380_10209935 | 3300014326 | Bacteria | 1734 |
| 379 | Ga0157377_10213353 | 3300014745 | Bacteria | 1232 |
| 380 | Ga0157379_10026966 | 3300014968 | Bacteria | 5113 |
| 381 | Ga0157379_10056084 | 3300014968 | Unclassified | 3521 |
| 382 | Ga0157379_10061318 | 3300014968 | Bacteria | 3363 |
| 383 | Ga0157376_10109332 | 3300014969 | Bacteria | 2430 |
| 384 | Ga0157376_10227024 | 3300014969 | Bacteria | 1732 |
| 385 | Ga0163161_10348762 | 3300017792 | Bacteria | 1176 |
| 386 | Ga0207672_1000065 | 3300025223 | Bacteria | 14210 |
| 387 | Ga0207653_10000175 | 3300025885 | Bacteria | 44967 |
| 388 | Ga0207653_10005112 | 3300025885 | Unclassified | 4099 |
| 389 | Ga0207642_10002264 | 3300025899 | Bacteria | 5988 |
| 390 | Ga0207710_10000003 | 3300025900 | Bacteria | 1071597 |
| 391 | Ga0207710_10002199 | 3300025900 | Bacteria | 9170 |
| 392 | Ga0207710_10116277 | 3300025900 | Bacteria | 1273 |
| 393 | Ga0207680_10184943 | 3300025903 | Bacteria | 1411 |
| 394 | Ga0207680_10224625 | 3300025903 | Bacteria | 1289 |
| 395 | Ga0207647_10003725 | 3300025904 | Bacteria | 11400 |
| 396 | Ga0207685_10000026 | 3300025905 | Bacteria | 109892 |
| 397 | Ga0207699_10183740 | 3300025906 | Unclassified | 1407 |
| 398 | Ga0207645_10066030 | 3300025907 | Unclassified | 2313 |
| 399 | Ga0207643_10014841 | 3300025908 | Bacteria | 4236 |
| 400 | Ga0207643_10120339 | 3300025908 | Unclassified | 1555 |
| 401 | Ga0207643_10192511 | 3300025908 | Unclassified | 1238 |
| 402 | Ga0207684_10001881 | 3300025910 | Bacteria | 21837 |
| 403 | Ga0207684_10007446 | 3300025910 | Bacteria | 9851 |
| 404 | Ga0207684_10019404 | 3300025910 | Bacteria | 5818 |
| 405 | Ga0207684_10060736 | 3300025910 | Unclassified | 3210 |
| 406 | Ga0207684_10426565 | 3300025910 | Bacteria | 1139 |
| 407 | Ga0207654_10063598 | 3300025911 | Bacteria | 2166 |
| 408 | Ga0207654_10111425 | 3300025911 | Bacteria | 1703 |
| 409 | Ga0207654_10190885 | 3300025911 | Unclassified | 1342 |
| 410 | Ga0207654_10263774 | 3300025911 | Viruses | 1159 |
| 411 | Ga0207707_10000031 | 3300025912 | Bacteria | 159505 |
| 412 | Ga0207707_10027684 | 3300025912 | Bacteria | 4957 |
| 413 | Ga0207695_10096136 | 3300025913 | Bacteria | 2964 |
| 414 | Ga0207695_10224829 | 3300025913 | Bacteria | 1783 |
| 415 | Ga0207671_10154199 | 3300025914 | Bacteria | 1776 |
| 416 | Ga0207660_10004070 | 3300025917 | Bacteria | 9535 |
| 417 | Ga0207660_10151392 | 3300025917 | Unclassified | 1782 |
| 418 | Ga0207662_10009243 | 3300025918 | Bacteria | 5417 |
| 419 | Ga0207662_10038701 | 3300025918 | Bacteria | 2795 |
| 420 | Ga0207662_10052112 | 3300025918 | Unclassified | 2435 |
| 421 | Ga0207662_10061884 | 3300025918 | Bacteria | 2248 |
| 422 | Ga0207662_10087381 | 3300025918 | Bacteria | 1912 |
| 423 | Ga0207657_10082494 | 3300025919 | Unclassified | 2699 |
| 424 | Ga0207652_10000087 | 3300025921 | Bacteria | 99945 |
| 425 | Ga0207652_10056228 | 3300025921 | Bacteria | 3387 |
| 426 | Ga0207646_10000941 | 3300025922 | Bacteria | 37455 |
| 427 | Ga0207646_10007403 | 3300025922 | Bacteria | 11162 |
| 428 | Ga0207646_10116464 | 3300025922 | Bacteria | 2400 |
| 429 | Ga0207646_10177494 | 3300025922 | Bacteria | 1924 |
| 430 | Ga0207646_10207708 | 3300025922 | Bacteria | 1768 |
| 431 | Ga0207646_10212540 | 3300025922 | Unclassified | 1747 |
| 432 | Ga0207681_10000856 | 3300025923 | Bacteria | 19992 |
| 433 | Ga0207681_10072676 | 3300025923 | Bacteria | 2403 |
| 434 | Ga0207681_10175759 | 3300025923 | Unclassified | 1627 |
| 435 | Ga0207681_10355927 | 3300025923 | Unclassified | 1173 |
| 436 | Ga0207694_10022766 | 3300025924 | Unclassified | 4753 |
| 437 | Ga0207694_10047565 | 3300025924 | Bacteria | 3318 |
| 438 | Ga0207650_10000028 | 3300025925 | Bacteria | 236867 |
| 439 | Ga0207650_10000526 | 3300025925 | Bacteria | 31386 |
| 440 | Ga0207650_10018250 | 3300025925 | Bacteria | 4922 |
| 441 | Ga0207659_10145187 | 3300025926 | Bacteria | 1847 |
| 442 | Ga0207644_10001567 | 3300025931 | Bacteria | 14760 |
| 443 | Ga0207644_10003719 | 3300025931 | Bacteria | 9887 |
| 444 | Ga0207644_10044889 | 3300025931 | Unclassified | 3142 |
| 445 | Ga0207690_10047556 | 3300025932 | Unclassified | 2847 |
| 446 | Ga0207706_10032892 | 3300025933 | Unclassified | 4614 |
| 447 | Ga0207706_10097554 | 3300025933 | Unclassified | 2585 |
| 448 | Ga0207706_10129193 | 3300025933 | Bacteria | 2222 |
| 449 | Ga0207686_10000004 | 3300025934 | Bacteria | 349251 |
| 450 | Ga0207686_10000090 | 3300025934 | Bacteria | 74224 |
| 451 | Ga0207686_10014586 | 3300025934 | Bacteria | 4378 |
| 452 | Ga0207686_10171435 | 3300025934 | Unclassified | 1531 |
| 453 | Ga0207686_10332276 | 3300025934 | Bacteria | 1139 |
| 454 | Ga0207686_10347165 | 3300025934 | Unclassified | 1116 |
| 455 | Ga0207709_10000028 | 3300025935 | Bacteria | 334429 |
| 456 | Ga0207709_10001127 | 3300025935 | Bacteria | 19568 |
| 457 | Ga0207709_10008381 | 3300025935 | Bacteria | 5719 |
| 458 | Ga0207709_10130067 | 3300025935 | Bacteria | 1714 |
| 459 | Ga0207709_10158028 | 3300025935 | Unclassified | 1578 |
| 460 | Ga0207670_10000207 | 3300025936 | Bacteria | 38519 |
| 461 | Ga0207670_10116026 | 3300025936 | Bacteria | 1938 |
| 462 | Ga0207670_10167157 | 3300025936 | Unclassified | 1646 |
| 463 | Ga0207704_10142521 | 3300025938 | Bacteria | 1679 |
| 464 | Ga0207665_10000504 | 3300025939 | Bacteria | 26460 |
| 465 | Ga0207665_10048508 | 3300025939 | Bacteria | 2850 |
| 466 | Ga0207691_10115288 | 3300025940 | Bacteria | 2386 |
| 467 | Ga0207691_10174318 | 3300025940 | Unclassified | 1882 |
| 468 | Ga0207691_10216499 | 3300025940 | Unclassified | 1662 |
| 469 | Ga0207711_10011318 | 3300025941 | Bacteria | 7411 |
| 470 | Ga0207711_10053190 | 3300025941 | Bacteria | 3472 |
| 471 | Ga0207711_10080204 | 3300025941 | Bacteria | 2850 |
| 472 | Ga0207711_10328714 | 3300025941 | Bacteria | 1414 |
| 473 | Ga0207711_10353801 | 3300025941 | Bacteria | 1360 |
| 474 | Ga0207689_10009419 | 3300025942 | Bacteria | 8433 |
| 475 | Ga0207689_10018025 | 3300025942 | Bacteria | 5963 |
| 476 | Ga0207689_10081990 | 3300025942 | Bacteria | 2652 |
| 477 | Ga0207689_10133714 | 3300025942 | Bacteria | 2042 |
| 478 | Ga0207689_10470756 | 3300025942 | Bacteria | 1051 |
| 479 | Ga0207679_10007697 | 3300025945 | Bacteria | 6843 |
| 480 | Ga0207679_10077343 | 3300025945 | Unclassified | 2531 |
| 481 | Ga0207667_10648551 | 3300025949 | Unclassified | 1061 |
| 482 | Ga0207651_10256703 | 3300025960 | Unclassified | 1433 |
| 483 | Ga0207712_10000145 | 3300025961 | Bacteria | 73520 |
| 484 | Ga0207712_10025809 | 3300025961 | Bacteria | 3908 |
| 485 | Ga0207712_10029128 | 3300025961 | Bacteria | 3701 |
| 486 | Ga0207712_10085081 | 3300025961 | Bacteria | 2313 |
| 487 | Ga0207712_10266274 | 3300025961 | Bacteria | 1392 |
| 488 | Ga0207640_10251194 | 3300025981 | Bacteria | 1373 |
| 489 | Ga0207658_10255740 | 3300025986 | Bacteria | 1490 |
| 490 | Ga0207677_10022583 | 3300026023 | Unclassified | 3870 |
| 491 | Ga0207677_10092440 | 3300026023 | Bacteria | 2203 |
| 492 | Ga0207677_10310741 | 3300026023 | Bacteria | 1306 |
| 493 | Ga0207703_10000109 | 3300026035 | Bacteria | 97743 |
| 494 | Ga0207703_10059801 | 3300026035 | Bacteria | 3113 |
| 495 | Ga0207703_10121334 | 3300026035 | Bacteria | 2244 |
| 496 | Ga0207703_10209306 | 3300026035 | Unclassified | 1738 |
| 497 | Ga0207703_10318821 | 3300026035 | Bacteria | 1423 |
| 498 | Ga0207639_10063510 | 3300026041 | Unclassified | 2860 |
| 499 | Ga0207639_10083296 | 3300026041 | Unclassified | 2538 |
| 500 | Ga0207639_10326406 | 3300026041 | Bacteria | 1364 |
| 501 | Ga0207708_10000386 | 3300026075 | Bacteria | 34516 |
| 502 | Ga0207708_10030781 | 3300026075 | Bacteria | 4070 |
| 503 | Ga0207708_10048883 | 3300026075 | Bacteria | 3220 |
| 504 | Ga0207708_10072317 | 3300026075 | Bacteria | 2642 |
| 505 | Ga0207708_10353663 | 3300026075 | Unclassified | 1206 |
| 506 | Ga0207702_10196334 | 3300026078 | Bacteria | 1868 |
| 507 | Ga0207641_10018996 | 3300026088 | Bacteria | 5638 |
| 508 | Ga0207641_10095995 | 3300026088 | Unclassified | 2603 |
| 509 | Ga0207641_10361535 | 3300026088 | Bacteria | 1386 |
| 510 | Ga0207641_10422704 | 3300026088 | Bacteria | 1283 |
| 511 | Ga0207641_10659245 | 3300026088 | Unclassified | 1028 |
| 512 | Ga0207648_10083848 | 3300026089 | Unclassified | 2780 |
| 513 | Ga0207648_10119943 | 3300026089 | Unclassified | 2312 |
| 514 | Ga0207648_10232437 | 3300026089 | Unclassified | 1640 |
| 515 | Ga0207648_10277882 | 3300026089 | Bacteria | 1497 |
| 516 | Ga0207676_10012506 | 3300026095 | Bacteria | 6084 |
| 517 | Ga0207676_10021600 | 3300026095 | Bacteria | 4723 |
| 518 | Ga0207676_10242990 | 3300026095 | Unclassified | 1616 |
| 519 | Ga0207676_10522614 | 3300026095 | Unclassified | 1130 |
| 520 | Ga0207674_10000790 | 3300026116 | Bacteria | 41276 |
| 521 | Ga0207674_10022062 | 3300026116 | Bacteria | 6845 |
| 522 | Ga0207674_10071368 | 3300026116 | Bacteria | 3489 |
| 523 | Ga0207674_10128585 | 3300026116 | Unclassified | 2498 |
| 524 | Ga0207674_10566043 | 3300026116 | Bacteria | 1098 |
| 525 | Ga0207675_100000727 | 3300026118 | Bacteria | 32691 |
| 526 | Ga0207675_100016246 | 3300026118 | Bacteria | 6948 |
| 527 | Ga0207675_100021791 | 3300026118 | Bacteria | 5965 |
| 528 | Ga0207675_100073732 | 3300026118 | Bacteria | 3193 |
| 529 | Ga0207675_100088490 | 3300026118 | Bacteria | 2909 |
| 530 | Ga0207675_100226254 | 3300026118 | Bacteria | 1804 |
| 531 | Ga0207675_100242720 | 3300026118 | Bacteria | 1741 |
| 532 | Ga0207698_10513352 | 3300026142 | Bacteria | 1168 |
| 533 | Ga0207428_10018667 | 3300027907 | Bacteria | 5920 |
| 534 | Ga0207428_10024954 | 3300027907 | Bacteria | 5012 |
| 535 | Ga0207428_10029261 | 3300027907 | Bacteria | 4568 |
| 536 | Ga0268266_10050152 | 3300028379 | Bacteria | 3581 |
| 537 | Ga0268265_10065299 | 3300028380 | Bacteria | 2808 |
| 538 | Ga0268264_10057045 | 3300028381 | Bacteria | 3265 |
| 539 | Ga0268264_10059846 | 3300028381 | Bacteria | 3192 |
| 540 | Ga0268264_10060793 | 3300028381 | Bacteria | 3167 |
| 541 | Ga0268264_10065262 | 3300028381 | Unclassified | 3067 |
| 542 | Ga0268264_10266169 | 3300028381 | Bacteria | 1599 |
| 543 | Ga0268264_10314636 | 3300028381 | Bacteria | 1478 |
| 544 | Ga0307408_100112550 | 3300031548 | Unclassified | 2093 |
| 545 | Ga0307405_10184330 | 3300031731 | Unclassified | 1501 |
| 546 | Ga0307405_10319777 | 3300031731 | Unclassified | 1185 |
| 547 | Ga0307413_10098334 | 3300031824 | Unclassified | 1926 |
| 548 | Ga0307413_10144691 | 3300031824 | Bacteria | 1648 |
| 549 | Ga0307406_10048055 | 3300031901 | Unclassified | 2692 |
| 550 | Ga0307416_100096361 | 3300032002 | Unclassified | 2558 |
| 551 | Ga0307416_100363332 | 3300032002 | Bacteria | 1470 |
| 552 | Ga0307414_10002951 | 3300032004 | Bacteria | 8990 |
| 553 | Ga0307414_10060626 | 3300032004 | Unclassified | 2677 |
| 554 | Ga0307414_10228595 | 3300032004 | Unclassified | 1532 |
| 555 | Ga0307411_10038838 | 3300032005 | Unclassified | 3007 |
| 556 | Ga0307415_100034997 | 3300032126 | Unclassified | 3276 |
| 557 | Ga0307415_100077921 | 3300032126 | Unclassified | 2355 |
| 558 | Ga0373951_0001041 | 3300035091 | Bacteria | 7457 |
| 559 | Ga0373941_0008165 | 3300035115 | Bacteria | 2592 |
| 560 | Ga0373937_0098224 | 3300036401 | Unclassified | 2716 |
| 561 | Ga0395900_0347998 | 3300037418 | Bacteria | 1456 |
| 562 | Ga0395898_0078200 | 3300037466 | Unclassified | 3192 |
| 563 | Ga0395905_0254600 | 3300037471 | Bacteria | 1640 |
| 564 | Ga0395901_0531267 | 3300038443 | Bacteria | 1194 |
| 565 | Ga0242422_00717 | 3300038699 | Unclassified | 2191 |
| 566 | Ga0242420_016600 | 3300038996 | Bacteria | 1283 |
| 567 | Ga0453683_0027779 | 3300044673 | Bacteria | 3585 |
| 568 | Ga0453683_0169031 | 3300044673 | Bacteria | 1385 |
| 569 | Ga0451576_0058806 | 3300045051 | Bacteria | 4014 |
| 570 | Ga0451576_0255221 | 3300045051 | Unclassified | 1833 |
| 571 | Ga0451576_0547752 | 3300045051 | Bacteria | 1215 |
| 572 | Ga0495580_0121086 | 3300046472 | Bacteria | 1817 |
| 573 | Ga0495663_0000223 | 3300046525 | Bacteria | 22614 |
| 574 | Ga0495621_0001177 | 3300046539 | Bacteria | 6754 |
| 575 | Ga0495621_0014966 | 3300046539 | Bacteria | 2466 |
| 576 | Ga0495659_0025673 | 3300046664 | Unclassified | 2018 |
| 577 | Ga0495588_0177170 | 3300046674 | Bacteria | 1127 |
| 578 | Ga0495658_0070803 | 3300046683 | Bacteria | 2025 |
| 579 | Ga0495636_0043236 | 3300047318 | Bacteria | 1874 |
| 580 | Ga0495672_0011357 | 3300047320 | Bacteria | 6291 |
| 581 | Ga0495615_0027223 | 3300048090 | Bacteria | 1340 |
| 582 | Ga0496102_0076332 | 3300048905 | Bacteria | 3082 |
| 583 | Ga0496104_0078629 | 3300048907 | Bacteria | 3143 |
| 584 | Ga0496106_0024232 | 3300048909 | Unclassified | 4510 |
| 585 | Ga0496106_0041010 | 3300048909 | Bacteria | 3468 |
| 586 | Ga0496106_0121002 | 3300048909 | Unclassified | 2046 |
| 587 | Ga0496107_0093478 | 3300048910 | Unclassified | 2199 |
| 588 | Ga0496108_0321649 | 3300048911 | Bacteria | 1349 |
| 589 | Ga0496110_0382437 | 3300048913 | Bacteria | 1283 |
| 590 | Ga0496112_0109066 | 3300048915 | Unclassified | 2739 |
| 591 | Ga0496114_0238727 | 3300048917 | Bacteria | 1598 |
| 592 | Ga0501291_004717 | 3300049514 | Bacteria | 1748 |
| 593 | Ga0501292_002422 | 3300049515 | Unclassified | 2410 |
| 594 | Ga0501292_018931 | 3300049515 | Bacteria | 1098 |
| 595 | Ga0501295_010415 | 3300049518 | Bacteria | 1460 |
| 596 | Ga0501296_000693 | 3300049519 | Unclassified | 3335 |
| 597 | Ga0501296_010620 | 3300049519 | Unclassified | 1094 |
| 598 | Ga0501297_002180 | 3300049520 | Unclassified | 1878 |
| 599 | Ga0501298_007803 | 3300049521 | Unclassified | 1783 |
| 600 | Ga0501299_002470 | 3300049522 | Unclassified | 2561 |
| 601 | Ga0501300_007608 | 3300049523 | Unclassified | 1588 |
| 602 | Ga0501198_000685 | 3300049649 | Unclassified | 4212 |
| 603 | Ga0501202_015716 | 3300049652 | Unclassified | 1461 |
| 604 | Ga0501202_039618 | 3300049652 | Bacteria | 1013 |
| 605 | Ga0501207_000631 | 3300049654 | Unclassified | 4082 |
| 606 | Ga0501208_009527 | 3300049655 | Bacteria | 1344 |
| 607 | Ga0501216_002558 | 3300049660 | Unclassified | 2595 |
| 608 | Ga0501216_008005 | 3300049660 | Unclassified | 1656 |
| 609 | Ga0501217_000250 | 3300049661 | Bacteria | 8329 |
| 610 | Ga0501217_021929 | 3300049661 | Bacteria | 1511 |
| 611 | Ga0501223_009413 | 3300049663 | Unclassified | 1980 |
| 612 | Ga0501224_001815 | 3300049664 | Bacteria | 2875 |
| 613 | Ga0501227_000481 | 3300049665 | Bacteria | 8499 |
| 614 | Ga0501227_021042 | 3300049665 | Unclassified | 1501 |
| 615 | Ga0501230_012163 | 3300049667 | Bacteria | 1374 |
| 616 | Ga0501233_001016 | 3300049668 | Bacteria | 4769 |
| 617 | Ga0501233_004653 | 3300049668 | Unclassified | 2526 |
| 618 | Ga0501235_001823 | 3300049669 | Unclassified | 4567 |
| 619 | Ga0501235_004086 | 3300049669 | Bacteria | 3159 |
| 620 | Ga0501235_033273 | 3300049669 | Bacteria | 1167 |
| 621 | Ga0501242_001899 | 3300049674 | Unclassified | 2155 |
| 622 | Ga0501243_006371 | 3300049675 | Bacteria | 1786 |
| 623 | Ga0501243_010575 | 3300049675 | Bacteria | 1441 |
| 624 | Ga0501247_009044 | 3300049677 | Bacteria | 1171 |
| 625 | Ga0501249_006039 | 3300049679 | Unclassified | 2486 |
| 626 | Ga0501249_010084 | 3300049679 | Bacteria | 1970 |
| 627 | Ga0501249_017137 | 3300049679 | Unclassified | 1560 |
| 628 | Ga0501253_007822 | 3300049683 | Unclassified | 1510 |
| 629 | Ga0501256_002644 | 3300049685 | Unclassified | 1437 |
| 630 | Ga0501256_003433 | 3300049685 | Bacteria | 1316 |
| 631 | Ga0501257_030064 | 3300049686 | Unclassified | 1306 |
| 632 | Ga0501259_011875 | 3300049688 | Unclassified | 1446 |
| 633 | Ga0501260_000580 | 3300049689 | Unclassified | 2820 |
| 634 | Ga0501260_005429 | 3300049689 | Unclassified | 1200 |
| 635 | Ga0501261_006149 | 3300049690 | Bacteria | 1523 |
| 636 | Ga0501221_007386 | 3300049704 | Unclassified | 1884 |
| 637 | Ga0501225_0006513 | 3300049705 | Bacteria | 3410 |
| 638 | Ga0501225_0012705 | 3300049705 | Unclassified | 2363 |
| 639 | Ga0501225_0022646 | 3300049705 | Unclassified | 1734 |
| 640 | Ga0501229_005135 | 3300049706 | Unclassified | 1601 |
| 641 | Ga0501234_004126 | 3300049707 | Unclassified | 2280 |
| 642 | Ga0501234_004441 | 3300049707 | Unclassified | 2206 |
| 643 | Ga0501234_006180 | 3300049707 | Unclassified | 1875 |
| 644 | Ga0501234_009209 | 3300049707 | Bacteria | 1539 |
| 645 | Ga0501245_001612 | 3300049708 | Unclassified | 2937 |
| 646 | Ga0501241_004234 | 3300049758 | Unclassified | 2695 |
| 647 | Ga0501266_011132 | 3300049763 | Unclassified | 1150 |
| 648 | Ga0501268_019906 | 3300049765 | Unclassified | 1139 |
| 649 | Ga0501273_000582 | 3300049770 | Unclassified | 3018 |
| 650 | Ga0501283_001776 | 3300049779 | Unclassified | 2796 |
| 651 | Ga0501212_005760 | 3300049851 | Unclassified | 1648 |
| 652 | Ga0501212_021211 | 3300049851 | Unclassified | 1006 |
| 653 | Ga0501226_001593 | 3300049853 | Bacteria | 2876 |
| 654 | nmdc:mga05p37_125179_c1 | 3300050507 | Bacteria | 3156 |
| 655 | nmdc:mga05p37_220378_c1 | 3300050507 | Unclassified | 2290 |
| 656 | nmdc:mga05p37_425785_c1 | 3300050507 | Bacteria | 1543 |
| 657 | nmdc:mga05p37_85382_c1 | 3300050507 | Bacteria | 3889 |
| 658 | nmdc:mga09592_269100_c1 | 3300050508 | Bacteria | 1478 |
| 659 | nmdc:mga09592_76681_c1 | 3300050508 | Bacteria | 2843 |
| 660 | nmdc:mga0qj67_123711_c1 | 3300050509 | Bacteria | 2093 |
| 661 | nmdc:mga06r32_326012_c1 | 3300050510 | Unclassified | 1521 |
| 662 | nmdc:mga08y16_1720_c1 | 3300050511 | Bacteria | 22215 |
| 663 | nmdc:mga08y16_91674_c1 | 3300050511 | Bacteria | 3167 |
| 664 | nmdc:mga0n895_102393_c1 | 3300050512 | Bacteria | 2874 |
| 665 | nmdc:mga0n895_112959_c1 | 3300050512 | Unclassified | 2734 |
| 666 | nmdc:mga0n895_27814_c1 | 3300050512 | Bacteria | 5374 |
| 667 | nmdc:mga0n895_305469_c1 | 3300050512 | Bacteria | 1613 |
| 668 | nmdc:mga0n895_522691_c1 | 3300050512 | Bacteria | 1194 |
| 669 | nmdc:mga0n895_664145_c1 | 3300050512 | Bacteria | 1040 |
| 670 | nmdc:mga0rr50_14623_c1 | 3300050513 | Bacteria | 5154 |
| 671 | nmdc:mga0rr50_223016_c1 | 3300050513 | Unclassified | 1557 |
| 672 | nmdc:mga0rr50_450_c1 | 3300050513 | Bacteria | 21853 |
| 673 | nmdc:mga08x19_5_c1 | 3300050514 | Bacteria | 464292 |
| 674 | nmdc:mga0a205_190899_c1 | 3300050515 | Bacteria | 1941 |
| 675 | nmdc:mga0a205_309082_c1 | 3300050515 | Unclassified | 1453 |
| 676 | nmdc:mga0a205_49046_c1 | 3300050515 | Bacteria | 4075 |
| 677 | nmdc:mga0a205_69352_c1 | 3300050515 | Bacteria | 3404 |
| 678 | nmdc:mga0a205_83063_c1 | 3300050515 | Bacteria | 3094 |
| 679 | nmdc:mga0a205_92926_c1 | 3300050515 | Bacteria | 2915 |
| 680 | nmdc:mga0a205_98799_c1 | 3300050515 | Bacteria | 2817 |
| 681 | Ga0495655_0010049 | 3300053083 | Bacteria | 1855 |
| 682 | Ga0501084_0449824 | 3300054114 | Unclassified | 1089 |
| 683 | Ga0530510_0108480 | 3300061734 | Bacteria | 2032 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005468 | Ga0070707_100069107 | Ga0070707_1000691073 | 226 |
| 2 | 3300009148 | Ga0105243_10196844 | Ga0105243_101968442 | 242 |
| 3 | 3300025935 | Ga0207709_10158028 | Ga0207709_101580282 | 242 |
| 4 | 3300005339 | Ga0070660_100031027 | Ga0070660_1000310274 | 243 |
| 5 | 3300005354 | Ga0070675_100202969 | Ga0070675_1002029692 | 243 |
| 6 | 3300005366 | Ga0070659_100002273 | Ga0070659_1000022735 | 243 |
| 7 | 3300005458 | Ga0070681_10015191 | Ga0070681_100151914 | 243 |
| 8 | 3300005530 | Ga0070679_100030221 | Ga0070679_1000302212 | 243 |
| 9 | 3300005539 | Ga0068853_100055465 | Ga0068853_1000554653 | 243 |
| 10 | 3300005564 | Ga0070664_100003825 | Ga0070664_1000038254 | 243 |
| 11 | 3300005577 | Ga0068857_100003794 | Ga0068857_10000379410 | 243 |
| 12 | 3300013307 | Ga0157372_10433739 | Ga0157372_104337391 | 243 |
| 13 | 3300025919 | Ga0207657_10082494 | Ga0207657_100824944 | 243 |
| 14 | 3300025932 | Ga0207690_10047556 | Ga0207690_100475562 | 243 |
| 15 | 3300025945 | Ga0207679_10007697 | Ga0207679_100076975 | 243 |
| 16 | 3300026041 | Ga0207639_10083296 | Ga0207639_100832962 | 243 |
| 17 | 3300026116 | Ga0207674_10000790 | Ga0207674_100007904 | 243 |
| 18 | 3300013307 | Ga0157372_10891512 | Ga0157372_108915121 | 245 |
| 19 | 3300014325 | Ga0163163_10144834 | Ga0163163_101448342 | 245 |
| 20 | 3300026088 | Ga0207641_10018996 | Ga0207641_100189964 | 246 |
| 21 | 3300005577 | Ga0068857_100128807 | Ga0068857_1001288072 | 248 |
| 22 | 3300011119 | Ga0105246_10124288 | Ga0105246_101242881 | 248 |
| 23 | 3300014325 | Ga0163163_10107477 | Ga0163163_101074771 | 248 |
| 24 | 3300025908 | Ga0207643_10014841 | Ga0207643_100148414 | 248 |
| 25 | 3300026116 | Ga0207674_10071368 | Ga0207674_100713683 | 248 |
| 26 | 3300049675 | Ga0501243_010575 | Ga0501243_010575_581_1417 | 249 |
| 27 | 3300050508 | nmdc:mga09592_76681_c1 | nmdc:mga09592_76681_c1_136_1035 | 249 |
| 28 | 3300005354 | Ga0070675_100304982 | Ga0070675_1003049821 | 252 |
| 29 | 3300009147 | Ga0114129_10527761 | Ga0114129_105277611 | 252 |
| 30 | 3300005444 | Ga0070694_100016906 | Ga0070694_1000169066 | 253 |
| 31 | 3300005549 | Ga0070704_100130823 | Ga0070704_1001308232 | 253 |
| 32 | 3300005843 | Ga0068860_100202519 | Ga0068860_1002025192 | 253 |
| 33 | 3300009094 | Ga0111539_10069877 | Ga0111539_100698773 | 253 |
| 34 | 3300009147 | Ga0114129_10042987 | Ga0114129_100429875 | 253 |
| 35 | 3300028381 | Ga0268264_10060793 | Ga0268264_100607933 | 253 |
| 36 | 3300049519 | Ga0501296_010620 | Ga0501296_010620_120_1040 | 253 |
| 37 | 3300049665 | Ga0501227_021042 | Ga0501227_021042_244_1164 | 253 |
| 38 | 3300049679 | Ga0501249_017137 | Ga0501249_017137_488_1408 | 253 |
| 39 | 3300049705 | Ga0501225_0022646 | Ga0501225_0022646_652_1572 | 253 |
| 40 | 3300049765 | Ga0501268_019906 | Ga0501268_019906_172_1092 | 253 |
| 41 | 3300049704 | Ga0501221_007386 | Ga0501221_007386_885_1805 | 254 |
| 42 | 3300049707 | Ga0501234_004441 | Ga0501234_004441_738_1658 | 254 |
| 43 | 3300005844 | Ga0068862_100186187 | Ga0068862_1001861872 | 257 |
| 44 | 3300006871 | Ga0075434_100030724 | Ga0075434_1000307243 | 258 |
| 45 | 3300013297 | Ga0157378_10219596 | Ga0157378_102195961 | 258 |
| 46 | 3300050512 | nmdc:mga0n895_112959_c1 | nmdc:mga0n895_112959_c1_1261_2181 | 258 |
| 47 | 3300050515 | nmdc:mga0a205_49046_c1 | nmdc:mga0a205_49046_c1_923_1843 | 258 |
| 48 | 3300009147 | Ga0114129_10037717 | Ga0114129_100377175 | 259 |
| 49 | 3300032004 | Ga0307414_10228595 | Ga0307414_102285951 | 259 |
| 50 | 3300049675 | Ga0501243_006371 | Ga0501243_006371_25_951 | 259 |
| 51 | 3300049763 | Ga0501266_011132 | Ga0501266_011132_73_999 | 259 |
| 52 | 3300049770 | Ga0501273_000582 | Ga0501273_000582_1669_2595 | 259 |
| 53 | 3300049851 | Ga0501212_021211 | Ga0501212_021211_52_978 | 259 |
| 54 | 3300050507 | nmdc:mga05p37_85382_c1 | nmdc:mga05p37_85382_c1_2044_2958 | 259 |
| 55 | 3300005293 | Ga0065715_10094065 | Ga0065715_100940654 | 260 |
| 56 | 3300005340 | Ga0070689_100043886 | Ga0070689_1000438862 | 260 |
| 57 | 3300005345 | Ga0070692_10017150 | Ga0070692_100171502 | 260 |
| 58 | 3300005347 | Ga0070668_100033984 | Ga0070668_1000339843 | 260 |
| 59 | 3300005365 | Ga0070688_100110756 | Ga0070688_1001107561 | 260 |
| 60 | 3300005406 | Ga0070703_10006463 | Ga0070703_100064633 | 260 |
| 61 | 3300005438 | Ga0070701_10024550 | Ga0070701_100245504 | 260 |
| 62 | 3300005440 | Ga0070705_100006565 | Ga0070705_1000065655 | 260 |
| 63 | 3300005441 | Ga0070700_100031495 | Ga0070700_1000314952 | 260 |
| 64 | 3300005444 | Ga0070694_100003766 | Ga0070694_1000037665 | 260 |
| 65 | 3300005444 | Ga0070694_100011628 | Ga0070694_1000116283 | 260 |
| 66 | 3300005467 | Ga0070706_100023837 | Ga0070706_1000238373 | 260 |
| 67 | 3300005544 | Ga0070686_100024497 | Ga0070686_1000244972 | 260 |
| 68 | 3300005546 | Ga0070696_100138231 | Ga0070696_1001382312 | 260 |
| 69 | 3300005547 | Ga0070693_100016399 | Ga0070693_1000163993 | 260 |
| 70 | 3300005549 | Ga0070704_100008763 | Ga0070704_1000087634 | 260 |
| 71 | 3300005615 | Ga0070702_100021459 | Ga0070702_1000214592 | 260 |
| 72 | 3300005841 | Ga0068863_100089448 | Ga0068863_1000894483 | 260 |
| 73 | 3300005842 | Ga0068858_100048180 | Ga0068858_1000481805 | 260 |
| 74 | 3300005843 | Ga0068860_100038636 | Ga0068860_1000386365 | 260 |
| 75 | 3300009093 | Ga0105240_10840452 | Ga0105240_108404521 | 260 |
| 76 | 3300009101 | Ga0105247_10005468 | Ga0105247_100054685 | 260 |
| 77 | 3300009148 | Ga0105243_10000242 | Ga0105243_100002426 | 260 |
| 78 | 3300009176 | Ga0105242_10000092 | Ga0105242_100000926 | 260 |
| 79 | 3300009177 | Ga0105248_10191193 | Ga0105248_101911932 | 260 |
| 80 | 3300009545 | Ga0105237_10031885 | Ga0105237_100318853 | 260 |
| 81 | 3300009553 | Ga0105249_10000032 | Ga0105249_10000032151 | 260 |
| 82 | 3300013306 | Ga0163162_10000006 | Ga0163162_10000006152 | 260 |
| 83 | 3300013306 | Ga0163162_10257262 | Ga0163162_102572623 | 260 |
| 84 | 3300014325 | Ga0163163_10007267 | Ga0163163_100072675 | 260 |
| 85 | 3300014326 | Ga0157380_10049392 | Ga0157380_100493922 | 260 |
| 86 | 3300025885 | Ga0207653_10005112 | Ga0207653_100051124 | 260 |
| 87 | 3300025900 | Ga0207710_10002199 | Ga0207710_100021995 | 260 |
| 88 | 3300025907 | Ga0207645_10066030 | Ga0207645_100660303 | 260 |
| 89 | 3300025910 | Ga0207684_10019404 | Ga0207684_100194045 | 260 |
| 90 | 3300025918 | Ga0207662_10061884 | Ga0207662_100618842 | 260 |
| 91 | 3300025918 | Ga0207662_10087381 | Ga0207662_100873811 | 260 |
| 92 | 3300025922 | Ga0207646_10007403 | Ga0207646_100074035 | 260 |
| 93 | 3300025926 | Ga0207659_10145187 | Ga0207659_101451872 | 260 |
| 94 | 3300025934 | Ga0207686_10000004 | Ga0207686_10000004215 | 260 |
| 95 | 3300025935 | Ga0207709_10000028 | Ga0207709_1000002840 | 260 |
| 96 | 3300025936 | Ga0207670_10116026 | Ga0207670_101160262 | 260 |
| 97 | 3300025940 | Ga0207691_10216499 | Ga0207691_102164991 | 260 |
| 98 | 3300025941 | Ga0207711_10353801 | Ga0207711_103538011 | 260 |
| 99 | 3300025942 | Ga0207689_10133714 | Ga0207689_101337141 | 260 |
| 100 | 3300025961 | Ga0207712_10000145 | Ga0207712_1000014521 | 260 |
| 101 | 3300026075 | Ga0207708_10072317 | Ga0207708_100723174 | 260 |
| 102 | 3300026095 | Ga0207676_10021600 | Ga0207676_100216005 | 260 |
| 103 | 3300028381 | Ga0268264_10059846 | Ga0268264_100598465 | 260 |
| 104 | 3300046539 | Ga0495621_0014966 | Ga0495621_0014966_235_1134 | 260 |
| 105 | 3300046664 | Ga0495659_0025673 | Ga0495659_0025673_565_1464 | 260 |
| 106 | 3300048909 | Ga0496106_0041010 | Ga0496106_0041010_2312_3223 | 260 |
| 107 | 3300048910 | Ga0496107_0093478 | Ga0496107_0093478_1153_2064 | 260 |
| 108 | 3300048913 | Ga0496110_0382437 | Ga0496110_0382437_116_1042 | 260 |
| 109 | 3300050512 | nmdc:mga0n895_102393_c1 | nmdc:mga0n895_102393_c1_1463_2386 | 260 |
| 110 | 3300050515 | nmdc:mga0a205_190899_c1 | nmdc:mga0a205_190899_c1_460_1383 | 260 |
| 111 | 3300002459 | JGI24751J29686_10000006 | JGI24751J29686_1000000651 | 261 |
| 112 | 3300005290 | Ga0065712_10002929 | Ga0065712_100029296 | 261 |
| 113 | 3300005331 | Ga0070670_100000739 | Ga0070670_1000007396 | 261 |
| 114 | 3300005331 | Ga0070670_100027974 | Ga0070670_1000279744 | 261 |
| 115 | 3300005340 | Ga0070689_100166012 | Ga0070689_1001660122 | 261 |
| 116 | 3300005440 | Ga0070705_100171790 | Ga0070705_1001717901 | 261 |
| 117 | 3300005441 | Ga0070700_100006434 | Ga0070700_1000064343 | 261 |
| 118 | 3300005444 | Ga0070694_100089542 | Ga0070694_1000895424 | 261 |
| 119 | 3300005518 | Ga0070699_100002843 | Ga0070699_10000284310 | 261 |
| 120 | 3300005545 | Ga0070695_100333326 | Ga0070695_1003333261 | 261 |
| 121 | 3300005546 | Ga0070696_100151830 | Ga0070696_1001518302 | 261 |
| 122 | 3300005617 | Ga0068859_100029722 | Ga0068859_1000297226 | 261 |
| 123 | 3300005719 | Ga0068861_100105847 | Ga0068861_1001058474 | 261 |
| 124 | 3300005843 | Ga0068860_100255697 | Ga0068860_1002556972 | 261 |
| 125 | 3300006358 | Ga0068871_100170635 | Ga0068871_1001706352 | 261 |
| 126 | 3300006931 | Ga0097620_100029722 | Ga0097620_1000297226 | 261 |
| 127 | 3300009148 | Ga0105243_10123060 | Ga0105243_101230603 | 261 |
| 128 | 3300009174 | Ga0105241_10033890 | Ga0105241_100338906 | 261 |
| 129 | 3300009174 | Ga0105241_10165777 | Ga0105241_101657773 | 261 |
| 130 | 3300009177 | Ga0105248_10076483 | Ga0105248_100764832 | 261 |
| 131 | 3300009551 | Ga0105238_10022347 | Ga0105238_100223474 | 261 |
| 132 | 3300013306 | Ga0163162_10780374 | Ga0163162_107803742 | 261 |
| 133 | 3300014325 | Ga0163163_10000983 | Ga0163163_1000098318 | 261 |
| 134 | 3300014325 | Ga0163163_10625086 | Ga0163163_106250861 | 261 |
| 135 | 3300025911 | Ga0207654_10263774 | Ga0207654_102637741 | 261 |
| 136 | 3300025924 | Ga0207694_10047565 | Ga0207694_100475653 | 261 |
| 137 | 3300025925 | Ga0207650_10000028 | Ga0207650_10000028135 | 261 |
| 138 | 3300025925 | Ga0207650_10018250 | Ga0207650_100182504 | 261 |
| 139 | 3300025934 | Ga0207686_10014586 | Ga0207686_100145864 | 261 |
| 140 | 3300025936 | Ga0207670_10167157 | Ga0207670_101671572 | 261 |
| 141 | 3300025940 | Ga0207691_10115288 | Ga0207691_101152882 | 261 |
| 142 | 3300025941 | Ga0207711_10053190 | Ga0207711_100531903 | 261 |
| 143 | 3300026035 | Ga0207703_10318821 | Ga0207703_103188212 | 261 |
| 144 | 3300026075 | Ga0207708_10353663 | Ga0207708_103536632 | 261 |
| 145 | 3300026116 | Ga0207674_10566043 | Ga0207674_105660431 | 261 |
| 146 | 3300026118 | Ga0207675_100088490 | Ga0207675_1000884904 | 261 |
| 147 | 3300026118 | Ga0207675_100242720 | Ga0207675_1002427202 | 261 |
| 148 | 3300031548 | Ga0307408_100112550 | Ga0307408_1001125502 | 261 |
| 149 | 3300031731 | Ga0307405_10319777 | Ga0307405_103197771 | 261 |
| 150 | 3300031824 | Ga0307413_10098334 | Ga0307413_100983342 | 261 |
| 151 | 3300031901 | Ga0307406_10048055 | Ga0307406_100480554 | 261 |
| 152 | 3300032002 | Ga0307416_100096361 | Ga0307416_1000963614 | 261 |
| 153 | 3300032004 | Ga0307414_10002951 | Ga0307414_100029519 | 261 |
| 154 | 3300032004 | Ga0307414_10060626 | Ga0307414_100606263 | 261 |
| 155 | 3300032126 | Ga0307415_100077921 | Ga0307415_1000779213 | 261 |
| 156 | 3300035115 | Ga0373941_0008165 | Ga0373941_0008165_1244_2164 | 261 |
| 157 | 3300037466 | Ga0395898_0078200 | Ga0395898_0078200_1772_2692 | 261 |
| 158 | 3300038699 | Ga0242422_00717 | Ga0242422_00717_284_1210 | 261 |
| 159 | 3300038996 | Ga0242420_016600 | Ga0242420_016600_306_1232 | 261 |
| 160 | 3300045051 | Ga0451576_0547752 | Ga0451576_0547752_143_1069 | 261 |
| 161 | 3300049649 | Ga0501198_000685 | Ga0501198_000685_2621_3541 | 261 |
| 162 | 3300049652 | Ga0501202_015716 | Ga0501202_015716_173_1093 | 261 |
| 163 | 3300049654 | Ga0501207_000631 | Ga0501207_000631_2422_3342 | 261 |
| 164 | 3300049660 | Ga0501216_008005 | Ga0501216_008005_491_1411 | 261 |
| 165 | 3300049661 | Ga0501217_000250 | Ga0501217_000250_6019_6939 | 261 |
| 166 | 3300049663 | Ga0501223_009413 | Ga0501223_009413_356_1276 | 261 |
| 167 | 3300049664 | Ga0501224_001815 | Ga0501224_001815_1368_2288 | 261 |
| 168 | 3300049665 | Ga0501227_000481 | Ga0501227_000481_6167_7087 | 261 |
| 169 | 3300049668 | Ga0501233_001016 | Ga0501233_001016_2219_3139 | 261 |
| 170 | 3300049669 | Ga0501235_004086 | Ga0501235_004086_395_1315 | 261 |
| 171 | 3300049679 | Ga0501249_006039 | Ga0501249_006039_339_1259 | 261 |
| 172 | 3300049683 | Ga0501253_007822 | Ga0501253_007822_315_1235 | 261 |
| 173 | 3300049685 | Ga0501256_002644 | Ga0501256_002644_271_1191 | 261 |
| 174 | 3300049686 | Ga0501257_030064 | Ga0501257_030064_138_1058 | 261 |
| 175 | 3300049688 | Ga0501259_011875 | Ga0501259_011875_387_1307 | 261 |
| 176 | 3300049689 | Ga0501260_005429 | Ga0501260_005429_228_1148 | 261 |
| 177 | 3300049705 | Ga0501225_0006513 | Ga0501225_0006513_1714_2634 | 261 |
| 178 | 3300049706 | Ga0501229_005135 | Ga0501229_005135_93_1013 | 261 |
| 179 | 3300049707 | Ga0501234_004126 | Ga0501234_004126_359_1279 | 261 |
| 180 | 3300049758 | Ga0501241_004234 | Ga0501241_004234_558_1478 | 261 |
| 181 | 3300049851 | Ga0501212_005760 | Ga0501212_005760_258_1178 | 261 |
| 182 | 3300049853 | Ga0501226_001593 | Ga0501226_001593_602_1522 | 261 |
| 183 | 3300050507 | nmdc:mga05p37_125179_c1 | nmdc:mga05p37_125179_c1_128_1054 | 261 |
| 184 | 3300005467 | Ga0070706_100000044 | Ga0070706_10000004458 | 262 |
| 185 | 3300005468 | Ga0070707_100544291 | Ga0070707_1005442911 | 262 |
| 186 | 3300005544 | Ga0070686_100049811 | Ga0070686_1000498112 | 262 |
| 187 | 3300006914 | Ga0075436_100286201 | Ga0075436_1002862012 | 262 |
| 188 | 3300009147 | Ga0114129_10294483 | Ga0114129_102944832 | 262 |
| 189 | 3300009553 | Ga0105249_10034607 | Ga0105249_100346076 | 262 |
| 190 | 3300025910 | Ga0207684_10001881 | Ga0207684_1000188113 | 262 |
| 191 | 3300025911 | Ga0207654_10111425 | Ga0207654_101114253 | 262 |
| 192 | 3300025961 | Ga0207712_10029128 | Ga0207712_100291285 | 262 |
| 193 | 3300036401 | Ga0373937_0098224 | Ga0373937_0098224_25_942 | 262 |
| 194 | 3300049514 | Ga0501291_004717 | Ga0501291_004717_565_1503 | 262 |
| 195 | 3300049515 | Ga0501292_018931 | Ga0501292_018931_110_1048 | 262 |
| 196 | 3300049518 | Ga0501295_010415 | Ga0501295_010415_334_1272 | 262 |
| 197 | 3300049519 | Ga0501296_000693 | Ga0501296_000693_400_1338 | 262 |
| 198 | 3300049520 | Ga0501297_002180 | Ga0501297_002180_234_1172 | 262 |
| 199 | 3300049521 | Ga0501298_007803 | Ga0501298_007803_392_1330 | 262 |
| 200 | 3300049523 | Ga0501300_007608 | Ga0501300_007608_595_1533 | 262 |
| 201 | 3300049668 | Ga0501233_004653 | Ga0501233_004653_1352_2290 | 262 |
| 202 | 3300049669 | Ga0501235_001823 | Ga0501235_001823_1943_2881 | 262 |
| 203 | 3300049674 | Ga0501242_001899 | Ga0501242_001899_388_1326 | 262 |
| 204 | 3300049685 | Ga0501256_003433 | Ga0501256_003433_243_1181 | 262 |
| 205 | 3300049689 | Ga0501260_000580 | Ga0501260_000580_509_1447 | 262 |
| 206 | 3300049707 | Ga0501234_006180 | Ga0501234_006180_192_1130 | 262 |
| 207 | 3300049708 | Ga0501245_001612 | Ga0501245_001612_202_1140 | 262 |
| 208 | 3300049779 | Ga0501283_001776 | Ga0501283_001776_1170_2108 | 262 |
| 209 | 3300050513 | nmdc:mga0rr50_14623_c1 | nmdc:mga0rr50_14623_c1_2337_3245 | 262 |
| 210 | 3300005337 | Ga0070682_100110224 | Ga0070682_1001102242 | 263 |
| 211 | 3300005617 | Ga0068859_100244320 | Ga0068859_1002443202 | 263 |
| 212 | 3300005985 | Ga0081539_10004393 | Ga0081539_100043934 | 263 |
| 213 | 3300006173 | Ga0070716_100117831 | Ga0070716_1001178312 | 263 |
| 214 | 3300006931 | Ga0097620_100244323 | Ga0097620_1002443232 | 263 |
| 215 | 3300009553 | Ga0105249_10690214 | Ga0105249_106902141 | 263 |
| 216 | 3300014326 | Ga0157380_10087413 | Ga0157380_100874131 | 263 |
| 217 | 3300025939 | Ga0207665_10048508 | Ga0207665_100485082 | 263 |
| 218 | 3300026095 | Ga0207676_10522614 | Ga0207676_105226141 | 263 |
| 219 | 3300005295 | Ga0065707_10171915 | Ga0065707_101719152 | 264 |
| 220 | 3300005331 | Ga0070670_100142637 | Ga0070670_1001426372 | 264 |
| 221 | 3300005353 | Ga0070669_100399354 | Ga0070669_1003993542 | 264 |
| 222 | 3300005471 | Ga0070698_100005210 | Ga0070698_1000052102 | 264 |
| 223 | 3300005518 | Ga0070699_100216316 | Ga0070699_1002163161 | 264 |
| 224 | 3300005545 | Ga0070695_100251008 | Ga0070695_1002510082 | 264 |
| 225 | 3300005546 | Ga0070696_100023432 | Ga0070696_1000234324 | 264 |
| 226 | 3300005985 | Ga0081539_10011645 | Ga0081539_100116452 | 264 |
| 227 | 3300006871 | Ga0075434_100017408 | Ga0075434_1000174083 | 264 |
| 228 | 3300013308 | Ga0157375_10044886 | Ga0157375_100448863 | 264 |
| 229 | 3300026116 | Ga0207674_10128585 | Ga0207674_101285854 | 264 |
| 230 | 3300050512 | nmdc:mga0n895_27814_c1 | nmdc:mga0n895_27814_c1_2037_2975 | 264 |
| 231 | 3300001990 | JGI24737J22298_10020719 | JGI24737J22298_100207192 | 265 |
| 232 | 3300003320 | rootH2_10113728 | rootH2_101137281 | 265 |
| 233 | 3300005293 | Ga0065715_10094019 | Ga0065715_100940194 | 265 |
| 234 | 3300005340 | Ga0070689_100000228 | Ga0070689_10000022816 | 265 |
| 235 | 3300005345 | Ga0070692_10014359 | Ga0070692_100143592 | 265 |
| 236 | 3300005345 | Ga0070692_10040676 | Ga0070692_100406763 | 265 |
| 237 | 3300005441 | Ga0070700_100000569 | Ga0070700_10000056919 | 265 |
| 238 | 3300005468 | Ga0070707_100000761 | Ga0070707_1000007617 | 265 |
| 239 | 3300005539 | Ga0068853_100035104 | Ga0068853_1000351043 | 265 |
| 240 | 3300005549 | Ga0070704_100056765 | Ga0070704_1000567653 | 265 |
| 241 | 3300005617 | Ga0068859_100015317 | Ga0068859_1000153174 | 265 |
| 242 | 3300005840 | Ga0068870_10114948 | Ga0068870_101149482 | 265 |
| 243 | 3300005841 | Ga0068863_100100105 | Ga0068863_1001001051 | 265 |
| 244 | 3300005842 | Ga0068858_100060977 | Ga0068858_1000609774 | 265 |
| 245 | 3300005843 | Ga0068860_100092470 | Ga0068860_1000924703 | 265 |
| 246 | 3300005844 | Ga0068862_100066457 | Ga0068862_1000664574 | 265 |
| 247 | 3300006237 | Ga0097621_100033755 | Ga0097621_1000337554 | 265 |
| 248 | 3300006871 | Ga0075434_100140720 | Ga0075434_1001407203 | 265 |
| 249 | 3300006931 | Ga0097620_100015315 | Ga0097620_1000153157 | 265 |
| 250 | 3300009551 | Ga0105238_10003265 | Ga0105238_100032656 | 265 |
| 251 | 3300011119 | Ga0105246_10182407 | Ga0105246_101824072 | 265 |
| 252 | 3300013100 | Ga0157373_10046279 | Ga0157373_100462793 | 265 |
| 253 | 3300013100 | Ga0157373_10205382 | Ga0157373_102053822 | 265 |
| 254 | 3300025900 | Ga0207710_10116277 | Ga0207710_101162771 | 265 |
| 255 | 3300025904 | Ga0207647_10003725 | Ga0207647_100037253 | 265 |
| 256 | 3300025908 | Ga0207643_10120339 | Ga0207643_101203392 | 265 |
| 257 | 3300025922 | Ga0207646_10000941 | Ga0207646_100009414 | 265 |
| 258 | 3300025924 | Ga0207694_10022766 | Ga0207694_100227665 | 265 |
| 259 | 3300025936 | Ga0207670_10000207 | Ga0207670_100002077 | 265 |
| 260 | 3300025949 | Ga0207667_10648551 | Ga0207667_106485511 | 265 |
| 261 | 3300026035 | Ga0207703_10059801 | Ga0207703_100598015 | 265 |
| 262 | 3300026041 | Ga0207639_10063510 | Ga0207639_100635104 | 265 |
| 263 | 3300026075 | Ga0207708_10000386 | Ga0207708_1000038630 | 265 |
| 264 | 3300028380 | Ga0268265_10065299 | Ga0268265_100652992 | 265 |
| 265 | 3300028381 | Ga0268264_10065262 | Ga0268264_100652622 | 265 |
| 266 | 3300005295 | Ga0065707_10247540 | Ga0065707_102475402 | 266 |
| 267 | 3300005331 | Ga0070670_100057214 | Ga0070670_1000572142 | 266 |
| 268 | 3300005364 | Ga0070673_100047029 | Ga0070673_1000470292 | 266 |
| 269 | 3300005617 | Ga0068859_100185557 | Ga0068859_1001855573 | 266 |
| 270 | 3300005841 | Ga0068863_100543634 | Ga0068863_1005436341 | 266 |
| 271 | 3300006844 | Ga0075428_100157367 | Ga0075428_1001573672 | 266 |
| 272 | 3300006852 | Ga0075433_10188710 | Ga0075433_101887102 | 266 |
| 273 | 3300006931 | Ga0097620_100185559 | Ga0097620_1001855592 | 266 |
| 274 | 3300009094 | Ga0111539_10068876 | Ga0111539_100688762 | 266 |
| 275 | 3300014326 | Ga0157380_10209935 | Ga0157380_102099352 | 266 |
| 276 | 3300025911 | Ga0207654_10063598 | Ga0207654_100635982 | 266 |
| 277 | 3300027907 | Ga0207428_10029261 | Ga0207428_100292615 | 266 |
| 278 | 3300044673 | Ga0453683_0169031 | Ga0453683_0169031_479_1375 | 266 |
| 279 | 3300005444 | Ga0070694_100184015 | Ga0070694_1001840152 | 267 |
| 280 | 3300005445 | Ga0070708_100319610 | Ga0070708_1003196101 | 267 |
| 281 | 3300005471 | Ga0070698_100240948 | Ga0070698_1002409482 | 267 |
| 282 | 3300005577 | Ga0068857_100221247 | Ga0068857_1002212473 | 267 |
| 283 | 3300005617 | Ga0068859_100054636 | Ga0068859_1000546363 | 267 |
| 284 | 3300005840 | Ga0068870_10166421 | Ga0068870_101664211 | 267 |
| 285 | 3300005844 | Ga0068862_100017697 | Ga0068862_1000176977 | 267 |
| 286 | 3300006237 | Ga0097621_100239472 | Ga0097621_1002394722 | 267 |
| 287 | 3300006931 | Ga0097620_100054635 | Ga0097620_1000546353 | 267 |
| 288 | 3300009011 | Ga0105251_10135732 | Ga0105251_101357322 | 267 |
| 289 | 3300009148 | Ga0105243_10012306 | Ga0105243_100123063 | 267 |
| 290 | 3300009176 | Ga0105242_10214885 | Ga0105242_102148852 | 267 |
| 291 | 3300009553 | Ga0105249_10389659 | Ga0105249_103896592 | 267 |
| 292 | 3300011119 | Ga0105246_10243567 | Ga0105246_102435672 | 267 |
| 293 | 3300013297 | Ga0157378_10237920 | Ga0157378_102379202 | 267 |
| 294 | 3300025908 | Ga0207643_10192511 | Ga0207643_101925111 | 267 |
| 295 | 3300025911 | Ga0207654_10190885 | Ga0207654_101908851 | 267 |
| 296 | 3300025935 | Ga0207709_10008381 | Ga0207709_100083815 | 267 |
| 297 | 3300025945 | Ga0207679_10077343 | Ga0207679_100773431 | 267 |
| 298 | 3300026088 | Ga0207641_10659245 | Ga0207641_106592451 | 267 |
| 299 | 3300026089 | Ga0207648_10083848 | Ga0207648_100838482 | 267 |
| 300 | 3300026116 | Ga0207674_10022062 | Ga0207674_100220624 | 267 |
| 301 | 3300053083 | Ga0495655_0010049 | Ga0495655_0010049_865_1758 | 267 |
| 302 | 3300001432 | JGI24034J14986_100205 | JGI24034J14986_1002053 | 268 |
| 303 | 3300002074 | JGI24748J21848_1000020 | JGI24748J21848_100002055 | 268 |
| 304 | 3300002239 | JGI24034J26672_10000002 | JGI24034J26672_10000002233 | 268 |
| 305 | 3300005295 | Ga0065707_10040848 | Ga0065707_100408481 | 268 |
| 306 | 3300005340 | Ga0070689_100301283 | Ga0070689_1003012832 | 268 |
| 307 | 3300005355 | Ga0070671_100022472 | Ga0070671_1000224725 | 268 |
| 308 | 3300005364 | Ga0070673_100094126 | Ga0070673_1000941262 | 268 |
| 309 | 3300005518 | Ga0070699_100146166 | Ga0070699_1001461661 | 268 |
| 310 | 3300005536 | Ga0070697_100000047 | Ga0070697_10000004740 | 268 |
| 311 | 3300005546 | Ga0070696_100180269 | Ga0070696_1001802692 | 268 |
| 312 | 3300005615 | Ga0070702_100188985 | Ga0070702_1001889852 | 268 |
| 313 | 3300005617 | Ga0068859_100237128 | Ga0068859_1002371283 | 268 |
| 314 | 3300005842 | Ga0068858_100000008 | Ga0068858_10000000876 | 268 |
| 315 | 3300006852 | Ga0075433_10318259 | Ga0075433_103182592 | 268 |
| 316 | 3300006931 | Ga0097620_100237133 | Ga0097620_1002371333 | 268 |
| 317 | 3300009101 | Ga0105247_10000001 | Ga0105247_10000001407 | 268 |
| 318 | 3300009147 | Ga0114129_10002864 | Ga0114129_100028648 | 268 |
| 319 | 3300009148 | Ga0105243_10000646 | Ga0105243_100006461 | 268 |
| 320 | 3300009176 | Ga0105242_10001645 | Ga0105242_1000164513 | 268 |
| 321 | 3300013297 | Ga0157378_10000019 | Ga0157378_1000001963 | 268 |
| 322 | 3300013307 | Ga0157372_10342037 | Ga0157372_103420371 | 268 |
| 323 | 3300013308 | Ga0157375_10017803 | Ga0157375_100178034 | 268 |
| 324 | 3300014325 | Ga0163163_10191796 | Ga0163163_101917962 | 268 |
| 325 | 3300014968 | Ga0157379_10061318 | Ga0157379_100613184 | 268 |
| 326 | 3300025223 | Ga0207672_1000065 | Ga0207672_100006514 | 268 |
| 327 | 3300025900 | Ga0207710_10000003 | Ga0207710_10000003229 | 268 |
| 328 | 3300025931 | Ga0207644_10001567 | Ga0207644_100015674 | 268 |
| 329 | 3300025931 | Ga0207644_10003719 | Ga0207644_100037193 | 268 |
| 330 | 3300025934 | Ga0207686_10171435 | Ga0207686_101714352 | 268 |
| 331 | 3300025935 | Ga0207709_10001127 | Ga0207709_100011273 | 268 |
| 332 | 3300026023 | Ga0207677_10310741 | Ga0207677_103107412 | 268 |
| 333 | 3300026035 | Ga0207703_10000109 | Ga0207703_1000010913 | 268 |
| 334 | 3300026095 | Ga0207676_10242990 | Ga0207676_102429902 | 268 |
| 335 | 3300048909 | Ga0496106_0024232 | Ga0496106_0024232_2581_3519 | 268 |
| 336 | 3300050515 | nmdc:mga0a205_98799_c1 | nmdc:mga0a205_98799_c1_46_966 | 268 |
| 337 | 3300005293 | Ga0065715_10094761 | Ga0065715_100947612 | 269 |
| 338 | 3300005334 | Ga0068869_100058635 | Ga0068869_1000586353 | 269 |
| 339 | 3300005335 | Ga0070666_10086651 | Ga0070666_100866512 | 269 |
| 340 | 3300005338 | Ga0068868_100036486 | Ga0068868_1000364862 | 269 |
| 341 | 3300005364 | Ga0070673_100155206 | Ga0070673_1001552063 | 269 |
| 342 | 3300005406 | Ga0070703_10000048 | Ga0070703_1000004844 | 269 |
| 343 | 3300005441 | Ga0070700_100030220 | Ga0070700_1000302202 | 269 |
| 344 | 3300005459 | Ga0068867_100087157 | Ga0068867_1000871571 | 269 |
| 345 | 3300005543 | Ga0070672_100179266 | Ga0070672_1001792662 | 269 |
| 346 | 3300005545 | Ga0070695_100129004 | Ga0070695_1001290042 | 269 |
| 347 | 3300005546 | Ga0070696_100034377 | Ga0070696_1000343773 | 269 |
| 348 | 3300005549 | Ga0070704_100190932 | Ga0070704_1001909322 | 269 |
| 349 | 3300005617 | Ga0068859_100012155 | Ga0068859_1000121557 | 269 |
| 350 | 3300005618 | Ga0068864_100100162 | Ga0068864_1001001623 | 269 |
| 351 | 3300005718 | Ga0068866_10214190 | Ga0068866_102141902 | 269 |
| 352 | 3300005841 | Ga0068863_100123803 | Ga0068863_1001238033 | 269 |
| 353 | 3300005842 | Ga0068858_100044468 | Ga0068858_1000444685 | 269 |
| 354 | 3300005843 | Ga0068860_100013902 | Ga0068860_1000139027 | 269 |
| 355 | 3300005843 | Ga0068860_100257601 | Ga0068860_1002576013 | 269 |
| 356 | 3300006237 | Ga0097621_100002796 | Ga0097621_10000279610 | 269 |
| 357 | 3300006358 | Ga0068871_100007882 | Ga0068871_1000078827 | 269 |
| 358 | 3300006844 | Ga0075428_100354666 | Ga0075428_1003546662 | 269 |
| 359 | 3300006871 | Ga0075434_100487663 | Ga0075434_1004876632 | 269 |
| 360 | 3300006931 | Ga0097620_100012155 | Ga0097620_1000121557 | 269 |
| 361 | 3300009176 | Ga0105242_10071804 | Ga0105242_100718043 | 269 |
| 362 | 3300009553 | Ga0105249_10317775 | Ga0105249_103177752 | 269 |
| 363 | 3300013296 | Ga0157374_10021074 | Ga0157374_100210742 | 269 |
| 364 | 3300013297 | Ga0157378_10067268 | Ga0157378_100672683 | 269 |
| 365 | 3300013297 | Ga0157378_10586028 | Ga0157378_105860281 | 269 |
| 366 | 3300013306 | Ga0163162_10007396 | Ga0163162_100073965 | 269 |
| 367 | 3300013306 | Ga0163162_10511897 | Ga0163162_105118972 | 269 |
| 368 | 3300013308 | Ga0157375_10099018 | Ga0157375_100990184 | 269 |
| 369 | 3300013308 | Ga0157375_10341273 | Ga0157375_103412732 | 269 |
| 370 | 3300014325 | Ga0163163_10001332 | Ga0163163_1000133211 | 269 |
| 371 | 3300014325 | Ga0163163_10025718 | Ga0163163_100257184 | 269 |
| 372 | 3300014325 | Ga0163163_10455406 | Ga0163163_104554061 | 269 |
| 373 | 3300014968 | Ga0157379_10056084 | Ga0157379_100560842 | 269 |
| 374 | 3300014969 | Ga0157376_10109332 | Ga0157376_101093322 | 269 |
| 375 | 3300014969 | Ga0157376_10227024 | Ga0157376_102270242 | 269 |
| 376 | 3300025885 | Ga0207653_10000175 | Ga0207653_100001753 | 269 |
| 377 | 3300025903 | Ga0207680_10184943 | Ga0207680_101849431 | 269 |
| 378 | 3300025931 | Ga0207644_10044889 | Ga0207644_100448893 | 269 |
| 379 | 3300025938 | Ga0207704_10142521 | Ga0207704_101425212 | 269 |
| 380 | 3300025941 | Ga0207711_10080204 | Ga0207711_100802042 | 269 |
| 381 | 3300025941 | Ga0207711_10328714 | Ga0207711_103287142 | 269 |
| 382 | 3300025986 | Ga0207658_10255740 | Ga0207658_102557401 | 269 |
| 383 | 3300026035 | Ga0207703_10121334 | Ga0207703_101213343 | 269 |
| 384 | 3300026075 | Ga0207708_10048883 | Ga0207708_100488833 | 269 |
| 385 | 3300026088 | Ga0207641_10422704 | Ga0207641_104227042 | 269 |
| 386 | 3300026089 | Ga0207648_10119943 | Ga0207648_101199433 | 269 |
| 387 | 3300026095 | Ga0207676_10012506 | Ga0207676_100125065 | 269 |
| 388 | 3300026118 | Ga0207675_100000727 | Ga0207675_1000007273 | 269 |
| 389 | 3300028379 | Ga0268266_10050152 | Ga0268266_100501522 | 269 |
| 390 | 3300028381 | Ga0268264_10057045 | Ga0268264_100570454 | 269 |
| 391 | 3300028381 | Ga0268264_10314636 | Ga0268264_103146362 | 269 |
| 392 | 3300038443 | Ga0395901_0531267 | Ga0395901_0531267_259_1182 | 269 |
| 393 | 3300046472 | Ga0495580_0121086 | Ga0495580_0121086_684_1601 | 269 |
| 394 | 3300046674 | Ga0495588_0177170 | Ga0495588_0177170_128_1045 | 269 |
| 395 | 3300048917 | Ga0496114_0238727 | Ga0496114_0238727_159_1076 | 269 |
| 396 | 3300050512 | nmdc:mga0n895_522691_c1 | nmdc:mga0n895_522691_c1_158_1057 | 269 |
| 397 | 3300050515 | nmdc:mga0a205_309082_c1 | nmdc:mga0a205_309082_c1_518_1417 | 269 |
| 398 | 3300005288 | Ga0065714_10064454 | Ga0065714_1006445452 | 270 |
| 399 | 3300005290 | Ga0065712_10000129 | Ga0065712_1000012917 | 270 |
| 400 | 3300005293 | Ga0065715_10108203 | Ga0065715_101082034 | 270 |
| 401 | 3300005334 | Ga0068869_100049526 | Ga0068869_1000495263 | 270 |
| 402 | 3300005337 | Ga0070682_100000053 | Ga0070682_10000005331 | 270 |
| 403 | 3300005338 | Ga0068868_100149230 | Ga0068868_1001492302 | 270 |
| 404 | 3300005434 | Ga0070709_10120586 | Ga0070709_101205863 | 270 |
| 405 | 3300005444 | Ga0070694_100018636 | Ga0070694_1000186362 | 270 |
| 406 | 3300005468 | Ga0070707_100213229 | Ga0070707_1002132294 | 270 |
| 407 | 3300005471 | Ga0070698_100000143 | Ga0070698_10000014328 | 270 |
| 408 | 3300005471 | Ga0070698_100048394 | Ga0070698_1000483943 | 270 |
| 409 | 3300005544 | Ga0070686_100296894 | Ga0070686_1002968941 | 270 |
| 410 | 3300005547 | Ga0070693_100237383 | Ga0070693_1002373832 | 270 |
| 411 | 3300005719 | Ga0068861_100022645 | Ga0068861_1000226451 | 270 |
| 412 | 3300006237 | Ga0097621_100146875 | Ga0097621_1001468753 | 270 |
| 413 | 3300006358 | Ga0068871_100042557 | Ga0068871_1000425574 | 270 |
| 414 | 3300006914 | Ga0075436_100000012 | Ga0075436_10000001275 | 270 |
| 415 | 3300007076 | Ga0075435_100001219 | Ga0075435_1000012192 | 270 |
| 416 | 3300007076 | Ga0075435_100231520 | Ga0075435_1002315201 | 270 |
| 417 | 3300009148 | Ga0105243_10096012 | Ga0105243_100960122 | 270 |
| 418 | 3300009553 | Ga0105249_10139416 | Ga0105249_101394163 | 270 |
| 419 | 3300013306 | Ga0163162_10047531 | Ga0163162_100475312 | 270 |
| 420 | 3300025906 | Ga0207699_10183740 | Ga0207699_101837402 | 270 |
| 421 | 3300025922 | Ga0207646_10116464 | Ga0207646_101164643 | 270 |
| 422 | 3300025935 | Ga0207709_10130067 | Ga0207709_101300672 | 270 |
| 423 | 3300025942 | Ga0207689_10081990 | Ga0207689_100819903 | 270 |
| 424 | 3300025942 | Ga0207689_10470756 | Ga0207689_104707562 | 270 |
| 425 | 3300026023 | Ga0207677_10092440 | Ga0207677_100924402 | 270 |
| 426 | 3300044673 | Ga0453683_0027779 | Ga0453683_0027779_217_1155 | 270 |
| 427 | 3300045051 | Ga0451576_0058806 | Ga0451576_0058806_645_1583 | 270 |
| 428 | 3300046525 | Ga0495663_0000223 | Ga0495663_0000223_5667_6593 | 270 |
| 429 | 3300046539 | Ga0495621_0001177 | Ga0495621_0001177_751_1677 | 270 |
| 430 | 3300048090 | Ga0495615_0027223 | Ga0495615_0027223_195_1118 | 270 |
| 431 | 3300050513 | nmdc:mga0rr50_223016_c1 | nmdc:mga0rr50_223016_c1_151_1065 | 270 |
| 432 | 3300050513 | nmdc:mga0rr50_450_c1 | nmdc:mga0rr50_450_c1_15229_16131 | 270 |
| 433 | 3300050514 | nmdc:mga08x19_5_c1 | nmdc:mga08x19_5_c1_328710_329612 | 270 |
| 434 | 3300005295 | Ga0065707_10120641 | Ga0065707_101206411 | 271 |
| 435 | 3300005331 | Ga0070670_100285306 | Ga0070670_1002853062 | 271 |
| 436 | 3300005334 | Ga0068869_100053833 | Ga0068869_1000538333 | 271 |
| 437 | 3300005343 | Ga0070687_100019746 | Ga0070687_1000197463 | 271 |
| 438 | 3300005467 | Ga0070706_100203414 | Ga0070706_1002034143 | 271 |
| 439 | 3300005544 | Ga0070686_100100100 | Ga0070686_1001001002 | 271 |
| 440 | 3300005564 | Ga0070664_100216216 | Ga0070664_1002162163 | 271 |
| 441 | 3300005577 | Ga0068857_100215226 | Ga0068857_1002152261 | 271 |
| 442 | 3300005937 | Ga0081455_10311862 | Ga0081455_103118621 | 271 |
| 443 | 3300006871 | Ga0075434_100276147 | Ga0075434_1002761472 | 271 |
| 444 | 3300007788 | Ga0099795_10088558 | Ga0099795_100885581 | 271 |
| 445 | 3300009094 | Ga0111539_10005448 | Ga0111539_100054485 | 271 |
| 446 | 3300009094 | Ga0111539_10591538 | Ga0111539_105915382 | 271 |
| 447 | 3300009147 | Ga0114129_10037695 | Ga0114129_100376951 | 271 |
| 448 | 3300009148 | Ga0105243_10331091 | Ga0105243_103310912 | 271 |
| 449 | 3300009176 | Ga0105242_10000464 | Ga0105242_100004647 | 271 |
| 450 | 3300011119 | Ga0105246_10435807 | Ga0105246_104358071 | 271 |
| 451 | 3300013306 | Ga0163162_10193194 | Ga0163162_101931942 | 271 |
| 452 | 3300013306 | Ga0163162_10439310 | Ga0163162_104393102 | 271 |
| 453 | 3300014325 | Ga0163163_10166567 | Ga0163163_101665671 | 271 |
| 454 | 3300017792 | Ga0163161_10348762 | Ga0163161_103487621 | 271 |
| 455 | 3300025918 | Ga0207662_10009243 | Ga0207662_100092433 | 271 |
| 456 | 3300025923 | Ga0207681_10355927 | Ga0207681_103559271 | 271 |
| 457 | 3300025934 | Ga0207686_10000090 | Ga0207686_1000009034 | 271 |
| 458 | 3300025934 | Ga0207686_10347165 | Ga0207686_103471651 | 271 |
| 459 | 3300025942 | Ga0207689_10009419 | Ga0207689_100094192 | 271 |
| 460 | 3300027907 | Ga0207428_10024954 | Ga0207428_100249544 | 271 |
| 461 | 3300037471 | Ga0395905_0254600 | Ga0395905_0254600_264_1172 | 271 |
| 462 | 3300047318 | Ga0495636_0043236 | Ga0495636_0043236_355_1293 | 271 |
| 463 | 3300050511 | nmdc:mga08y16_91674_c1 | nmdc:mga08y16_91674_c1_2103_3020 | 271 |
| 464 | 3300054114 | Ga0501084_0449824 | Ga0501084_0449824_76_990 | 271 |
| 465 | 3300061734 | Ga0530510_0108480 | Ga0530510_0108480_215_1129 | 271 |
| 466 | 3300005334 | Ga0068869_100006951 | Ga0068869_1000069513 | 272 |
| 467 | 3300005353 | Ga0070669_100132319 | Ga0070669_1001323192 | 272 |
| 468 | 3300005441 | Ga0070700_100047449 | Ga0070700_1000474492 | 272 |
| 469 | 3300005445 | Ga0070708_100031524 | Ga0070708_1000315242 | 272 |
| 470 | 3300005471 | Ga0070698_100000857 | Ga0070698_10000085718 | 272 |
| 471 | 3300005545 | Ga0070695_100048846 | Ga0070695_1000488463 | 272 |
| 472 | 3300005615 | Ga0070702_100174764 | Ga0070702_1001747642 | 272 |
| 473 | 3300005617 | Ga0068859_100014303 | Ga0068859_1000143034 | 272 |
| 474 | 3300005719 | Ga0068861_100066551 | Ga0068861_1000665511 | 272 |
| 475 | 3300005843 | Ga0068860_100105967 | Ga0068860_1001059673 | 272 |
| 476 | 3300006846 | Ga0075430_100046477 | Ga0075430_1000464774 | 272 |
| 477 | 3300006852 | Ga0075433_10364892 | Ga0075433_103648922 | 272 |
| 478 | 3300006931 | Ga0097620_100014302 | Ga0097620_1000143024 | 272 |
| 479 | 3300009147 | Ga0114129_10547180 | Ga0114129_105471801 | 272 |
| 480 | 3300013297 | Ga0157378_10432034 | Ga0157378_104320342 | 272 |
| 481 | 3300013308 | Ga0157375_10176422 | Ga0157375_101764222 | 272 |
| 482 | 3300025917 | Ga0207660_10151392 | Ga0207660_101513922 | 272 |
| 483 | 3300025923 | Ga0207681_10175759 | Ga0207681_101757592 | 272 |
| 484 | 3300025933 | Ga0207706_10032892 | Ga0207706_100328925 | 272 |
| 485 | 3300025940 | Ga0207691_10174318 | Ga0207691_101743182 | 272 |
| 486 | 3300025942 | Ga0207689_10018025 | Ga0207689_100180255 | 272 |
| 487 | 3300025960 | Ga0207651_10256703 | Ga0207651_102567032 | 272 |
| 488 | 3300025981 | Ga0207640_10251194 | Ga0207640_102511942 | 272 |
| 489 | 3300026075 | Ga0207708_10030781 | Ga0207708_100307814 | 272 |
| 490 | 3300026118 | Ga0207675_100073732 | Ga0207675_1000737323 | 272 |
| 491 | 3300047320 | Ga0495672_0011357 | Ga0495672_0011357_4258_5190 | 272 |
| 492 | 3300050507 | nmdc:mga05p37_425785_c1 | nmdc:mga05p37_425785_c1_510_1424 | 272 |
| 493 | 3300050508 | nmdc:mga09592_269100_c1 | nmdc:mga09592_269100_c1_238_1146 | 272 |
| 494 | 3300050510 | nmdc:mga06r32_326012_c1 | nmdc:mga06r32_326012_c1_463_1371 | 272 |
| 495 | 3300003322 | rootL2_10085343 | rootL2_100853432 | 273 |
| 496 | 3300005331 | Ga0070670_100057826 | Ga0070670_1000578264 | 273 |
| 497 | 3300005353 | Ga0070669_100020321 | Ga0070669_1000203215 | 273 |
| 498 | 3300005438 | Ga0070701_10003449 | Ga0070701_100034492 | 273 |
| 499 | 3300005440 | Ga0070705_100176643 | Ga0070705_1001766431 | 273 |
| 500 | 3300005444 | Ga0070694_100036698 | Ga0070694_1000366983 | 273 |
| 501 | 3300005445 | Ga0070708_100244638 | Ga0070708_1002446382 | 273 |
| 502 | 3300005467 | Ga0070706_100046926 | Ga0070706_1000469264 | 273 |
| 503 | 3300005467 | Ga0070706_100083782 | Ga0070706_1000837824 | 273 |
| 504 | 3300005471 | Ga0070698_100015234 | Ga0070698_1000152345 | 273 |
| 505 | 3300005518 | Ga0070699_100009363 | Ga0070699_1000093633 | 273 |
| 506 | 3300005536 | Ga0070697_100000811 | Ga0070697_10000081121 | 273 |
| 507 | 3300005536 | Ga0070697_100390015 | Ga0070697_1003900151 | 273 |
| 508 | 3300005544 | Ga0070686_100005298 | Ga0070686_1000052984 | 273 |
| 509 | 3300005546 | Ga0070696_100118521 | Ga0070696_1001185211 | 273 |
| 510 | 3300005549 | Ga0070704_100026888 | Ga0070704_1000268883 | 273 |
| 511 | 3300005549 | Ga0070704_100110134 | Ga0070704_1001101343 | 273 |
| 512 | 3300005718 | Ga0068866_10003038 | Ga0068866_100030383 | 273 |
| 513 | 3300005841 | Ga0068863_100128534 | Ga0068863_1001285344 | 273 |
| 514 | 3300005983 | Ga0081540_1055775 | Ga0081540_10557753 | 273 |
| 515 | 3300006852 | Ga0075433_10117076 | Ga0075433_101170762 | 273 |
| 516 | 3300006871 | Ga0075434_100064420 | Ga0075434_1000644202 | 273 |
| 517 | 3300009148 | Ga0105243_10136056 | Ga0105243_101360562 | 273 |
| 518 | 3300009553 | Ga0105249_10133657 | Ga0105249_101336571 | 273 |
| 519 | 3300013297 | Ga0157378_10062314 | Ga0157378_100623145 | 273 |
| 520 | 3300013306 | Ga0163162_10231671 | Ga0163162_102316713 | 273 |
| 521 | 3300014325 | Ga0163163_10038983 | Ga0163163_100389833 | 273 |
| 522 | 3300014326 | Ga0157380_10013736 | Ga0157380_100137365 | 273 |
| 523 | 3300025899 | Ga0207642_10002264 | Ga0207642_100022644 | 273 |
| 524 | 3300025910 | Ga0207684_10007446 | Ga0207684_100074469 | 273 |
| 525 | 3300025923 | Ga0207681_10000856 | Ga0207681_1000085612 | 273 |
| 526 | 3300025925 | Ga0207650_10000526 | Ga0207650_1000052619 | 273 |
| 527 | 3300025934 | Ga0207686_10332276 | Ga0207686_103322762 | 273 |
| 528 | 3300025961 | Ga0207712_10025809 | Ga0207712_100258092 | 273 |
| 529 | 3300026088 | Ga0207641_10095995 | Ga0207641_100959954 | 273 |
| 530 | 3300026089 | Ga0207648_10277882 | Ga0207648_102778822 | 273 |
| 531 | 3300031731 | Ga0307405_10184330 | Ga0307405_101843302 | 273 |
| 532 | 3300031824 | Ga0307413_10144691 | Ga0307413_101446912 | 273 |
| 533 | 3300032002 | Ga0307416_100363332 | Ga0307416_1003633322 | 273 |
| 534 | 3300032005 | Ga0307411_10038838 | Ga0307411_100388384 | 273 |
| 535 | 3300032126 | Ga0307415_100034997 | Ga0307415_1000349973 | 273 |
| 536 | 3300045051 | Ga0451576_0255221 | Ga0451576_0255221_580_1512 | 273 |
| 537 | 3300049515 | Ga0501292_002422 | Ga0501292_002422_1396_2313 | 273 |
| 538 | 3300049522 | Ga0501299_002470 | Ga0501299_002470_725_1642 | 273 |
| 539 | 3300049652 | Ga0501202_039618 | Ga0501202_039618_80_997 | 273 |
| 540 | 3300049655 | Ga0501208_009527 | Ga0501208_009527_222_1139 | 273 |
| 541 | 3300049660 | Ga0501216_002558 | Ga0501216_002558_1190_2107 | 273 |
| 542 | 3300049661 | Ga0501217_021929 | Ga0501217_021929_479_1396 | 273 |
| 543 | 3300049667 | Ga0501230_012163 | Ga0501230_012163_254_1171 | 273 |
| 544 | 3300049669 | Ga0501235_033273 | Ga0501235_033273_114_1031 | 273 |
| 545 | 3300049677 | Ga0501247_009044 | Ga0501247_009044_214_1131 | 273 |
| 546 | 3300049679 | Ga0501249_010084 | Ga0501249_010084_26_943 | 273 |
| 547 | 3300049690 | Ga0501261_006149 | Ga0501261_006149_12_929 | 273 |
| 548 | 3300049705 | Ga0501225_0012705 | Ga0501225_0012705_720_1637 | 273 |
| 549 | 3300049707 | Ga0501234_009209 | Ga0501234_009209_334_1251 | 273 |
| 550 | 3300050512 | nmdc:mga0n895_305469_c1 | nmdc:mga0n895_305469_c1_631_1548 | 273 |
| 551 | 3300050515 | nmdc:mga0a205_83063_c1 | nmdc:mga0a205_83063_c1_190_1107 | 273 |
| 552 | 3300005289 | Ga0065704_10020787 | Ga0065704_100207872 | 274 |
| 553 | 3300005293 | Ga0065715_10145744 | Ga0065715_101457441 | 274 |
| 554 | 3300005295 | Ga0065707_10010192 | Ga0065707_100101922 | 274 |
| 555 | 3300005330 | Ga0070690_100022746 | Ga0070690_1000227461 | 274 |
| 556 | 3300005335 | Ga0070666_10287327 | Ga0070666_102873271 | 274 |
| 557 | 3300005336 | Ga0070680_100005606 | Ga0070680_1000056065 | 274 |
| 558 | 3300005338 | Ga0068868_100097169 | Ga0068868_1000971692 | 274 |
| 559 | 3300005343 | Ga0070687_100079243 | Ga0070687_1000792432 | 274 |
| 560 | 3300005345 | Ga0070692_10139726 | Ga0070692_101397261 | 274 |
| 561 | 3300005440 | Ga0070705_100424576 | Ga0070705_1004245761 | 274 |
| 562 | 3300005444 | Ga0070694_100023777 | Ga0070694_1000237774 | 274 |
| 563 | 3300005457 | Ga0070662_100095102 | Ga0070662_1000951023 | 274 |
| 564 | 3300005457 | Ga0070662_100173507 | Ga0070662_1001735071 | 274 |
| 565 | 3300005458 | Ga0070681_10000362 | Ga0070681_100003627 | 274 |
| 566 | 3300005458 | Ga0070681_10002416 | Ga0070681_1000241614 | 274 |
| 567 | 3300005467 | Ga0070706_100023122 | Ga0070706_1000231224 | 274 |
| 568 | 3300005467 | Ga0070706_100089013 | Ga0070706_1000890132 | 274 |
| 569 | 3300005468 | Ga0070707_100182363 | Ga0070707_1001823633 | 274 |
| 570 | 3300005471 | Ga0070698_100045288 | Ga0070698_1000452883 | 274 |
| 571 | 3300005471 | Ga0070698_100502047 | Ga0070698_1005020472 | 274 |
| 572 | 3300005518 | Ga0070699_100221637 | Ga0070699_1002216372 | 274 |
| 573 | 3300005530 | Ga0070679_100000540 | Ga0070679_10000054026 | 274 |
| 574 | 3300005536 | Ga0070697_100051508 | Ga0070697_1000515083 | 274 |
| 575 | 3300005536 | Ga0070697_100301340 | Ga0070697_1003013401 | 274 |
| 576 | 3300005543 | Ga0070672_100207047 | Ga0070672_1002070472 | 274 |
| 577 | 3300005544 | Ga0070686_100016452 | Ga0070686_1000164522 | 274 |
| 578 | 3300005545 | Ga0070695_100081856 | Ga0070695_1000818563 | 274 |
| 579 | 3300005547 | Ga0070693_100186248 | Ga0070693_1001862481 | 274 |
| 580 | 3300005549 | Ga0070704_100022565 | Ga0070704_1000225653 | 274 |
| 581 | 3300005549 | Ga0070704_100077215 | Ga0070704_1000772153 | 274 |
| 582 | 3300005614 | Ga0068856_100073874 | Ga0068856_1000738742 | 274 |
| 583 | 3300005617 | Ga0068859_100055655 | Ga0068859_1000556553 | 274 |
| 584 | 3300005617 | Ga0068859_100219495 | Ga0068859_1002194952 | 274 |
| 585 | 3300005618 | Ga0068864_100648731 | Ga0068864_1006487312 | 274 |
| 586 | 3300005719 | Ga0068861_100097589 | Ga0068861_1000975892 | 274 |
| 587 | 3300005719 | Ga0068861_100136737 | Ga0068861_1001367372 | 274 |
| 588 | 3300005842 | Ga0068858_100260384 | Ga0068858_1002603841 | 274 |
| 589 | 3300005843 | Ga0068860_100138571 | Ga0068860_1001385712 | 274 |
| 590 | 3300005843 | Ga0068860_100314110 | Ga0068860_1003141102 | 274 |
| 591 | 3300006163 | Ga0070715_10000005 | Ga0070715_10000005204 | 274 |
| 592 | 3300006173 | Ga0070716_100000034 | Ga0070716_10000003423 | 274 |
| 593 | 3300006852 | Ga0075433_10064779 | Ga0075433_100647794 | 274 |
| 594 | 3300006871 | Ga0075434_100159219 | Ga0075434_1001592193 | 274 |
| 595 | 3300006871 | Ga0075434_100788566 | Ga0075434_1007885661 | 274 |
| 596 | 3300006931 | Ga0097620_100055655 | Ga0097620_1000556553 | 274 |
| 597 | 3300006931 | Ga0097620_100219515 | Ga0097620_1002195152 | 274 |
| 598 | 3300009093 | Ga0105240_10078482 | Ga0105240_100784824 | 274 |
| 599 | 3300009093 | Ga0105240_10295873 | Ga0105240_102958732 | 274 |
| 600 | 3300009147 | Ga0114129_10037171 | Ga0114129_100371715 | 274 |
| 601 | 3300009147 | Ga0114129_10159521 | Ga0114129_101595213 | 274 |
| 602 | 3300009174 | Ga0105241_10320746 | Ga0105241_103207462 | 274 |
| 603 | 3300009177 | Ga0105248_10168269 | Ga0105248_101682693 | 274 |
| 604 | 3300009545 | Ga0105237_10274366 | Ga0105237_102743662 | 274 |
| 605 | 3300009553 | Ga0105249_10053731 | Ga0105249_100537313 | 274 |
| 606 | 3300009553 | Ga0105249_10468382 | Ga0105249_104683821 | 274 |
| 607 | 3300011119 | Ga0105246_10265043 | Ga0105246_102650432 | 274 |
| 608 | 3300013297 | Ga0157378_10040435 | Ga0157378_100404354 | 274 |
| 609 | 3300013297 | Ga0157378_10178768 | Ga0157378_101787682 | 274 |
| 610 | 3300013306 | Ga0163162_10002140 | Ga0163162_1000214012 | 274 |
| 611 | 3300013306 | Ga0163162_10351952 | Ga0163162_103519522 | 274 |
| 612 | 3300013307 | Ga0157372_10026279 | Ga0157372_100262795 | 274 |
| 613 | 3300013307 | Ga0157372_10128556 | Ga0157372_101285562 | 274 |
| 614 | 3300013307 | Ga0157372_10335976 | Ga0157372_103359762 | 274 |
| 615 | 3300014326 | Ga0157380_10047281 | Ga0157380_100472813 | 274 |
| 616 | 3300014326 | Ga0157380_10122756 | Ga0157380_101227561 | 274 |
| 617 | 3300014968 | Ga0157379_10026966 | Ga0157379_100269663 | 274 |
| 618 | 3300025903 | Ga0207680_10224625 | Ga0207680_102246251 | 274 |
| 619 | 3300025905 | Ga0207685_10000026 | Ga0207685_1000002678 | 274 |
| 620 | 3300025910 | Ga0207684_10060736 | Ga0207684_100607362 | 274 |
| 621 | 3300025910 | Ga0207684_10426565 | Ga0207684_104265651 | 274 |
| 622 | 3300025912 | Ga0207707_10000031 | Ga0207707_1000003140 | 274 |
| 623 | 3300025912 | Ga0207707_10027684 | Ga0207707_100276845 | 274 |
| 624 | 3300025913 | Ga0207695_10096136 | Ga0207695_100961363 | 274 |
| 625 | 3300025913 | Ga0207695_10224829 | Ga0207695_102248292 | 274 |
| 626 | 3300025914 | Ga0207671_10154199 | Ga0207671_101541992 | 274 |
| 627 | 3300025917 | Ga0207660_10004070 | Ga0207660_100040706 | 274 |
| 628 | 3300025918 | Ga0207662_10038701 | Ga0207662_100387014 | 274 |
| 629 | 3300025918 | Ga0207662_10052112 | Ga0207662_100521122 | 274 |
| 630 | 3300025921 | Ga0207652_10000087 | Ga0207652_1000008789 | 274 |
| 631 | 3300025922 | Ga0207646_10177494 | Ga0207646_101774944 | 274 |
| 632 | 3300025922 | Ga0207646_10212540 | Ga0207646_102125402 | 274 |
| 633 | 3300025923 | Ga0207681_10072676 | Ga0207681_100726763 | 274 |
| 634 | 3300025933 | Ga0207706_10097554 | Ga0207706_100975542 | 274 |
| 635 | 3300025933 | Ga0207706_10129193 | Ga0207706_101291933 | 274 |
| 636 | 3300025939 | Ga0207665_10000504 | Ga0207665_100005044 | 274 |
| 637 | 3300025961 | Ga0207712_10085081 | Ga0207712_100850814 | 274 |
| 638 | 3300025961 | Ga0207712_10266274 | Ga0207712_102662741 | 274 |
| 639 | 3300026023 | Ga0207677_10022583 | Ga0207677_100225834 | 274 |
| 640 | 3300026035 | Ga0207703_10209306 | Ga0207703_102093062 | 274 |
| 641 | 3300026041 | Ga0207639_10326406 | Ga0207639_103264062 | 274 |
| 642 | 3300026078 | Ga0207702_10196334 | Ga0207702_101963343 | 274 |
| 643 | 3300026088 | Ga0207641_10361535 | Ga0207641_103615352 | 274 |
| 644 | 3300026089 | Ga0207648_10232437 | Ga0207648_102324372 | 274 |
| 645 | 3300026118 | Ga0207675_100016246 | Ga0207675_1000162464 | 274 |
| 646 | 3300026118 | Ga0207675_100021791 | Ga0207675_1000217915 | 274 |
| 647 | 3300026118 | Ga0207675_100226254 | Ga0207675_1002262542 | 274 |
| 648 | 3300026142 | Ga0207698_10513352 | Ga0207698_105133521 | 274 |
| 649 | 3300028381 | Ga0268264_10266169 | Ga0268264_102661692 | 274 |
| 650 | 3300035091 | Ga0373951_0001041 | Ga0373951_0001041_5363_6304 | 274 |
| 651 | 3300037418 | Ga0395900_0347998 | Ga0395900_0347998_416_1342 | 274 |
| 652 | 3300046683 | Ga0495658_0070803 | Ga0495658_0070803_515_1432 | 274 |
| 653 | 3300048905 | Ga0496102_0076332 | Ga0496102_0076332_1800_2717 | 274 |
| 654 | 3300048907 | Ga0496104_0078629 | Ga0496104_0078629_829_1746 | 274 |
| 655 | 3300048911 | Ga0496108_0321649 | Ga0496108_0321649_58_975 | 274 |
| 656 | 3300048915 | Ga0496112_0109066 | Ga0496112_0109066_1560_2477 | 274 |
| 657 | 3300050507 | nmdc:mga05p37_220378_c1 | nmdc:mga05p37_220378_c1_598_1542 | 274 |
| 658 | 3300050509 | nmdc:mga0qj67_123711_c1 | nmdc:mga0qj67_123711_c1_383_1294 | 274 |
| 659 | 3300050512 | nmdc:mga0n895_664145_c1 | nmdc:mga0n895_664145_c1_11_952 | 274 |
| 660 | 3300050515 | nmdc:mga0a205_92926_c1 | nmdc:mga0a205_92926_c1_52_969 | 274 |
| 661 | 2162886007 | SwRhRL2b_contig_1039737 | SwRhRL2b_0360.00002470 | 275 |
| 662 | 3300005289 | Ga0065704_10075229 | Ga0065704_100752293 | 275 |
| 663 | 3300005295 | Ga0065707_10001198 | Ga0065707_100011984 | 275 |
| 664 | 3300005468 | Ga0070707_100028094 | Ga0070707_1000280944 | 275 |
| 665 | 3300005471 | Ga0070698_100034683 | Ga0070698_1000346833 | 275 |
| 666 | 3300005518 | Ga0070699_100009653 | Ga0070699_1000096537 | 275 |
| 667 | 3300005530 | Ga0070679_100134864 | Ga0070679_1001348643 | 275 |
| 668 | 3300005536 | Ga0070697_100035763 | Ga0070697_1000357632 | 275 |
| 669 | 3300005577 | Ga0068857_100461340 | Ga0068857_1004613401 | 275 |
| 670 | 3300005617 | Ga0068859_100777818 | Ga0068859_1007778181 | 275 |
| 671 | 3300005840 | Ga0068870_10029713 | Ga0068870_100297131 | 275 |
| 672 | 3300006852 | Ga0075433_10192584 | Ga0075433_101925841 | 275 |
| 673 | 3300006931 | Ga0097620_100777859 | Ga0097620_1007778591 | 275 |
| 674 | 3300009094 | Ga0111539_10001823 | Ga0111539_1000182316 | 275 |
| 675 | 3300009177 | Ga0105248_10007844 | Ga0105248_100078448 | 275 |
| 676 | 3300014745 | Ga0157377_10213353 | Ga0157377_102133531 | 275 |
| 677 | 3300025921 | Ga0207652_10056228 | Ga0207652_100562283 | 275 |
| 678 | 3300025922 | Ga0207646_10207708 | Ga0207646_102077083 | 275 |
| 679 | 3300025941 | Ga0207711_10011318 | Ga0207711_100113185 | 275 |
| 680 | 3300027907 | Ga0207428_10018667 | Ga0207428_100186675 | 275 |
| 681 | 3300048909 | Ga0496106_0121002 | Ga0496106_0121002_946_1875 | 275 |
| 682 | 3300050511 | nmdc:mga08y16_1720_c1 | nmdc:mga08y16_1720_c1_20128_21054 | 275 |
| 683 | 3300050515 | nmdc:mga0a205_69352_c1 | nmdc:mga0a205_69352_c1_1501_2427 | 275 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6vol-assembly1.cif.gz_a | chloroplast atp synthase (r2, cf1fo) | 0.5982 | 80 | 257 |
| 7tjy-assembly1.cif.gz_T | yeast atp synthase state 1catalytic(a) without exogenous atp backbone model | 0.5935 | 80 | 258 |
| 8g08-assembly1.cif.gz_a | cryo-em structure of sq31f-bound mycobacterium smegmatis atp synthase rotational state 1 (backbone model) | 0.5769 | 77 | 263 |
| 8g07-assembly1.cif.gz_a | cryo-em structure of sq31f-bound mycobacterium smegmatis atp synthase fo region | 0.5769 | 77 | 263 |
| 6fkh-assembly1.cif.gz_a | chloroplast f1fo conformation 2 | 0.5701 | 80 | 256 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P00854_92_259_1.20.120.220 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);ATP synthase, F0 complex, subunit A | 0.4999 | 132 | 258 | 1.20.120.220 |
| af_M1FN39_66_236_1.20.120.220 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);ATP synthase, F0 complex, subunit A | 0.4928 | 129 | 265 | 1.20.120.220 |
| af_P24888_3_199_1.20.120.220 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);ATP synthase, F0 complex, subunit A | 0.4708 | 80 | 263 | 1.20.120.220 |
| af_Q8N5U1_73_165_1.20.140.150 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; | 0.4613 | 163 | 258 | 1.20.140.150 |
| af_P24888_3_199_1.20.120.220 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);ATP synthase, F0 complex, subunit A | 0.4458 | 80 | 263 | 1.20.120.220 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0F9JX90-F1-model_v4 | F0F1 ATP synthase subunit A | 0.8068 | 74 | 177 |
GO:0005886
GO:0042777 GO:0045263 GO:0046933 |
| AF-A0A7C3GJX7-F1-model_v4 | F0F1 ATP synthase subunit A | 0.7821 | 77 | 193 |
GO:0005886
GO:0042777 GO:0045263 GO:0046933 |
| AF-C4FK81-F1-model_v4 | ATP synthase, A subunit | 0.7788 | 77 | 203 |
GO:0005886
GO:0042777 GO:0045263 GO:0046933 |
| AF-A0A2V6XE48-F1-model_v4 | F0F1 ATP synthase subunit A | 0.7697 | 74 | 198 |
GO:0005886
GO:0042777 GO:0045263 GO:0046933 |
| AF-A0A2V9SW82-F1-model_v4 | F0F1 ATP synthase subunit A | 0.7681 | 27 | 223 |
GO:0005886
GO:0042777 GO:0045263 GO:0046933 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar