F474925
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 682 | 315 | 681 | 154 |
Family's Representative Sequence
| Representative Sequence | 3300042002|Ga0439442_044239|Ga0439442_044239_284_844 |
| Length | 186 |
| Sequence | VAGSGRKLRESARSGQNVAESADIDLNTDGFLRMKLDRFDKAILQALQHDGRVSNAALAERLSLSESACLRRVRALEESGLVEGYTALINQQKAGCPVNVFVNITLDRQDETDLRRFEEAVRKIPEVMECYLMTGDYDYVVRVVVADTADFERLHSKHLTRLPGVARVHSSFALRTIQKSRELPIR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2857553236 | Duganella sp. R-74557 | Isolate | Unclassified |
| 3 | 2919476304 | Duganella sp. 3397 | Isolate | Unclassified |
| 4 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 5 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 6 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 39 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 44 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 50 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 52 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 53 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 54 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 56 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 57 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 58 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 59 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 60 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 61 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 62 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 63 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 64 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 65 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 66 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 67 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 68 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 74 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 75 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 76 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 77 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 78 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 79 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 81 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 82 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 83 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 97 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 111 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 112 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 114 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 170 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 171 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 175 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 176 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 177 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 178 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 179 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 180 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 181 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 182 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 183 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 184 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 185 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 186 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 187 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 188 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 189 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 190 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 191 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 192 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 193 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 194 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 195 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 196 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 197 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 198 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 199 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 200 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 201 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 202 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 203 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 204 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 205 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 206 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 207 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 208 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 209 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 210 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 211 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 212 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 213 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 214 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 215 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 216 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 217 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 218 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 219 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 220 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 221 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 222 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 223 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 224 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 225 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 226 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 227 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 228 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 229 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 230 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 231 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 232 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 233 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 253 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 254 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 255 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 256 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 257 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 258 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 259 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 260 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 261 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 262 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 263 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 264 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 265 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 266 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 267 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 268 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 269 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 270 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 271 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 272 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 273 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049659 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control | Metagenome | Rhizosphere |
| 281 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 282 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 287 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 290 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 291 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 292 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 293 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 294 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 295 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 296 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 297 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 298 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 299 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 300 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 301 | 3300053124 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere | Metagenome | Endosphere |
| 302 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 303 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 304 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 305 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 306 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 307 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 308 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 309 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 310 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 311 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 312 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 313 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 314 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.71 |
| Metatranscriptomes | 0 |
| Isolates | 0.29 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.13 |
| Nodule | 0.29 |
| Rhizoplane | 2.79 |
| Rhizosphere | 85.48 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.3 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1383463 | 2162886007 | Bacteria | 4249 |
| 2 | rootH1_10045185 | 3300003316 | Bacteria | 3066 |
| 3 | rootH1_10045185 | 3300003323 | Bacteria | 2482 |
| 4 | rootH1_10000183 | 3300003323 | Bacteria | 3684 |
| 5 | rootH1_10027822 | 3300003323 | Bacteria | 7994 |
| 6 | Ga0065715_10130591 | 3300005293 | Bacteria | 2017 |
| 7 | Ga0065707_10082632 | 3300005295 | Bacteria | 13146 |
| 8 | Ga0065707_10098644 | 3300005295 | Unclassified | 3069 |
| 9 | Ga0070658_10157495 | 3300005327 | Bacteria | 1904 |
| 10 | Ga0070676_10155833 | 3300005328 | Bacteria | 1466 |
| 11 | Ga0070690_100015129 | 3300005330 | Bacteria | 4595 |
| 12 | Ga0070670_100035627 | 3300005331 | Bacteria | 4283 |
| 13 | Ga0070670_100508339 | 3300005331 | Bacteria | 1072 |
| 14 | Ga0068869_100008053 | 3300005334 | Bacteria | 6771 |
| 15 | Ga0070666_10025693 | 3300005335 | Bacteria | 3841 |
| 16 | Ga0070666_10085450 | 3300005335 | Bacteria | 2161 |
| 17 | Ga0070680_100039302 | 3300005336 | Bacteria | 3829 |
| 18 | Ga0070680_100040752 | 3300005336 | Bacteria | 3763 |
| 19 | Ga0070680_100077678 | 3300005336 | Bacteria | 2734 |
| 20 | Ga0070680_100336615 | 3300005336 | Bacteria | 1282 |
| 21 | Ga0070682_100612757 | 3300005337 | Bacteria | 861 |
| 22 | Ga0070682_101365767 | 3300005337 | Unclassified | 604 |
| 23 | Ga0068868_100291310 | 3300005338 | Bacteria | 1384 |
| 24 | Ga0070689_100011375 | 3300005340 | Bacteria | 6373 |
| 25 | Ga0070661_100017056 | 3300005344 | Bacteria | 5146 |
| 26 | Ga0070661_100164259 | 3300005344 | Bacteria | 1683 |
| 27 | Ga0070661_100424054 | 3300005344 | Bacteria | 1055 |
| 28 | Ga0070692_10406471 | 3300005345 | Bacteria | 861 |
| 29 | Ga0070668_100019556 | 3300005347 | Bacteria | 5097 |
| 30 | Ga0070668_100847046 | 3300005347 | Unclassified | 815 |
| 31 | Ga0070669_100091784 | 3300005353 | Bacteria | 2278 |
| 32 | Ga0070669_100234107 | 3300005353 | Bacteria | 1457 |
| 33 | Ga0070669_100643161 | 3300005353 | Bacteria | 892 |
| 34 | Ga0070675_100003796 | 3300005354 | Bacteria | 11475 |
| 35 | Ga0070675_100872445 | 3300005354 | Unclassified | 824 |
| 36 | Ga0070675_101171453 | 3300005354 | Unclassified | 707 |
| 37 | Ga0070675_101647428 | 3300005354 | Unclassified | 592 |
| 38 | Ga0070671_100054617 | 3300005355 | Bacteria | 3321 |
| 39 | Ga0070671_100210386 | 3300005355 | Bacteria | 1649 |
| 40 | Ga0070671_100220916 | 3300005355 | Bacteria | 1607 |
| 41 | Ga0070673_100052109 | 3300005364 | Bacteria | 3209 |
| 42 | Ga0070673_100069325 | 3300005364 | Bacteria | 2826 |
| 43 | Ga0070673_100940430 | 3300005364 | Bacteria | 803 |
| 44 | Ga0070659_100162435 | 3300005366 | Bacteria | 1827 |
| 45 | Ga0070659_100377181 | 3300005366 | Bacteria | 1194 |
| 46 | Ga0070659_101091248 | 3300005366 | Bacteria | 703 |
| 47 | Ga0070667_100000455 | 3300005367 | Bacteria | 42084 |
| 48 | Ga0070667_100013238 | 3300005367 | Bacteria | 6816 |
| 49 | Ga0070667_100621768 | 3300005367 | Bacteria | 996 |
| 50 | Ga0070667_100880119 | 3300005367 | Bacteria | 833 |
| 51 | Ga0070667_101072832 | 3300005367 | Bacteria | 752 |
| 52 | Ga0070714_100050721 | 3300005435 | Bacteria | 3536 |
| 53 | Ga0070714_100710481 | 3300005435 | Unclassified | 970 |
| 54 | Ga0070713_100039876 | 3300005436 | Bacteria | 3815 |
| 55 | Ga0070713_100258185 | 3300005436 | Bacteria | 1592 |
| 56 | Ga0070713_100439207 | 3300005436 | Bacteria | 1224 |
| 57 | Ga0070713_100497601 | 3300005436 | Bacteria | 1150 |
| 58 | Ga0070710_10715711 | 3300005437 | Bacteria | 708 |
| 59 | Ga0070711_100029695 | 3300005439 | Bacteria | 3611 |
| 60 | Ga0070711_100109422 | 3300005439 | Bacteria | 2026 |
| 61 | Ga0070705_100063385 | 3300005440 | Bacteria | 2205 |
| 62 | Ga0070700_100028515 | 3300005441 | Bacteria | 3322 |
| 63 | Ga0070694_100189919 | 3300005444 | Bacteria | 1525 |
| 64 | Ga0070663_100023055 | 3300005455 | Bacteria | 4167 |
| 65 | Ga0070663_100314762 | 3300005455 | Bacteria | 1257 |
| 66 | Ga0070678_100060782 | 3300005456 | Bacteria | 2783 |
| 67 | Ga0070662_100020915 | 3300005457 | Bacteria | 4463 |
| 68 | Ga0070662_100066597 | 3300005457 | Bacteria | 2643 |
| 69 | Ga0070662_100981173 | 3300005457 | Bacteria | 723 |
| 70 | Ga0070681_10009271 | 3300005458 | Bacteria | 9676 |
| 71 | Ga0070681_10042578 | 3300005458 | Bacteria | 4550 |
| 72 | Ga0070681_10043940 | 3300005458 | Bacteria | 4472 |
| 73 | Ga0070681_10045191 | 3300005458 | Bacteria | 4407 |
| 74 | Ga0070681_10182794 | 3300005458 | Bacteria | 2018 |
| 75 | Ga0070681_11331870 | 3300005458 | Unclassified | 641 |
| 76 | Ga0068867_100024408 | 3300005459 | Bacteria | 4332 |
| 77 | Ga0070685_10019662 | 3300005466 | Bacteria | 3648 |
| 78 | Ga0070706_100481873 | 3300005467 | Bacteria | 1154 |
| 79 | Ga0070706_101576335 | 3300005467 | Bacteria | 599 |
| 80 | Ga0070679_100055650 | 3300005530 | Bacteria | 3940 |
| 81 | Ga0070679_100089032 | 3300005530 | Bacteria | 3074 |
| 82 | Ga0070679_100243831 | 3300005530 | Bacteria | 1754 |
| 83 | Ga0070679_100243929 | 3300005530 | Bacteria | 1754 |
| 84 | Ga0070679_100414505 | 3300005530 | Bacteria | 1292 |
| 85 | Ga0070684_100027241 | 3300005535 | Bacteria | 4821 |
| 86 | Ga0070684_100047998 | 3300005535 | Bacteria | 3703 |
| 87 | Ga0070684_100541448 | 3300005535 | Bacteria | 1080 |
| 88 | Ga0068853_100157804 | 3300005539 | Bacteria | 2045 |
| 89 | Ga0068853_101761120 | 3300005539 | Bacteria | 600 |
| 90 | Ga0070672_100011242 | 3300005543 | Bacteria | 6242 |
| 91 | Ga0070686_100026177 | 3300005544 | Bacteria | 3518 |
| 92 | Ga0070686_100089977 | 3300005544 | Bacteria | 2051 |
| 93 | Ga0070693_100259511 | 3300005547 | Bacteria | 1155 |
| 94 | Ga0070693_100521083 | 3300005547 | Bacteria | 846 |
| 95 | Ga0070665_100008225 | 3300005548 | Bacteria | 10560 |
| 96 | Ga0070665_100019892 | 3300005548 | Bacteria | 6741 |
| 97 | Ga0070665_100056754 | 3300005548 | Bacteria | 3926 |
| 98 | Ga0070665_100239051 | 3300005548 | Bacteria | 1817 |
| 99 | Ga0070665_100401891 | 3300005548 | Bacteria | 1378 |
| 100 | Ga0070665_101211150 | 3300005548 | Bacteria | 766 |
| 101 | Ga0070704_101569885 | 3300005549 | Bacteria | 606 |
| 102 | Ga0068855_100000392 | 3300005563 | Bacteria | 53969 |
| 103 | Ga0068855_100001597 | 3300005563 | Bacteria | 28472 |
| 104 | Ga0068855_100008729 | 3300005563 | Bacteria | 12253 |
| 105 | Ga0068855_100205149 | 3300005563 | Bacteria | 2218 |
| 106 | Ga0068855_100923035 | 3300005563 | Bacteria | 921 |
| 107 | Ga0070664_100181294 | 3300005564 | Bacteria | 1872 |
| 108 | Ga0068857_100012011 | 3300005577 | Bacteria | 7533 |
| 109 | Ga0068857_100125916 | 3300005577 | Bacteria | 2308 |
| 110 | Ga0068857_100555750 | 3300005577 | Bacteria | 1082 |
| 111 | Ga0068854_100198195 | 3300005578 | Bacteria | 1577 |
| 112 | Ga0068856_100004047 | 3300005614 | Bacteria | 14685 |
| 113 | Ga0068856_100027578 | 3300005614 | Bacteria | 5540 |
| 114 | Ga0068856_100104027 | 3300005614 | Bacteria | 2832 |
| 115 | Ga0070702_100004325 | 3300005615 | Bacteria | 6477 |
| 116 | Ga0068852_100833159 | 3300005616 | Bacteria | 937 |
| 117 | Ga0068852_101110060 | 3300005616 | Bacteria | 811 |
| 118 | Ga0068859_100000092 | 3300005617 | Bacteria | 82442 |
| 119 | Ga0068859_100001034 | 3300005617 | Bacteria | 28510 |
| 120 | Ga0068859_100034199 | 3300005617 | Bacteria | 5102 |
| 121 | Ga0068859_100125209 | 3300005617 | Bacteria | 2639 |
| 122 | Ga0068864_100053523 | 3300005618 | Bacteria | 3482 |
| 123 | Ga0068864_100634669 | 3300005618 | Bacteria | 1039 |
| 124 | Ga0068864_100855385 | 3300005618 | Unclassified | 896 |
| 125 | Ga0068866_10009522 | 3300005718 | Bacteria | 4128 |
| 126 | Ga0068866_10067119 | 3300005718 | Bacteria | 1882 |
| 127 | Ga0068861_100000011 | 3300005719 | Bacteria | 82099 |
| 128 | Ga0068861_100035493 | 3300005719 | Bacteria | 3694 |
| 129 | Ga0068851_10085808 | 3300005834 | Unclassified | 1650 |
| 130 | Ga0068870_10053832 | 3300005840 | Bacteria | 2139 |
| 131 | Ga0068870_10196986 | 3300005840 | Bacteria | 1219 |
| 132 | Ga0068863_100009047 | 3300005841 | Bacteria | 9723 |
| 133 | Ga0068863_100014747 | 3300005841 | Bacteria | 7518 |
| 134 | Ga0068863_100023640 | 3300005841 | Bacteria | 5867 |
| 135 | Ga0068863_100207876 | 3300005841 | Bacteria | 1884 |
| 136 | Ga0068863_102412561 | 3300005841 | Bacteria | 535 |
| 137 | Ga0068858_100006868 | 3300005842 | Bacteria | 11059 |
| 138 | Ga0068858_100007426 | 3300005842 | Bacteria | 10601 |
| 139 | Ga0068858_100082830 | 3300005842 | Bacteria | 2982 |
| 140 | Ga0068860_100004269 | 3300005843 | Bacteria | 14632 |
| 141 | Ga0068860_100045523 | 3300005843 | Bacteria | 4184 |
| 142 | Ga0068860_100961925 | 3300005843 | Bacteria | 871 |
| 143 | Ga0068860_101002359 | 3300005843 | Bacteria | 853 |
| 144 | Ga0068862_100000888 | 3300005844 | Bacteria | 29098 |
| 145 | Ga0068862_100002301 | 3300005844 | Bacteria | 17066 |
| 146 | Ga0068862_100013400 | 3300005844 | Bacteria | 6783 |
| 147 | Ga0068862_101478416 | 3300005844 | Bacteria | 684 |
| 148 | Ga0081455_10000016 | 3300005937 | Bacteria | 176679 |
| 149 | Ga0081455_10158140 | 3300005937 | Bacteria | 1740 |
| 150 | Ga0081539_10000060 | 3300005985 | Bacteria | 252799 |
| 151 | Ga0070717_10029245 | 3300006028 | Bacteria | 4418 |
| 152 | Ga0070715_10427283 | 3300006163 | Unclassified | 743 |
| 153 | Ga0070716_100164797 | 3300006173 | Bacteria | 1440 |
| 154 | Ga0070716_100361248 | 3300006173 | Bacteria | 1031 |
| 155 | Ga0070712_100060593 | 3300006175 | Bacteria | 2670 |
| 156 | Ga0070712_100215381 | 3300006175 | Bacteria | 1517 |
| 157 | Ga0070712_100797251 | 3300006175 | Bacteria | 810 |
| 158 | Ga0097621_100331903 | 3300006237 | Unclassified | 1349 |
| 159 | Ga0097621_101006599 | 3300006237 | Bacteria | 780 |
| 160 | Ga0097621_101395339 | 3300006237 | Bacteria | 663 |
| 161 | Ga0068871_100401767 | 3300006358 | Bacteria | 1220 |
| 162 | Ga0068871_100991522 | 3300006358 | Bacteria | 782 |
| 163 | Ga0068871_101318555 | 3300006358 | Bacteria | 679 |
| 164 | Ga0068871_101494549 | 3300006358 | Bacteria | 638 |
| 165 | Ga0075428_100000063 | 3300006844 | Bacteria | 86012 |
| 166 | Ga0075428_100010087 | 3300006844 | Bacteria | 10494 |
| 167 | Ga0075428_100011126 | 3300006844 | Bacteria | 10013 |
| 168 | Ga0075428_101898022 | 3300006844 | Bacteria | 619 |
| 169 | Ga0075430_100007097 | 3300006846 | Bacteria | 9448 |
| 170 | Ga0075430_100008776 | 3300006846 | Bacteria | 8530 |
| 171 | Ga0075430_100053377 | 3300006846 | Bacteria | 3403 |
| 172 | Ga0075430_100360402 | 3300006846 | Bacteria | 1201 |
| 173 | Ga0075430_100447589 | 3300006846 | Bacteria | 1066 |
| 174 | Ga0075430_100459386 | 3300006846 | Bacteria | 1051 |
| 175 | Ga0075431_100000298 | 3300006847 | Bacteria | 39052 |
| 176 | Ga0075431_100003650 | 3300006847 | Bacteria | 14923 |
| 177 | Ga0075431_100007451 | 3300006847 | Bacteria | 10898 |
| 178 | Ga0075431_100018918 | 3300006847 | Bacteria | 7016 |
| 179 | Ga0075431_100089184 | 3300006847 | Bacteria | 3183 |
| 180 | Ga0075431_100179092 | 3300006847 | Bacteria | 2176 |
| 181 | Ga0075434_100630163 | 3300006871 | Bacteria | 1091 |
| 182 | Ga0075429_100005716 | 3300006880 | Bacteria | 10730 |
| 183 | Ga0075429_100016693 | 3300006880 | Bacteria | 6358 |
| 184 | Ga0075429_100096222 | 3300006880 | Bacteria | 2583 |
| 185 | Ga0075429_100251907 | 3300006880 | Bacteria | 1546 |
| 186 | Ga0097620_100000092 | 3300006931 | Bacteria | 82442 |
| 187 | Ga0097620_100001034 | 3300006931 | Bacteria | 28510 |
| 188 | Ga0097620_100034199 | 3300006931 | Bacteria | 5102 |
| 189 | Ga0097620_100125208 | 3300006931 | Bacteria | 2639 |
| 190 | Ga0079104_1027601 | 3300006946 | Bacteria | 1453 |
| 191 | Ga0099794_10220632 | 3300007265 | Bacteria | 974 |
| 192 | Ga0099795_10008188 | 3300007788 | Bacteria | 2966 |
| 193 | Ga0105250_10000031 | 3300009092 | Bacteria | 170328 |
| 194 | Ga0105250_10005907 | 3300009092 | Bacteria | 5417 |
| 195 | Ga0105250_10037645 | 3300009092 | Bacteria | 1940 |
| 196 | Ga0105250_10143792 | 3300009092 | Bacteria | 990 |
| 197 | Ga0105240_10001742 | 3300009093 | Bacteria | 36760 |
| 198 | Ga0105240_10016076 | 3300009093 | Bacteria | 10139 |
| 199 | Ga0105240_10022235 | 3300009093 | Bacteria | 8413 |
| 200 | Ga0105240_10034991 | 3300009093 | Bacteria | 6476 |
| 201 | Ga0105240_10051007 | 3300009093 | Bacteria | 5210 |
| 202 | Ga0105240_10080442 | 3300009093 | Bacteria | 4007 |
| 203 | Ga0105240_10164811 | 3300009093 | Bacteria | 2629 |
| 204 | Ga0105240_10332079 | 3300009093 | Bacteria | 1730 |
| 205 | Ga0105240_10339259 | 3300009093 | Bacteria | 1708 |
| 206 | Ga0111539_10000428 | 3300009094 | Bacteria | 52857 |
| 207 | Ga0111539_10010330 | 3300009094 | Bacteria | 11754 |
| 208 | Ga0111539_10032635 | 3300009094 | Bacteria | 6322 |
| 209 | Ga0111539_10078027 | 3300009094 | Bacteria | 3897 |
| 210 | Ga0111539_10172799 | 3300009094 | Bacteria | 2524 |
| 211 | Ga0111539_10884749 | 3300009094 | Bacteria | 1039 |
| 212 | Ga0105245_10568061 | 3300009098 | Bacteria | 1158 |
| 213 | Ga0105247_10000482 | 3300009101 | Bacteria | 33256 |
| 214 | Ga0105247_10007371 | 3300009101 | Bacteria | 6757 |
| 215 | Ga0105247_10150790 | 3300009101 | Bacteria | 1532 |
| 216 | Ga0114129_10007442 | 3300009147 | Bacteria | 15595 |
| 217 | Ga0114129_10145822 | 3300009147 | Bacteria | 3243 |
| 218 | Ga0105243_12343055 | 3300009148 | Bacteria | 572 |
| 219 | Ga0105241_10019394 | 3300009174 | Bacteria | 5014 |
| 220 | Ga0105241_10336679 | 3300009174 | Bacteria | 1306 |
| 221 | Ga0105241_10751493 | 3300009174 | Bacteria | 894 |
| 222 | Ga0105241_10829127 | 3300009174 | Bacteria | 854 |
| 223 | Ga0105241_11158045 | 3300009174 | Bacteria | 731 |
| 224 | Ga0105242_10074774 | 3300009176 | Bacteria | 2819 |
| 225 | Ga0105248_10005260 | 3300009177 | Bacteria | 14242 |
| 226 | Ga0105248_10033557 | 3300009177 | Bacteria | 5735 |
| 227 | Ga0105248_10088707 | 3300009177 | Bacteria | 3481 |
| 228 | Ga0105237_10042229 | 3300009545 | Bacteria | 4600 |
| 229 | Ga0105237_10100121 | 3300009545 | Bacteria | 2889 |
| 230 | Ga0105237_10331497 | 3300009545 | Bacteria | 1526 |
| 231 | Ga0105237_10481995 | 3300009545 | Bacteria | 1247 |
| 232 | Ga0105237_10762756 | 3300009545 | Bacteria | 974 |
| 233 | Ga0105237_10834266 | 3300009545 | Bacteria | 928 |
| 234 | Ga0105237_11554545 | 3300009545 | Unclassified | 668 |
| 235 | Ga0105238_10047524 | 3300009551 | Bacteria | 4326 |
| 236 | Ga0105238_10052665 | 3300009551 | Bacteria | 4091 |
| 237 | Ga0105238_10056304 | 3300009551 | Bacteria | 3945 |
| 238 | Ga0105238_10079682 | 3300009551 | Bacteria | 3265 |
| 239 | Ga0105238_10156877 | 3300009551 | Bacteria | 2251 |
| 240 | Ga0105238_10415384 | 3300009551 | Bacteria | 1339 |
| 241 | Ga0105238_11649597 | 3300009551 | Unclassified | 672 |
| 242 | Ga0105238_12434992 | 3300009551 | Unclassified | 559 |
| 243 | Ga0105249_10008115 | 3300009553 | Bacteria | 9153 |
| 244 | Ga0105249_10073625 | 3300009553 | Bacteria | 3160 |
| 245 | Ga0105249_10084364 | 3300009553 | Bacteria | 2958 |
| 246 | Ga0105249_10106648 | 3300009553 | Bacteria | 2643 |
| 247 | Ga0105249_10289876 | 3300009553 | Bacteria | 1638 |
| 248 | Ga0105249_10400818 | 3300009553 | Bacteria | 1402 |
| 249 | Ga0105249_10799456 | 3300009553 | Bacteria | 1007 |
| 250 | Ga0099796_10021732 | 3300010159 | Bacteria | 1980 |
| 251 | Ga0105239_10146473 | 3300010375 | Unclassified | 2634 |
| 252 | Ga0105239_10573183 | 3300010375 | Bacteria | 1286 |
| 253 | Ga0105239_10742520 | 3300010375 | Unclassified | 1123 |
| 254 | Ga0105239_11521453 | 3300010375 | Unclassified | 773 |
| 255 | Ga0105246_10084901 | 3300011119 | Bacteria | 2266 |
| 256 | Ga0105246_10195242 | 3300011119 | Bacteria | 1570 |
| 257 | Ga0105246_10905409 | 3300011119 | Bacteria | 791 |
| 258 | Ga0157369_10023283 | 3300013105 | Bacteria | 6899 |
| 259 | Ga0157369_10096890 | 3300013105 | Bacteria | 3146 |
| 260 | Ga0157369_10627881 | 3300013105 | Bacteria | 1108 |
| 261 | Ga0157369_10883122 | 3300013105 | Bacteria | 917 |
| 262 | Ga0157374_10038537 | 3300013296 | Bacteria | 4394 |
| 263 | Ga0157374_10577519 | 3300013296 | Bacteria | 1133 |
| 264 | Ga0157378_10813997 | 3300013297 | Bacteria | 960 |
| 265 | Ga0163162_10114758 | 3300013306 | Bacteria | 2793 |
| 266 | Ga0163162_10122167 | 3300013306 | Bacteria | 2709 |
| 267 | Ga0163162_10646610 | 3300013306 | Bacteria | 1181 |
| 268 | Ga0163162_10857284 | 3300013306 | Bacteria | 1023 |
| 269 | Ga0157372_10158176 | 3300013307 | Bacteria | 2618 |
| 270 | Ga0157372_10348192 | 3300013307 | Bacteria | 1726 |
| 271 | Ga0157372_10400366 | 3300013307 | Unclassified | 1600 |
| 272 | Ga0157372_10767954 | 3300013307 | Bacteria | 1120 |
| 273 | Ga0157372_10824616 | 3300013307 | Bacteria | 1077 |
| 274 | Ga0157372_12149748 | 3300013307 | Bacteria | 641 |
| 275 | Ga0157375_10055528 | 3300013308 | Bacteria | 3906 |
| 276 | Ga0157375_10255823 | 3300013308 | Bacteria | 1912 |
| 277 | Ga0163163_10030495 | 3300014325 | Bacteria | 5196 |
| 278 | Ga0163163_10051897 | 3300014325 | Bacteria | 4044 |
| 279 | Ga0163163_10095081 | 3300014325 | Bacteria | 2999 |
| 280 | Ga0163163_10119562 | 3300014325 | Bacteria | 2668 |
| 281 | Ga0163163_11748340 | 3300014325 | Bacteria | 682 |
| 282 | Ga0157380_10017020 | 3300014326 | Bacteria | 5371 |
| 283 | Ga0157380_10211485 | 3300014326 | Bacteria | 1729 |
| 284 | Ga0157380_10350108 | 3300014326 | Bacteria | 1382 |
| 285 | Ga0157380_10407320 | 3300014326 | Bacteria | 1292 |
| 286 | Ga0157377_10012711 | 3300014745 | Bacteria | 4241 |
| 287 | Ga0157379_10018854 | 3300014968 | Bacteria | 6087 |
| 288 | Ga0157379_10137671 | 3300014968 | Bacteria | 2200 |
| 289 | Ga0157379_10145998 | 3300014968 | Bacteria | 2133 |
| 290 | Ga0157379_10394009 | 3300014968 | Bacteria | 1272 |
| 291 | Ga0157379_10544970 | 3300014968 | Bacteria | 1079 |
| 292 | Ga0157379_10903876 | 3300014968 | Bacteria | 838 |
| 293 | Ga0157376_10369143 | 3300014969 | Bacteria | 1379 |
| 294 | Ga0157376_10727490 | 3300014969 | Bacteria | 1000 |
| 295 | Ga0157376_12229098 | 3300014969 | Unclassified | 587 |
| 296 | Ga0182006_1000008 | 3300015261 | Bacteria | 449652 |
| 297 | Ga0182005_1000008 | 3300015265 | Bacteria | 471394 |
| 298 | Ga0163161_10301543 | 3300017792 | Bacteria | 1262 |
| 299 | Ga0163161_10419686 | 3300017792 | Bacteria | 1076 |
| 300 | Ga0163161_10653297 | 3300017792 | Bacteria | 872 |
| 301 | Ga0163161_11313276 | 3300017792 | Unclassified | 629 |
| 302 | Ga0213876_10143292 | 3300021384 | Bacteria | 1271 |
| 303 | Ga0209148_1005584 | 3300025254 | Bacteria | 2861 |
| 304 | Ga0209455_1000415 | 3300025272 | Bacteria | 34158 |
| 305 | Ga0207656_10096370 | 3300025321 | Bacteria | 1350 |
| 306 | Ga0207696_1000125 | 3300025711 | Bacteria | 138603 |
| 307 | Ga0207692_10224286 | 3300025898 | Bacteria | 1115 |
| 308 | Ga0207692_10905519 | 3300025898 | Bacteria | 580 |
| 309 | Ga0207642_10037517 | 3300025899 | Bacteria | 2089 |
| 310 | Ga0207710_10000962 | 3300025900 | Bacteria | 15164 |
| 311 | Ga0207710_10112003 | 3300025900 | Bacteria | 1296 |
| 312 | Ga0207688_10028551 | 3300025901 | Bacteria | 3069 |
| 313 | Ga0207680_10044294 | 3300025903 | Bacteria | 2616 |
| 314 | Ga0207680_10061639 | 3300025903 | Bacteria | 2288 |
| 315 | Ga0207680_10263133 | 3300025903 | Bacteria | 1194 |
| 316 | Ga0207680_10486494 | 3300025903 | Bacteria | 878 |
| 317 | Ga0207647_10043235 | 3300025904 | Bacteria | 2820 |
| 318 | Ga0207685_10096108 | 3300025905 | Bacteria | 1258 |
| 319 | Ga0207645_10195195 | 3300025907 | Bacteria | 1331 |
| 320 | Ga0207643_10016609 | 3300025908 | Bacteria | 4015 |
| 321 | Ga0207643_10171636 | 3300025908 | Bacteria | 1309 |
| 322 | Ga0207643_10205250 | 3300025908 | Unclassified | 1201 |
| 323 | Ga0207684_10302649 | 3300025910 | Bacteria | 1379 |
| 324 | Ga0207654_10440789 | 3300025911 | Bacteria | 912 |
| 325 | Ga0207707_10008529 | 3300025912 | Bacteria | 8885 |
| 326 | Ga0207707_10019302 | 3300025912 | Bacteria | 5950 |
| 327 | Ga0207707_10021313 | 3300025912 | Bacteria | 5665 |
| 328 | Ga0207707_10159707 | 3300025912 | Bacteria | 1971 |
| 329 | Ga0207707_10247068 | 3300025912 | Bacteria | 1550 |
| 330 | Ga0207695_10020298 | 3300025913 | Bacteria | 7615 |
| 331 | Ga0207695_10028556 | 3300025913 | Bacteria | 6182 |
| 332 | Ga0207695_10067797 | 3300025913 | Bacteria | 3658 |
| 333 | Ga0207695_10083370 | 3300025913 | Bacteria | 3229 |
| 334 | Ga0207695_10096811 | 3300025913 | Bacteria | 2953 |
| 335 | Ga0207695_10109548 | 3300025913 | Bacteria | 2743 |
| 336 | Ga0207695_10118721 | 3300025913 | Bacteria | 2615 |
| 337 | Ga0207695_10349777 | 3300025913 | Bacteria | 1365 |
| 338 | Ga0207695_10414347 | 3300025913 | Bacteria | 1232 |
| 339 | Ga0207695_10534362 | 3300025913 | Bacteria | 1054 |
| 340 | Ga0207671_10522893 | 3300025914 | Bacteria | 946 |
| 341 | Ga0207671_10912553 | 3300025914 | Unclassified | 694 |
| 342 | Ga0207693_10028614 | 3300025915 | Bacteria | 4404 |
| 343 | Ga0207693_10123844 | 3300025915 | Bacteria | 2031 |
| 344 | Ga0207663_10024741 | 3300025916 | Bacteria | 3462 |
| 345 | Ga0207660_10133523 | 3300025917 | Bacteria | 1892 |
| 346 | Ga0207660_10219013 | 3300025917 | Bacteria | 1493 |
| 347 | Ga0207660_10250308 | 3300025917 | Bacteria | 1398 |
| 348 | Ga0207660_10349558 | 3300025917 | Bacteria | 1185 |
| 349 | Ga0207660_10880834 | 3300025917 | Bacteria | 731 |
| 350 | Ga0207662_10019026 | 3300025918 | Bacteria | 3902 |
| 351 | Ga0207649_10014316 | 3300025920 | Bacteria | 4439 |
| 352 | Ga0207649_10252338 | 3300025920 | Bacteria | 1271 |
| 353 | Ga0207652_10112524 | 3300025921 | Bacteria | 2416 |
| 354 | Ga0207652_10143680 | 3300025921 | Bacteria | 2134 |
| 355 | Ga0207652_10211692 | 3300025921 | Bacteria | 1745 |
| 356 | Ga0207652_10303953 | 3300025921 | Bacteria | 1440 |
| 357 | Ga0207681_10018138 | 3300025923 | Bacteria | 4431 |
| 358 | Ga0207681_10019833 | 3300025923 | Bacteria | 4256 |
| 359 | Ga0207681_10119595 | 3300025923 | Bacteria | 1930 |
| 360 | Ga0207694_10131129 | 3300025924 | Bacteria | 2009 |
| 361 | Ga0207694_10190755 | 3300025924 | Bacteria | 1665 |
| 362 | Ga0207694_10292770 | 3300025924 | Bacteria | 1339 |
| 363 | Ga0207694_10301691 | 3300025924 | Bacteria | 1319 |
| 364 | Ga0207694_10494295 | 3300025924 | Bacteria | 1024 |
| 365 | Ga0207694_10542591 | 3300025924 | Bacteria | 975 |
| 366 | Ga0207694_10656072 | 3300025924 | Bacteria | 884 |
| 367 | Ga0207650_10196792 | 3300025925 | Bacteria | 1613 |
| 368 | Ga0207650_10257354 | 3300025925 | Unclassified | 1415 |
| 369 | Ga0207650_10469008 | 3300025925 | Bacteria | 1049 |
| 370 | Ga0207650_10890658 | 3300025925 | Bacteria | 755 |
| 371 | Ga0207659_10038385 | 3300025926 | Bacteria | 3331 |
| 372 | Ga0207659_11108433 | 3300025926 | Unclassified | 681 |
| 373 | Ga0207700_10071177 | 3300025928 | Bacteria | 2677 |
| 374 | Ga0207700_10153296 | 3300025928 | Bacteria | 1906 |
| 375 | Ga0207700_10195251 | 3300025928 | Bacteria | 1703 |
| 376 | Ga0207700_11022037 | 3300025928 | Unclassified | 739 |
| 377 | Ga0207664_10022653 | 3300025929 | Bacteria | 4695 |
| 378 | Ga0207644_10000849 | 3300025931 | Bacteria | 19352 |
| 379 | Ga0207644_10070751 | 3300025931 | Bacteria | 2551 |
| 380 | Ga0207644_10366601 | 3300025931 | Bacteria | 1173 |
| 381 | Ga0207690_10262869 | 3300025932 | Bacteria | 1338 |
| 382 | Ga0207690_10314366 | 3300025932 | Bacteria | 1229 |
| 383 | Ga0207706_10029314 | 3300025933 | Bacteria | 4913 |
| 384 | Ga0207706_10225533 | 3300025933 | Bacteria | 1640 |
| 385 | Ga0207665_10207380 | 3300025939 | Bacteria | 1430 |
| 386 | Ga0207665_10305866 | 3300025939 | Bacteria | 1190 |
| 387 | Ga0207691_10022209 | 3300025940 | Bacteria | 5986 |
| 388 | Ga0207689_10007824 | 3300025942 | Bacteria | 9347 |
| 389 | Ga0207679_10298906 | 3300025945 | Bacteria | 1387 |
| 390 | Ga0207667_10004010 | 3300025949 | Bacteria | 18096 |
| 391 | Ga0207667_10008280 | 3300025949 | Bacteria | 12370 |
| 392 | Ga0207667_10022293 | 3300025949 | Bacteria | 6999 |
| 393 | Ga0207667_10399268 | 3300025949 | Bacteria | 1400 |
| 394 | Ga0207667_10898239 | 3300025949 | Bacteria | 878 |
| 395 | Ga0207651_10056253 | 3300025960 | Bacteria | 2706 |
| 396 | Ga0207712_10025109 | 3300025961 | Bacteria | 3956 |
| 397 | Ga0207712_10082802 | 3300025961 | Bacteria | 2340 |
| 398 | Ga0207712_10170455 | 3300025961 | Bacteria | 1701 |
| 399 | Ga0207712_10558765 | 3300025961 | Bacteria | 985 |
| 400 | Ga0207668_10053771 | 3300025972 | Bacteria | 2792 |
| 401 | Ga0207640_10169472 | 3300025981 | Bacteria | 1625 |
| 402 | Ga0207658_10005893 | 3300025986 | Bacteria | 8375 |
| 403 | Ga0207658_10235595 | 3300025986 | Bacteria | 1547 |
| 404 | Ga0207658_10885531 | 3300025986 | Bacteria | 812 |
| 405 | Ga0207703_10000318 | 3300026035 | Bacteria | 52249 |
| 406 | Ga0207703_10000569 | 3300026035 | Bacteria | 37992 |
| 407 | Ga0207703_11146149 | 3300026035 | Bacteria | 747 |
| 408 | Ga0207639_10105324 | 3300026041 | Bacteria | 2288 |
| 409 | Ga0207639_10169799 | 3300026041 | Bacteria | 1846 |
| 410 | Ga0207678_10008627 | 3300026067 | Bacteria | 8983 |
| 411 | Ga0207708_10042933 | 3300026075 | Bacteria | 3445 |
| 412 | Ga0207702_10020022 | 3300026078 | Bacteria | 5544 |
| 413 | Ga0207702_10878336 | 3300026078 | Bacteria | 888 |
| 414 | Ga0207702_10918833 | 3300026078 | Bacteria | 867 |
| 415 | Ga0207641_10006850 | 3300026088 | Bacteria | 9541 |
| 416 | Ga0207641_10027150 | 3300026088 | Bacteria | 4727 |
| 417 | Ga0207641_10098870 | 3300026088 | Bacteria | 2566 |
| 418 | Ga0207641_11324485 | 3300026088 | Bacteria | 721 |
| 419 | Ga0207648_10007613 | 3300026089 | Bacteria | 10616 |
| 420 | Ga0207648_10398394 | 3300026089 | Bacteria | 1247 |
| 421 | Ga0207676_11279324 | 3300026095 | Unclassified | 728 |
| 422 | Ga0207674_10005707 | 3300026116 | Bacteria | 14753 |
| 423 | Ga0207674_10013448 | 3300026116 | Bacteria | 9080 |
| 424 | Ga0207674_10458894 | 3300026116 | Bacteria | 1231 |
| 425 | Ga0207675_100001048 | 3300026118 | Bacteria | 27391 |
| 426 | Ga0207675_100037930 | 3300026118 | Bacteria | 4496 |
| 427 | Ga0207675_100615965 | 3300026118 | Bacteria | 1090 |
| 428 | Ga0207683_10060481 | 3300026121 | Bacteria | 3330 |
| 429 | Ga0207698_10317964 | 3300026142 | Bacteria | 1457 |
| 430 | Ga0209281_1010131 | 3300027111 | Bacteria | 2174 |
| 431 | Ga0207428_10005044 | 3300027907 | Bacteria | 12405 |
| 432 | Ga0207428_10017053 | 3300027907 | Bacteria | 6239 |
| 433 | Ga0207428_10118628 | 3300027907 | Bacteria | 2030 |
| 434 | Ga0268266_10002296 | 3300028379 | Bacteria | 20741 |
| 435 | Ga0268266_10153297 | 3300028379 | Bacteria | 2079 |
| 436 | Ga0268266_10251683 | 3300028379 | Bacteria | 1634 |
| 437 | Ga0268266_10604522 | 3300028379 | Bacteria | 1053 |
| 438 | Ga0268266_10886791 | 3300028379 | Bacteria | 862 |
| 439 | Ga0268265_10000313 | 3300028380 | Bacteria | 53636 |
| 440 | Ga0268265_10324993 | 3300028380 | Bacteria | 1395 |
| 441 | Ga0268265_11379604 | 3300028380 | Bacteria | 706 |
| 442 | Ga0268264_10004984 | 3300028381 | Bacteria | 11243 |
| 443 | Ga0268264_10015749 | 3300028381 | Bacteria | 6191 |
| 444 | Ga0268264_11372393 | 3300028381 | Bacteria | 717 |
| 445 | Ga0265334_10011925 | 3300028573 | Bacteria | 3651 |
| 446 | Ga0307515_10001184 | 3300028794 | Bacteria | 59700 |
| 447 | Ga0307515_10254863 | 3300028794 | Bacteria | 1501 |
| 448 | Ga0307511_10076666 | 3300030521 | Bacteria | 2388 |
| 449 | Ga0307511_10456755 | 3300030521 | Bacteria | 503 |
| 450 | Ga0265328_10004713 | 3300031239 | Bacteria | 5894 |
| 451 | Ga0265340_10127104 | 3300031247 | Bacteria | 1171 |
| 452 | Ga0265331_10004757 | 3300031250 | Bacteria | 8380 |
| 453 | Ga0265316_10028187 | 3300031344 | Bacteria | 4636 |
| 454 | Ga0307509_10000001 | 3300031507 | Bacteria | 629324 |
| 455 | Ga0307509_10000554 | 3300031507 | Bacteria | 63868 |
| 456 | Ga0307509_10384335 | 3300031507 | Bacteria | 1116 |
| 457 | Ga0307408_100017247 | 3300031548 | Bacteria | 4831 |
| 458 | Ga0307408_100355033 | 3300031548 | Bacteria | 1245 |
| 459 | Ga0307508_10159189 | 3300031616 | Bacteria | 1862 |
| 460 | Ga0307508_10178293 | 3300031616 | Bacteria | 1728 |
| 461 | Ga0307508_10235527 | 3300031616 | Bacteria | 1429 |
| 462 | Ga0316575_10054691 | 3300031665 | Bacteria | 1589 |
| 463 | Ga0265314_10313682 | 3300031711 | Bacteria | 875 |
| 464 | Ga0316576_10080340 | 3300031727 | Bacteria | 2418 |
| 465 | Ga0316576_10134942 | 3300031727 | Bacteria | 1857 |
| 466 | Ga0316576_10142746 | 3300031727 | Bacteria | 1803 |
| 467 | Ga0316578_10023547 | 3300031728 | Bacteria | 3446 |
| 468 | Ga0307413_10423684 | 3300031824 | Bacteria | 1049 |
| 469 | Ga0307410_10029566 | 3300031852 | Bacteria | 3491 |
| 470 | Ga0307406_10389611 | 3300031901 | Bacteria | 1101 |
| 471 | Ga0307409_100063729 | 3300031995 | Bacteria | 2892 |
| 472 | Ga0307416_100682662 | 3300032002 | Bacteria | 1115 |
| 473 | Ga0307416_100766924 | 3300032002 | Bacteria | 1058 |
| 474 | Ga0307414_10833420 | 3300032004 | Bacteria | 843 |
| 475 | Ga0307411_10005541 | 3300032005 | Bacteria | 6213 |
| 476 | Ga0307411_10143875 | 3300032005 | Bacteria | 1762 |
| 477 | Ga0307510_10000015 | 3300033180 | Bacteria | 258937 |
| 478 | Ga0373949_0149880 | 3300035090 | Bacteria | 674 |
| 479 | Ga0373951_0049530 | 3300035091 | Bacteria | 1031 |
| 480 | Ga0373936_0012855 | 3300035113 | Bacteria | 3191 |
| 481 | Ga0373962_0077850 | 3300035242 | Bacteria | 1002 |
| 482 | Ga0316574_0005865 | 3300035398 | Bacteria | 6593 |
| 483 | Ga0316574_0053238 | 3300035398 | Bacteria | 2526 |
| 484 | Ga0316574_0073603 | 3300035398 | Bacteria | 2160 |
| 485 | Ga0316574_0135596 | 3300035398 | Bacteria | 1585 |
| 486 | Ga0373931_0087545 | 3300035691 | Bacteria | 1730 |
| 487 | Ga0373931_0192299 | 3300035691 | Bacteria | 1215 |
| 488 | Ga0373931_0330814 | 3300035691 | Bacteria | 949 |
| 489 | Ga0316582_0341214 | 3300036647 | Bacteria | 1030 |
| 490 | Ga0316584_0074685 | 3300036712 | Bacteria | 2541 |
| 491 | Ga0316584_0118343 | 3300036712 | Bacteria | 1981 |
| 492 | Ga0373925_0816262 | 3300037068 | Bacteria | 769 |
| 493 | Ga0395900_0136641 | 3300037418 | Bacteria | 2512 |
| 494 | Ga0395898_0115191 | 3300037466 | Bacteria | 2575 |
| 495 | Ga0395905_1832136 | 3300037471 | Unclassified | 513 |
| 496 | Ga0436364_1369752 | 3300037853 | Bacteria | 1165 |
| 497 | Ga0436365_1779381 | 3300039437 | Bacteria | 2792 |
| 498 | Ga0436360_0420608 | 3300039438 | Bacteria | 842 |
| 499 | Ga0436363_0141791 | 3300039450 | Bacteria | 6171 |
| 500 | Ga0436363_0779673 | 3300039450 | Bacteria | 893 |
| 501 | Ga0439461_0146707 | 3300041410 | Bacteria | 607 |
| 502 | Ga0439442_044239 | 3300042002 | Bacteria | 938 |
| 503 | Ga0439457_153439 | 3300042014 | Unclassified | 555 |
| 504 | Ga0450898_119414 | 3300042134 | Bacteria | 562 |
| 505 | Ga0439444_0009016 | 3300042437 | Bacteria | 1564 |
| 506 | Ga0439464_0084597 | 3300042439 | Bacteria | 951 |
| 507 | Ga0451577_0004096 | 3300042876 | Bacteria | 15654 |
| 508 | Ga0451577_0043777 | 3300042876 | Bacteria | 4009 |
| 509 | Ga0451577_0161672 | 3300042876 | Bacteria | 2016 |
| 510 | Ga0451577_0360128 | 3300042876 | Bacteria | 1319 |
| 511 | Ga0451577_0452106 | 3300042876 | Bacteria | 1166 |
| 512 | Ga0451577_0654313 | 3300042876 | Bacteria | 953 |
| 513 | Ga0451577_1213028 | 3300042876 | Unclassified | 673 |
| 514 | Ga0466969_0077784 | 3300044656 | Bacteria | 1587 |
| 515 | Ga0466969_0299103 | 3300044656 | Bacteria | 728 |
| 516 | Ga0466972_0126124 | 3300044658 | Bacteria | 1206 |
| 517 | Ga0466965_0159623 | 3300044683 | Bacteria | 1182 |
| 518 | Ga0466966_0021523 | 3300044684 | Bacteria | 4234 |
| 519 | Ga0466966_0151508 | 3300044684 | Bacteria | 1414 |
| 520 | Ga0466966_0167799 | 3300044684 | Bacteria | 1335 |
| 521 | Ga0466966_0217036 | 3300044684 | Bacteria | 1155 |
| 522 | Ga0466961_0261051 | 3300044693 | Bacteria | 1062 |
| 523 | Ga0466964_0000478 | 3300044706 | Bacteria | 12333 |
| 524 | Ga0453684_0411613 | 3300044712 | Bacteria | 1512 |
| 525 | Ga0453684_0554213 | 3300044712 | Bacteria | 1266 |
| 526 | Ga0453684_0571964 | 3300044712 | Bacteria | 1242 |
| 527 | Ga0453684_1443869 | 3300044712 | Bacteria | 712 |
| 528 | Ga0466971_0000470 | 3300044719 | Bacteria | 15837 |
| 529 | Ga0466970_0025227 | 3300044765 | Bacteria | 3112 |
| 530 | Ga0466957_0002617 | 3300044842 | Bacteria | 9705 |
| 531 | Ga0466960_0021167 | 3300044901 | Bacteria | 2892 |
| 532 | Ga0466959_0004566 | 3300045049 | Bacteria | 9292 |
| 533 | Ga0466959_0005871 | 3300045049 | Bacteria | 8455 |
| 534 | Ga0466959_0023734 | 3300045049 | Bacteria | 4540 |
| 535 | Ga0466959_0054468 | 3300045049 | Bacteria | 2922 |
| 536 | Ga0466959_0058237 | 3300045049 | Bacteria | 2814 |
| 537 | Ga0466959_0184477 | 3300045049 | Bacteria | 1458 |
| 538 | Ga0466959_0566920 | 3300045049 | Unclassified | 765 |
| 539 | Ga0451576_0354354 | 3300045051 | Bacteria | 1536 |
| 540 | Ga0466958_0092844 | 3300045836 | Bacteria | 1869 |
| 541 | Ga0495627_000001 | 3300046453 | Bacteria | 1104709 |
| 542 | Ga0495590_0175186 | 3300046457 | Bacteria | 783 |
| 543 | Ga0495638_0000932 | 3300046460 | Bacteria | 29683 |
| 544 | Ga0495582_0683247 | 3300046473 | Bacteria | 594 |
| 545 | Ga0495606_0000449 | 3300046507 | Bacteria | 67234 |
| 546 | Ga0495606_0435619 | 3300046507 | Bacteria | 675 |
| 547 | Ga0495630_0590660 | 3300046517 | Bacteria | 851 |
| 548 | Ga0495632_0026708 | 3300046519 | Bacteria | 3035 |
| 549 | Ga0495632_0082221 | 3300046519 | Bacteria | 1535 |
| 550 | Ga0495643_0171842 | 3300046522 | Bacteria | 1059 |
| 551 | Ga0495609_0000667 | 3300046538 | Bacteria | 26626 |
| 552 | Ga0495611_0536452 | 3300046648 | Bacteria | 530 |
| 553 | Ga0495625_0003435 | 3300046660 | Bacteria | 15797 |
| 554 | Ga0495671_0022729 | 3300046692 | Bacteria | 3282 |
| 555 | Ga0495671_0582745 | 3300046692 | Bacteria | 532 |
| 556 | Ga0495649_0312938 | 3300046694 | Bacteria | 798 |
| 557 | Ga0495660_0000400 | 3300046810 | Bacteria | 37396 |
| 558 | Ga0495660_0000647 | 3300046810 | Bacteria | 27034 |
| 559 | Ga0495687_076708 | 3300047443 | Bacteria | 1322 |
| 560 | Ga0495679_069083 | 3300047446 | Bacteria | 1021 |
| 561 | Ga0495673_0082233 | 3300047469 | Unclassified | 1332 |
| 562 | Ga0495681_0127418 | 3300047470 | Bacteria | 1086 |
| 563 | Ga0495686_0669988 | 3300047472 | Bacteria | 531 |
| 564 | Ga0496101_0299771 | 3300048904 | Bacteria | 1259 |
| 565 | Ga0496102_0051798 | 3300048905 | Bacteria | 3739 |
| 566 | Ga0496102_0078502 | 3300048905 | Bacteria | 3039 |
| 567 | Ga0496102_0160941 | 3300048905 | Bacteria | 2112 |
| 568 | Ga0496102_0210917 | 3300048905 | Bacteria | 1831 |
| 569 | Ga0496103_0406641 | 3300048906 | Bacteria | 874 |
| 570 | Ga0496104_0159001 | 3300048907 | Bacteria | 2168 |
| 571 | Ga0496104_0646270 | 3300048907 | Bacteria | 967 |
| 572 | Ga0496106_0204087 | 3300048909 | Bacteria | 1574 |
| 573 | Ga0496107_0257713 | 3300048910 | Bacteria | 1298 |
| 574 | Ga0496108_0020014 | 3300048911 | Bacteria | 5499 |
| 575 | Ga0496109_0032431 | 3300048912 | Bacteria | 4696 |
| 576 | Ga0496109_0862792 | 3300048912 | Bacteria | 843 |
| 577 | Ga0496109_1455282 | 3300048912 | Bacteria | 620 |
| 578 | Ga0496110_0078250 | 3300048913 | Bacteria | 2944 |
| 579 | Ga0496112_0030321 | 3300048915 | Bacteria | 5233 |
| 580 | Ga0496113_0043951 | 3300048916 | Bacteria | 3308 |
| 581 | Ga0496115_0279494 | 3300048918 | Unclassified | 1371 |
| 582 | Ga0496115_1149903 | 3300048918 | Bacteria | 586 |
| 583 | Ga0496116_0016797 | 3300048919 | Bacteria | 5712 |
| 584 | Ga0496116_0032043 | 3300048919 | Bacteria | 3753 |
| 585 | Ga0496117_0000208 | 3300048920 | Bacteria | 113931 |
| 586 | Ga0496117_0086115 | 3300048920 | Bacteria | 2043 |
| 587 | Ga0496117_0189248 | 3300048920 | Bacteria | 1174 |
| 588 | Ga0496118_0000005 | 3300048921 | Bacteria | 697350 |
| 589 | Ga0496118_0015547 | 3300048921 | Bacteria | 7039 |
| 590 | Ga0496118_0345110 | 3300048921 | Bacteria | 796 |
| 591 | Ga0496119_0000983 | 3300048922 | Bacteria | 36653 |
| 592 | Ga0496119_0003655 | 3300048922 | Bacteria | 15792 |
| 593 | Ga0496120_0000199 | 3300048923 | Bacteria | 103142 |
| 594 | Ga0496120_0043028 | 3300048923 | Bacteria | 2634 |
| 595 | Ga0496121_0001978 | 3300048924 | Bacteria | 32561 |
| 596 | Ga0496121_0028102 | 3300048924 | Bacteria | 5244 |
| 597 | Ga0496121_0508052 | 3300048924 | Bacteria | 763 |
| 598 | Ga0496124_0104529 | 3300048927 | Bacteria | 2290 |
| 599 | Ga0496124_0379754 | 3300048927 | Bacteria | 988 |
| 600 | Ga0496125_0003265 | 3300048928 | Bacteria | 19952 |
| 601 | Ga0496125_0048773 | 3300048928 | Bacteria | 3526 |
| 602 | Ga0496125_0087137 | 3300048928 | Bacteria | 2359 |
| 603 | Ga0496126_0006026 | 3300048929 | Bacteria | 13607 |
| 604 | Ga0496126_0088648 | 3300048929 | Bacteria | 2725 |
| 605 | Ga0495678_000002 | 3300049459 | Bacteria | 999613 |
| 606 | Ga0501037_0075157 | 3300049573 | Bacteria | 2454 |
| 607 | Ga0501043_0340118 | 3300049579 | Bacteria | 1142 |
| 608 | Ga0501047_0490289 | 3300049581 | Bacteria | 1056 |
| 609 | Ga0501048_0270626 | 3300049582 | Bacteria | 1207 |
| 610 | Ga0501072_0046065 | 3300049588 | Bacteria | 3431 |
| 611 | Ga0501075_0495285 | 3300049591 | Bacteria | 932 |
| 612 | Ga0501214_006239 | 3300049659 | Bacteria | 1177 |
| 613 | Ga0501249_056265 | 3300049679 | Bacteria | 908 |
| 614 | Ga0501035_0406385 | 3300049822 | Bacteria | 1132 |
| 615 | Ga0501044_0597971 | 3300049823 | Bacteria | 996 |
| 616 | Ga0501045_0017416 | 3300049824 | Bacteria | 5101 |
| 617 | nmdc:mga05p37_119227_c1 | 3300050507 | Bacteria | 3242 |
| 618 | nmdc:mga05p37_7589_c1 | 3300050507 | Bacteria | 12794 |
| 619 | nmdc:mga09592_17903_c1 | 3300050508 | Bacteria | 5805 |
| 620 | nmdc:mga09592_97499_c1 | 3300050508 | Bacteria | 2516 |
| 621 | nmdc:mga09592_9989_c1 | 3300050508 | Bacteria | 7720 |
| 622 | nmdc:mga0qj67_1028165_c1 | 3300050509 | Unclassified | 646 |
| 623 | nmdc:mga0qj67_112863_c1 | 3300050509 | Bacteria | 2194 |
| 624 | nmdc:mga0qj67_122705_c1 | 3300050509 | Bacteria | 2102 |
| 625 | nmdc:mga0qj67_342063_c1 | 3300050509 | Bacteria | 1210 |
| 626 | nmdc:mga0qj67_3628_c1 | 3300050509 | Bacteria | 11139 |
| 627 | nmdc:mga0qj67_497912_c1 | 3300050509 | Bacteria | 980 |
| 628 | nmdc:mga0qj67_58991_c1 | 3300050509 | Bacteria | 3043 |
| 629 | nmdc:mga0qj67_6592_c1 | 3300050509 | Bacteria | 8530 |
| 630 | nmdc:mga0qj67_763115_c1 | 3300050509 | Bacteria | 767 |
| 631 | nmdc:mga06r32_1040355_c1 | 3300050510 | Bacteria | 770 |
| 632 | nmdc:mga06r32_1127223_c1 | 3300050510 | Bacteria | 733 |
| 633 | nmdc:mga06r32_1204_c1 | 3300050510 | Bacteria | 14841 |
| 634 | nmdc:mga06r32_181_c1 | 3300050510 | Bacteria | 49505 |
| 635 | nmdc:mga06r32_256658_c1 | 3300050510 | Bacteria | 1736 |
| 636 | nmdc:mga06r32_283906_c1 | 3300050510 | Bacteria | 1642 |
| 637 | nmdc:mga06r32_370_c1 | 3300050510 | Bacteria | 37940 |
| 638 | nmdc:mga06r32_5580_c1 | 3300050510 | Bacteria | 11326 |
| 639 | nmdc:mga08y16_16866_c1 | 3300050511 | Bacteria | 7689 |
| 640 | nmdc:mga08y16_204011_c1 | 3300050511 | Bacteria | 2049 |
| 641 | nmdc:mga08y16_3086_c1 | 3300050511 | Bacteria | 17228 |
| 642 | nmdc:mga0n895_416185_c1 | 3300050512 | Bacteria | 1359 |
| 643 | nmdc:mga0rr50_410930_c1 | 3300050513 | Bacteria | 1144 |
| 644 | nmdc:mga0a205_1124261_c1 | 3300050515 | Bacteria | 633 |
| 645 | nmdc:mga0a205_469497_c1 | 3300050515 | Bacteria | 1117 |
| 646 | nmdc:mga0a205_683756_c1 | 3300050515 | Bacteria | 876 |
| 647 | Ga0500644_0011984 | 3300053088 | Bacteria | 2385 |
| 648 | Ga0500583_0082219 | 3300053092 | Bacteria | 1557 |
| 649 | Ga0500583_0101567 | 3300053092 | Bacteria | 1409 |
| 650 | Ga0500583_0108738 | 3300053092 | Unclassified | 1363 |
| 651 | Ga0500583_0347530 | 3300053092 | Bacteria | 719 |
| 652 | Ga0500651_0179121 | 3300053093 | Bacteria | 1260 |
| 653 | Ga0500651_0373198 | 3300053093 | Bacteria | 806 |
| 654 | Ga0500641_0014877 | 3300053096 | Bacteria | 2877 |
| 655 | Ga0500556_0070350 | 3300053104 | Bacteria | 1306 |
| 656 | Ga0500562_063693 | 3300053108 | Bacteria | 992 |
| 657 | Ga0500562_077323 | 3300053108 | Bacteria | 900 |
| 658 | Ga0500591_063212 | 3300053115 | Bacteria | 1700 |
| 659 | Ga0500594_0177865 | 3300053118 | Bacteria | 693 |
| 660 | Ga0500617_033350 | 3300053124 | Bacteria | 2306 |
| 661 | Ga0500642_0066447 | 3300053130 | Bacteria | 1632 |
| 662 | Ga0500642_0259738 | 3300053130 | Bacteria | 795 |
| 663 | Ga0500652_067352 | 3300053131 | Bacteria | 1480 |
| 664 | Ga0500652_118413 | 3300053131 | Bacteria | 1107 |
| 665 | Ga0500655_023346 | 3300053133 | Bacteria | 1168 |
| 666 | Ga0500658_0048482 | 3300053134 | Unclassified | 1727 |
| 667 | Ga0500658_0092238 | 3300053134 | Bacteria | 1311 |
| 668 | Ga0500568_0041422 | 3300053139 | Bacteria | 1850 |
| 669 | Ga0500577_0297902 | 3300053142 | Bacteria | 704 |
| 670 | Ga0500588_0006679 | 3300053146 | Bacteria | 2627 |
| 671 | Ga0500590_170219 | 3300053148 | Bacteria | 959 |
| 672 | Ga0500622_0035953 | 3300053156 | Bacteria | 2590 |
| 673 | Ga0500627_0244881 | 3300053158 | Bacteria | 795 |
| 674 | Ga0500627_0383132 | 3300053158 | Bacteria | 602 |
| 675 | Ga0500637_0008894 | 3300053178 | Bacteria | 5089 |
| 676 | Ga0500637_0021154 | 3300053178 | Bacteria | 3532 |
| 677 | Ga0500637_0025197 | 3300053178 | Bacteria | 3266 |
| 678 | Ga0500637_0080013 | 3300053178 | Bacteria | 1887 |
| 679 | Ga0500596_025439 | 3300053735 | Bacteria | 903 |
| 680 | Ga0501082_0117803 | 3300060353 | Bacteria | 2301 |
| 681 | Ga0466962_0008334 | 3300061719 | Bacteria | 4966 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2857553236 | 2857555184 | 147 |
| 2 | iso_pu_bacteria | 2919476304 | 2919477532 | 147 |
| 3 | 3300006946 | Ga0079104_1027601 | Ga0079104_10276012 | 151 |
| 4 | 3300015261 | Ga0182006_1000008 | Ga0182006_1000008199 | 151 |
| 5 | 3300015265 | Ga0182005_1000008 | Ga0182005_1000008398 | 151 |
| 6 | 3300027111 | Ga0209281_1010131 | Ga0209281_10101312 | 151 |
| 7 | 3300035398 | Ga0316574_0135596 | Ga0316574_0135596_621_1076 | 151 |
| 8 | 3300042876 | Ga0451577_0043777 | Ga0451577_0043777_1995_2450 | 151 |
| 9 | 3300046453 | Ga0495627_000001 | Ga0495627_000001_405574_406032 | 151 |
| 10 | 3300046507 | Ga0495606_0000449 | Ga0495606_0000449_14901_15359 | 151 |
| 11 | 3300046538 | Ga0495609_0000667 | Ga0495609_0000667_20479_20937 | 151 |
| 12 | 3300046810 | Ga0495660_0000400 | Ga0495660_0000400_20538_20996 | 151 |
| 13 | 3300046810 | Ga0495660_0000647 | Ga0495660_0000647_5212_5670 | 151 |
| 14 | 3300047446 | Ga0495679_069083 | Ga0495679_069083_407_865 | 151 |
| 15 | 3300047470 | Ga0495681_0127418 | Ga0495681_0127418_613_1071 | 151 |
| 16 | 3300048919 | Ga0496116_0016797 | Ga0496116_0016797_719_1177 | 151 |
| 17 | 3300048927 | Ga0496124_0104529 | Ga0496124_0104529_1188_1646 | 151 |
| 18 | 3300049459 | Ga0495678_000002 | Ga0495678_000002_103962_104420 | 151 |
| 19 | 3300005937 | Ga0081455_10000016 | Ga0081455_1000001623 | 152 |
| 20 | 3300005985 | Ga0081539_10000060 | Ga0081539_1000006074 | 152 |
| 21 | 3300009553 | Ga0105249_10106648 | Ga0105249_101066483 | 152 |
| 22 | 3300009553 | Ga0105249_10799456 | Ga0105249_107994562 | 152 |
| 23 | 3300025961 | Ga0207712_10082802 | Ga0207712_100828023 | 152 |
| 24 | 3300028794 | Ga0307515_10254863 | Ga0307515_102548632 | 152 |
| 25 | 3300031507 | Ga0307509_10384335 | Ga0307509_103843352 | 152 |
| 26 | 3300044658 | Ga0466972_0126124 | Ga0466972_0126124_232_690 | 152 |
| 27 | 3300044683 | Ga0466965_0159623 | Ga0466965_0159623_313_771 | 152 |
| 28 | 3300044901 | Ga0466960_0021167 | Ga0466960_0021167_190_648 | 152 |
| 29 | 3300049573 | Ga0501037_0075157 | Ga0501037_0075157_298_816 | 152 |
| 30 | 3300049581 | Ga0501047_0490289 | Ga0501047_0490289_152_610 | 152 |
| 31 | 3300049822 | Ga0501035_0406385 | Ga0501035_0406385_422_940 | 152 |
| 32 | 3300049823 | Ga0501044_0597971 | Ga0501044_0597971_180_698 | 152 |
| 33 | 3300053092 | Ga0500583_0082219 | Ga0500583_0082219_145_603 | 152 |
| 34 | 3300053108 | Ga0500562_077323 | Ga0500562_077323_134_592 | 152 |
| 35 | 3300053130 | Ga0500642_0259738 | Ga0500642_0259738_247_705 | 152 |
| 36 | 3300053134 | Ga0500658_0092238 | Ga0500658_0092238_842_1300 | 152 |
| 37 | 3300053142 | Ga0500577_0297902 | Ga0500577_0297902_203_661 | 152 |
| 38 | 3300053158 | Ga0500627_0383132 | Ga0500627_0383132_86_544 | 152 |
| 39 | 3300003316 | rootH1_10045185 | rootH1_100451855 | 153 |
| 40 | 3300003323 | rootH1_10000183 | rootH1_100001832 | 153 |
| 41 | 3300003323 | rootH1_10027822 | rootH1_100278222 | 153 |
| 42 | 3300005293 | Ga0065715_10130591 | Ga0065715_101305913 | 153 |
| 43 | 3300005295 | Ga0065707_10082632 | Ga0065707_100826324 | 153 |
| 44 | 3300005295 | Ga0065707_10098644 | Ga0065707_100986444 | 153 |
| 45 | 3300005327 | Ga0070658_10157495 | Ga0070658_101574953 | 153 |
| 46 | 3300005328 | Ga0070676_10155833 | Ga0070676_101558332 | 153 |
| 47 | 3300005330 | Ga0070690_100015129 | Ga0070690_1000151293 | 153 |
| 48 | 3300005331 | Ga0070670_100035627 | Ga0070670_1000356272 | 153 |
| 49 | 3300005331 | Ga0070670_100508339 | Ga0070670_1005083392 | 153 |
| 50 | 3300005334 | Ga0068869_100008053 | Ga0068869_1000080536 | 153 |
| 51 | 3300005335 | Ga0070666_10025693 | Ga0070666_100256934 | 153 |
| 52 | 3300005335 | Ga0070666_10085450 | Ga0070666_100854502 | 153 |
| 53 | 3300005336 | Ga0070680_100039302 | Ga0070680_1000393024 | 153 |
| 54 | 3300005336 | Ga0070680_100040752 | Ga0070680_1000407524 | 153 |
| 55 | 3300005336 | Ga0070680_100077678 | Ga0070680_1000776781 | 153 |
| 56 | 3300005336 | Ga0070680_100336615 | Ga0070680_1003366152 | 153 |
| 57 | 3300005337 | Ga0070682_100612757 | Ga0070682_1006127572 | 153 |
| 58 | 3300005337 | Ga0070682_101365767 | Ga0070682_1013657671 | 153 |
| 59 | 3300005340 | Ga0070689_100011375 | Ga0070689_1000113754 | 153 |
| 60 | 3300005344 | Ga0070661_100017056 | Ga0070661_1000170564 | 153 |
| 61 | 3300005344 | Ga0070661_100164259 | Ga0070661_1001642592 | 153 |
| 62 | 3300005344 | Ga0070661_100424054 | Ga0070661_1004240542 | 153 |
| 63 | 3300005345 | Ga0070692_10406471 | Ga0070692_104064712 | 153 |
| 64 | 3300005347 | Ga0070668_100019556 | Ga0070668_1000195566 | 153 |
| 65 | 3300005353 | Ga0070669_100091784 | Ga0070669_1000917841 | 153 |
| 66 | 3300005353 | Ga0070669_100234107 | Ga0070669_1002341071 | 153 |
| 67 | 3300005354 | Ga0070675_100003796 | Ga0070675_1000037962 | 153 |
| 68 | 3300005355 | Ga0070671_100054617 | Ga0070671_1000546173 | 153 |
| 69 | 3300005355 | Ga0070671_100210386 | Ga0070671_1002103862 | 153 |
| 70 | 3300005364 | Ga0070673_100052109 | Ga0070673_1000521092 | 153 |
| 71 | 3300005366 | Ga0070659_100162435 | Ga0070659_1001624352 | 153 |
| 72 | 3300005366 | Ga0070659_100377181 | Ga0070659_1003771812 | 153 |
| 73 | 3300005366 | Ga0070659_101091248 | Ga0070659_1010912481 | 153 |
| 74 | 3300005367 | Ga0070667_100000455 | Ga0070667_10000045518 | 153 |
| 75 | 3300005367 | Ga0070667_100013238 | Ga0070667_1000132383 | 153 |
| 76 | 3300005367 | Ga0070667_100621768 | Ga0070667_1006217681 | 153 |
| 77 | 3300005367 | Ga0070667_100880119 | Ga0070667_1008801191 | 153 |
| 78 | 3300005367 | Ga0070667_101072832 | Ga0070667_1010728321 | 153 |
| 79 | 3300005435 | Ga0070714_100710481 | Ga0070714_1007104811 | 153 |
| 80 | 3300005436 | Ga0070713_100258185 | Ga0070713_1002581852 | 153 |
| 81 | 3300005436 | Ga0070713_100439207 | Ga0070713_1004392072 | 153 |
| 82 | 3300005436 | Ga0070713_100497601 | Ga0070713_1004976011 | 153 |
| 83 | 3300005440 | Ga0070705_100063385 | Ga0070705_1000633852 | 153 |
| 84 | 3300005441 | Ga0070700_100028515 | Ga0070700_1000285152 | 153 |
| 85 | 3300005444 | Ga0070694_100189919 | Ga0070694_1001899192 | 153 |
| 86 | 3300005455 | Ga0070663_100023055 | Ga0070663_1000230553 | 153 |
| 87 | 3300005455 | Ga0070663_100314762 | Ga0070663_1003147622 | 153 |
| 88 | 3300005456 | Ga0070678_100060782 | Ga0070678_1000607822 | 153 |
| 89 | 3300005457 | Ga0070662_100020915 | Ga0070662_1000209154 | 153 |
| 90 | 3300005457 | Ga0070662_100066597 | Ga0070662_1000665973 | 153 |
| 91 | 3300005458 | Ga0070681_10009271 | Ga0070681_100092718 | 153 |
| 92 | 3300005458 | Ga0070681_10042578 | Ga0070681_100425785 | 153 |
| 93 | 3300005458 | Ga0070681_10043940 | Ga0070681_100439402 | 153 |
| 94 | 3300005458 | Ga0070681_10045191 | Ga0070681_100451912 | 153 |
| 95 | 3300005458 | Ga0070681_10182794 | Ga0070681_101827942 | 153 |
| 96 | 3300005458 | Ga0070681_11331870 | Ga0070681_113318701 | 153 |
| 97 | 3300005459 | Ga0068867_100024408 | Ga0068867_1000244084 | 153 |
| 98 | 3300005466 | Ga0070685_10019662 | Ga0070685_100196623 | 153 |
| 99 | 3300005467 | Ga0070706_100481873 | Ga0070706_1004818732 | 153 |
| 100 | 3300005467 | Ga0070706_101576335 | Ga0070706_1015763351 | 153 |
| 101 | 3300005530 | Ga0070679_100055650 | Ga0070679_1000556502 | 153 |
| 102 | 3300005530 | Ga0070679_100089032 | Ga0070679_1000890322 | 153 |
| 103 | 3300005530 | Ga0070679_100243831 | Ga0070679_1002438312 | 153 |
| 104 | 3300005530 | Ga0070679_100243929 | Ga0070679_1002439292 | 153 |
| 105 | 3300005530 | Ga0070679_100414505 | Ga0070679_1004145052 | 153 |
| 106 | 3300005535 | Ga0070684_100027241 | Ga0070684_1000272414 | 153 |
| 107 | 3300005535 | Ga0070684_100047998 | Ga0070684_1000479984 | 153 |
| 108 | 3300005535 | Ga0070684_100541448 | Ga0070684_1005414482 | 153 |
| 109 | 3300005539 | Ga0068853_100157804 | Ga0068853_1001578042 | 153 |
| 110 | 3300005539 | Ga0068853_101761120 | Ga0068853_1017611201 | 153 |
| 111 | 3300005543 | Ga0070672_100011242 | Ga0070672_1000112426 | 153 |
| 112 | 3300005544 | Ga0070686_100026177 | Ga0070686_1000261772 | 153 |
| 113 | 3300005544 | Ga0070686_100089977 | Ga0070686_1000899773 | 153 |
| 114 | 3300005547 | Ga0070693_100259511 | Ga0070693_1002595111 | 153 |
| 115 | 3300005547 | Ga0070693_100521083 | Ga0070693_1005210831 | 153 |
| 116 | 3300005548 | Ga0070665_100008225 | Ga0070665_1000082254 | 153 |
| 117 | 3300005548 | Ga0070665_100019892 | Ga0070665_1000198923 | 153 |
| 118 | 3300005548 | Ga0070665_100056754 | Ga0070665_1000567542 | 153 |
| 119 | 3300005548 | Ga0070665_100239051 | Ga0070665_1002390513 | 153 |
| 120 | 3300005548 | Ga0070665_100401891 | Ga0070665_1004018912 | 153 |
| 121 | 3300005549 | Ga0070704_101569885 | Ga0070704_1015698851 | 153 |
| 122 | 3300005563 | Ga0068855_100001597 | Ga0068855_10000159713 | 153 |
| 123 | 3300005563 | Ga0068855_100008729 | Ga0068855_1000087298 | 153 |
| 124 | 3300005563 | Ga0068855_100205149 | Ga0068855_1002051493 | 153 |
| 125 | 3300005563 | Ga0068855_100923035 | Ga0068855_1009230351 | 153 |
| 126 | 3300005564 | Ga0070664_100181294 | Ga0070664_1001812942 | 153 |
| 127 | 3300005577 | Ga0068857_100012011 | Ga0068857_1000120111 | 153 |
| 128 | 3300005577 | Ga0068857_100125916 | Ga0068857_1001259163 | 153 |
| 129 | 3300005577 | Ga0068857_100555750 | Ga0068857_1005557501 | 153 |
| 130 | 3300005578 | Ga0068854_100198195 | Ga0068854_1001981952 | 153 |
| 131 | 3300005614 | Ga0068856_100104027 | Ga0068856_1001040273 | 153 |
| 132 | 3300005615 | Ga0070702_100004325 | Ga0070702_1000043252 | 153 |
| 133 | 3300005616 | Ga0068852_100833159 | Ga0068852_1008331592 | 153 |
| 134 | 3300005616 | Ga0068852_101110060 | Ga0068852_1011100601 | 153 |
| 135 | 3300005617 | Ga0068859_100000092 | Ga0068859_10000009232 | 153 |
| 136 | 3300005617 | Ga0068859_100001034 | Ga0068859_1000010346 | 153 |
| 137 | 3300005617 | Ga0068859_100034199 | Ga0068859_1000341992 | 153 |
| 138 | 3300005618 | Ga0068864_100053523 | Ga0068864_1000535232 | 153 |
| 139 | 3300005618 | Ga0068864_100634669 | Ga0068864_1006346692 | 153 |
| 140 | 3300005718 | Ga0068866_10009522 | Ga0068866_100095226 | 153 |
| 141 | 3300005718 | Ga0068866_10067119 | Ga0068866_100671192 | 153 |
| 142 | 3300005719 | Ga0068861_100000011 | Ga0068861_10000001174 | 153 |
| 143 | 3300005719 | Ga0068861_100035493 | Ga0068861_1000354932 | 153 |
| 144 | 3300005834 | Ga0068851_10085808 | Ga0068851_100858083 | 153 |
| 145 | 3300005840 | Ga0068870_10053832 | Ga0068870_100538322 | 153 |
| 146 | 3300005840 | Ga0068870_10196986 | Ga0068870_101969862 | 153 |
| 147 | 3300005841 | Ga0068863_100009047 | Ga0068863_1000090478 | 153 |
| 148 | 3300005841 | Ga0068863_100014747 | Ga0068863_1000147476 | 153 |
| 149 | 3300005841 | Ga0068863_100023640 | Ga0068863_1000236408 | 153 |
| 150 | 3300005841 | Ga0068863_100207876 | Ga0068863_1002078762 | 153 |
| 151 | 3300005842 | Ga0068858_100006868 | Ga0068858_10000686810 | 153 |
| 152 | 3300005842 | Ga0068858_100007426 | Ga0068858_1000074269 | 153 |
| 153 | 3300005842 | Ga0068858_100082830 | Ga0068858_1000828304 | 153 |
| 154 | 3300005843 | Ga0068860_100004269 | Ga0068860_1000042696 | 153 |
| 155 | 3300005843 | Ga0068860_100045523 | Ga0068860_1000455237 | 153 |
| 156 | 3300005843 | Ga0068860_101002359 | Ga0068860_1010023591 | 153 |
| 157 | 3300005844 | Ga0068862_100000888 | Ga0068862_1000008887 | 153 |
| 158 | 3300005844 | Ga0068862_100002301 | Ga0068862_10000230113 | 153 |
| 159 | 3300005844 | Ga0068862_100013400 | Ga0068862_10001340010 | 153 |
| 160 | 3300005844 | Ga0068862_101478416 | Ga0068862_1014784162 | 153 |
| 161 | 3300006173 | Ga0070716_100164797 | Ga0070716_1001647972 | 153 |
| 162 | 3300006175 | Ga0070712_100215381 | Ga0070712_1002153812 | 153 |
| 163 | 3300006175 | Ga0070712_100797251 | Ga0070712_1007972511 | 153 |
| 164 | 3300006237 | Ga0097621_100331903 | Ga0097621_1003319032 | 153 |
| 165 | 3300006237 | Ga0097621_101006599 | Ga0097621_1010065991 | 153 |
| 166 | 3300006358 | Ga0068871_100401767 | Ga0068871_1004017672 | 153 |
| 167 | 3300006358 | Ga0068871_100991522 | Ga0068871_1009915222 | 153 |
| 168 | 3300006844 | Ga0075428_100000063 | Ga0075428_10000006354 | 153 |
| 169 | 3300006844 | Ga0075428_100010087 | Ga0075428_1000100878 | 153 |
| 170 | 3300006844 | Ga0075428_100011126 | Ga0075428_1000111265 | 153 |
| 171 | 3300006846 | Ga0075430_100007097 | Ga0075430_10000709711 | 153 |
| 172 | 3300006846 | Ga0075430_100008776 | Ga0075430_1000087767 | 153 |
| 173 | 3300006846 | Ga0075430_100053377 | Ga0075430_1000533772 | 153 |
| 174 | 3300006846 | Ga0075430_100360402 | Ga0075430_1003604022 | 153 |
| 175 | 3300006846 | Ga0075430_100447589 | Ga0075430_1004475891 | 153 |
| 176 | 3300006846 | Ga0075430_100459386 | Ga0075430_1004593862 | 153 |
| 177 | 3300006847 | Ga0075431_100000298 | Ga0075431_10000029811 | 153 |
| 178 | 3300006847 | Ga0075431_100003650 | Ga0075431_10000365014 | 153 |
| 179 | 3300006847 | Ga0075431_100007451 | Ga0075431_10000745112 | 153 |
| 180 | 3300006847 | Ga0075431_100089184 | Ga0075431_1000891842 | 153 |
| 181 | 3300006847 | Ga0075431_100179092 | Ga0075431_1001790923 | 153 |
| 182 | 3300006880 | Ga0075429_100005716 | Ga0075429_1000057164 | 153 |
| 183 | 3300006880 | Ga0075429_100016693 | Ga0075429_1000166932 | 153 |
| 184 | 3300006880 | Ga0075429_100096222 | Ga0075429_1000962222 | 153 |
| 185 | 3300006880 | Ga0075429_100251907 | Ga0075429_1002519072 | 153 |
| 186 | 3300006931 | Ga0097620_100000092 | Ga0097620_10000009232 | 153 |
| 187 | 3300006931 | Ga0097620_100001034 | Ga0097620_1000010346 | 153 |
| 188 | 3300006931 | Ga0097620_100034199 | Ga0097620_1000341992 | 153 |
| 189 | 3300007265 | Ga0099794_10220632 | Ga0099794_102206322 | 153 |
| 190 | 3300007788 | Ga0099795_10008188 | Ga0099795_100081882 | 153 |
| 191 | 3300009092 | Ga0105250_10000031 | Ga0105250_10000031109 | 153 |
| 192 | 3300009092 | Ga0105250_10005907 | Ga0105250_100059073 | 153 |
| 193 | 3300009092 | Ga0105250_10037645 | Ga0105250_100376452 | 153 |
| 194 | 3300009092 | Ga0105250_10143792 | Ga0105250_101437922 | 153 |
| 195 | 3300009093 | Ga0105240_10001742 | Ga0105240_1000174212 | 153 |
| 196 | 3300009093 | Ga0105240_10016076 | Ga0105240_1001607610 | 153 |
| 197 | 3300009093 | Ga0105240_10022235 | Ga0105240_100222352 | 153 |
| 198 | 3300009093 | Ga0105240_10034991 | Ga0105240_100349916 | 153 |
| 199 | 3300009093 | Ga0105240_10051007 | Ga0105240_100510073 | 153 |
| 200 | 3300009093 | Ga0105240_10080442 | Ga0105240_100804422 | 153 |
| 201 | 3300009093 | Ga0105240_10164811 | Ga0105240_101648114 | 153 |
| 202 | 3300009093 | Ga0105240_10332079 | Ga0105240_103320792 | 153 |
| 203 | 3300009093 | Ga0105240_10339259 | Ga0105240_103392592 | 153 |
| 204 | 3300009094 | Ga0111539_10000428 | Ga0111539_1000042835 | 153 |
| 205 | 3300009094 | Ga0111539_10010330 | Ga0111539_100103302 | 153 |
| 206 | 3300009094 | Ga0111539_10032635 | Ga0111539_100326352 | 153 |
| 207 | 3300009094 | Ga0111539_10078027 | Ga0111539_100780275 | 153 |
| 208 | 3300009098 | Ga0105245_10568061 | Ga0105245_105680612 | 153 |
| 209 | 3300009101 | Ga0105247_10000482 | Ga0105247_100004827 | 153 |
| 210 | 3300009101 | Ga0105247_10007371 | Ga0105247_100073715 | 153 |
| 211 | 3300009101 | Ga0105247_10150790 | Ga0105247_101507902 | 153 |
| 212 | 3300009147 | Ga0114129_10007442 | Ga0114129_1000744211 | 153 |
| 213 | 3300009147 | Ga0114129_10145822 | Ga0114129_101458222 | 153 |
| 214 | 3300009148 | Ga0105243_12343055 | Ga0105243_123430551 | 153 |
| 215 | 3300009174 | Ga0105241_10019394 | Ga0105241_100193946 | 153 |
| 216 | 3300009174 | Ga0105241_10336679 | Ga0105241_103366792 | 153 |
| 217 | 3300009174 | Ga0105241_10751493 | Ga0105241_107514932 | 153 |
| 218 | 3300009174 | Ga0105241_10829127 | Ga0105241_108291272 | 153 |
| 219 | 3300009174 | Ga0105241_11158045 | Ga0105241_111580452 | 153 |
| 220 | 3300009176 | Ga0105242_10074774 | Ga0105242_100747741 | 153 |
| 221 | 3300009177 | Ga0105248_10005260 | Ga0105248_1000526011 | 153 |
| 222 | 3300009177 | Ga0105248_10033557 | Ga0105248_100335574 | 153 |
| 223 | 3300009177 | Ga0105248_10088707 | Ga0105248_100887075 | 153 |
| 224 | 3300009545 | Ga0105237_10042229 | Ga0105237_100422295 | 153 |
| 225 | 3300009545 | Ga0105237_10100121 | Ga0105237_101001214 | 153 |
| 226 | 3300009545 | Ga0105237_10331497 | Ga0105237_103314972 | 153 |
| 227 | 3300009545 | Ga0105237_10481995 | Ga0105237_104819952 | 153 |
| 228 | 3300009545 | Ga0105237_10762756 | Ga0105237_107627562 | 153 |
| 229 | 3300009545 | Ga0105237_10834266 | Ga0105237_108342662 | 153 |
| 230 | 3300009545 | Ga0105237_11554545 | Ga0105237_115545451 | 153 |
| 231 | 3300009551 | Ga0105238_10047524 | Ga0105238_100475242 | 153 |
| 232 | 3300009551 | Ga0105238_10052665 | Ga0105238_100526653 | 153 |
| 233 | 3300009551 | Ga0105238_10079682 | Ga0105238_100796823 | 153 |
| 234 | 3300009551 | Ga0105238_10156877 | Ga0105238_101568773 | 153 |
| 235 | 3300009551 | Ga0105238_10415384 | Ga0105238_104153842 | 153 |
| 236 | 3300009551 | Ga0105238_11649597 | Ga0105238_116495971 | 153 |
| 237 | 3300009551 | Ga0105238_12434992 | Ga0105238_124349921 | 153 |
| 238 | 3300009553 | Ga0105249_10008115 | Ga0105249_100081156 | 153 |
| 239 | 3300009553 | Ga0105249_10073625 | Ga0105249_100736253 | 153 |
| 240 | 3300009553 | Ga0105249_10084364 | Ga0105249_100843642 | 153 |
| 241 | 3300009553 | Ga0105249_10289876 | Ga0105249_102898762 | 153 |
| 242 | 3300009553 | Ga0105249_10400818 | Ga0105249_104008182 | 153 |
| 243 | 3300010159 | Ga0099796_10021732 | Ga0099796_100217322 | 153 |
| 244 | 3300010375 | Ga0105239_10146473 | Ga0105239_101464734 | 153 |
| 245 | 3300010375 | Ga0105239_10573183 | Ga0105239_105731832 | 153 |
| 246 | 3300010375 | Ga0105239_11521453 | Ga0105239_115214531 | 153 |
| 247 | 3300011119 | Ga0105246_10084901 | Ga0105246_100849012 | 153 |
| 248 | 3300011119 | Ga0105246_10195242 | Ga0105246_101952421 | 153 |
| 249 | 3300011119 | Ga0105246_10905409 | Ga0105246_109054091 | 153 |
| 250 | 3300013105 | Ga0157369_10023283 | Ga0157369_100232836 | 153 |
| 251 | 3300013105 | Ga0157369_10096890 | Ga0157369_100968903 | 153 |
| 252 | 3300013105 | Ga0157369_10627881 | Ga0157369_106278812 | 153 |
| 253 | 3300013105 | Ga0157369_10883122 | Ga0157369_108831222 | 153 |
| 254 | 3300013296 | Ga0157374_10038537 | Ga0157374_100385374 | 153 |
| 255 | 3300013296 | Ga0157374_10577519 | Ga0157374_105775192 | 153 |
| 256 | 3300013297 | Ga0157378_10813997 | Ga0157378_108139972 | 153 |
| 257 | 3300013306 | Ga0163162_10114758 | Ga0163162_101147582 | 153 |
| 258 | 3300013306 | Ga0163162_10122167 | Ga0163162_101221673 | 153 |
| 259 | 3300013306 | Ga0163162_10646610 | Ga0163162_106466102 | 153 |
| 260 | 3300013306 | Ga0163162_10857284 | Ga0163162_108572841 | 153 |
| 261 | 3300013307 | Ga0157372_10158176 | Ga0157372_101581763 | 153 |
| 262 | 3300013307 | Ga0157372_10348192 | Ga0157372_103481922 | 153 |
| 263 | 3300013307 | Ga0157372_10400366 | Ga0157372_104003662 | 153 |
| 264 | 3300013307 | Ga0157372_10767954 | Ga0157372_107679542 | 153 |
| 265 | 3300013307 | Ga0157372_10824616 | Ga0157372_108246162 | 153 |
| 266 | 3300013307 | Ga0157372_12149748 | Ga0157372_121497481 | 153 |
| 267 | 3300013308 | Ga0157375_10055528 | Ga0157375_100555284 | 153 |
| 268 | 3300014325 | Ga0163163_10030495 | Ga0163163_100304953 | 153 |
| 269 | 3300014325 | Ga0163163_10051897 | Ga0163163_100518973 | 153 |
| 270 | 3300014325 | Ga0163163_10095081 | Ga0163163_100950812 | 153 |
| 271 | 3300014325 | Ga0163163_10119562 | Ga0163163_101195622 | 153 |
| 272 | 3300014325 | Ga0163163_11748340 | Ga0163163_117483401 | 153 |
| 273 | 3300014326 | Ga0157380_10017020 | Ga0157380_100170205 | 153 |
| 274 | 3300014326 | Ga0157380_10407320 | Ga0157380_104073202 | 153 |
| 275 | 3300014745 | Ga0157377_10012711 | Ga0157377_100127114 | 153 |
| 276 | 3300014968 | Ga0157379_10018854 | Ga0157379_100188544 | 153 |
| 277 | 3300014968 | Ga0157379_10137671 | Ga0157379_101376713 | 153 |
| 278 | 3300014968 | Ga0157379_10145998 | Ga0157379_101459982 | 153 |
| 279 | 3300014968 | Ga0157379_10394009 | Ga0157379_103940092 | 153 |
| 280 | 3300014968 | Ga0157379_10544970 | Ga0157379_105449702 | 153 |
| 281 | 3300014968 | Ga0157379_10903876 | Ga0157379_109038762 | 153 |
| 282 | 3300014969 | Ga0157376_10369143 | Ga0157376_103691432 | 153 |
| 283 | 3300014969 | Ga0157376_12229098 | Ga0157376_122290981 | 153 |
| 284 | 3300017792 | Ga0163161_10301543 | Ga0163161_103015432 | 153 |
| 285 | 3300017792 | Ga0163161_11313276 | Ga0163161_113132761 | 153 |
| 286 | 3300021384 | Ga0213876_10143292 | Ga0213876_101432922 | 153 |
| 287 | 3300025321 | Ga0207656_10096370 | Ga0207656_100963702 | 153 |
| 288 | 3300025711 | Ga0207696_1000125 | Ga0207696_100012575 | 153 |
| 289 | 3300025898 | Ga0207692_10224286 | Ga0207692_102242862 | 153 |
| 290 | 3300025899 | Ga0207642_10037517 | Ga0207642_100375172 | 153 |
| 291 | 3300025900 | Ga0207710_10000962 | Ga0207710_100009622 | 153 |
| 292 | 3300025900 | Ga0207710_10112003 | Ga0207710_101120032 | 153 |
| 293 | 3300025901 | Ga0207688_10028551 | Ga0207688_100285514 | 153 |
| 294 | 3300025903 | Ga0207680_10044294 | Ga0207680_100442942 | 153 |
| 295 | 3300025903 | Ga0207680_10061639 | Ga0207680_100616392 | 153 |
| 296 | 3300025903 | Ga0207680_10263133 | Ga0207680_102631332 | 153 |
| 297 | 3300025903 | Ga0207680_10486494 | Ga0207680_104864942 | 153 |
| 298 | 3300025904 | Ga0207647_10043235 | Ga0207647_100432352 | 153 |
| 299 | 3300025907 | Ga0207645_10195195 | Ga0207645_101951952 | 153 |
| 300 | 3300025908 | Ga0207643_10016609 | Ga0207643_100166093 | 153 |
| 301 | 3300025908 | Ga0207643_10171636 | Ga0207643_101716362 | 153 |
| 302 | 3300025910 | Ga0207684_10302649 | Ga0207684_103026492 | 153 |
| 303 | 3300025911 | Ga0207654_10440789 | Ga0207654_104407892 | 153 |
| 304 | 3300025912 | Ga0207707_10008529 | Ga0207707_100085294 | 153 |
| 305 | 3300025912 | Ga0207707_10019302 | Ga0207707_100193026 | 153 |
| 306 | 3300025912 | Ga0207707_10021313 | Ga0207707_100213136 | 153 |
| 307 | 3300025912 | Ga0207707_10159707 | Ga0207707_101597072 | 153 |
| 308 | 3300025912 | Ga0207707_10247068 | Ga0207707_102470682 | 153 |
| 309 | 3300025913 | Ga0207695_10020298 | Ga0207695_100202984 | 153 |
| 310 | 3300025913 | Ga0207695_10028556 | Ga0207695_100285562 | 153 |
| 311 | 3300025913 | Ga0207695_10083370 | Ga0207695_100833703 | 153 |
| 312 | 3300025913 | Ga0207695_10096811 | Ga0207695_100968112 | 153 |
| 313 | 3300025913 | Ga0207695_10109548 | Ga0207695_101095483 | 153 |
| 314 | 3300025913 | Ga0207695_10118721 | Ga0207695_101187212 | 153 |
| 315 | 3300025913 | Ga0207695_10349777 | Ga0207695_103497772 | 153 |
| 316 | 3300025913 | Ga0207695_10414347 | Ga0207695_104143471 | 153 |
| 317 | 3300025913 | Ga0207695_10534362 | Ga0207695_105343622 | 153 |
| 318 | 3300025914 | Ga0207671_10522893 | Ga0207671_105228931 | 153 |
| 319 | 3300025914 | Ga0207671_10912553 | Ga0207671_109125531 | 153 |
| 320 | 3300025915 | Ga0207693_10123844 | Ga0207693_101238442 | 153 |
| 321 | 3300025917 | Ga0207660_10133523 | Ga0207660_101335232 | 153 |
| 322 | 3300025917 | Ga0207660_10219013 | Ga0207660_102190132 | 153 |
| 323 | 3300025917 | Ga0207660_10250308 | Ga0207660_102503081 | 153 |
| 324 | 3300025917 | Ga0207660_10349558 | Ga0207660_103495582 | 153 |
| 325 | 3300025917 | Ga0207660_10880834 | Ga0207660_108808341 | 153 |
| 326 | 3300025918 | Ga0207662_10019026 | Ga0207662_100190263 | 153 |
| 327 | 3300025920 | Ga0207649_10014316 | Ga0207649_100143164 | 153 |
| 328 | 3300025920 | Ga0207649_10252338 | Ga0207649_102523381 | 153 |
| 329 | 3300025921 | Ga0207652_10112524 | Ga0207652_101125242 | 153 |
| 330 | 3300025921 | Ga0207652_10143680 | Ga0207652_101436802 | 153 |
| 331 | 3300025921 | Ga0207652_10211692 | Ga0207652_102116922 | 153 |
| 332 | 3300025921 | Ga0207652_10303953 | Ga0207652_103039532 | 153 |
| 333 | 3300025923 | Ga0207681_10018138 | Ga0207681_100181383 | 153 |
| 334 | 3300025923 | Ga0207681_10019833 | Ga0207681_100198332 | 153 |
| 335 | 3300025924 | Ga0207694_10131129 | Ga0207694_101311291 | 153 |
| 336 | 3300025924 | Ga0207694_10190755 | Ga0207694_101907552 | 153 |
| 337 | 3300025924 | Ga0207694_10292770 | Ga0207694_102927702 | 153 |
| 338 | 3300025924 | Ga0207694_10494295 | Ga0207694_104942952 | 153 |
| 339 | 3300025924 | Ga0207694_10542591 | Ga0207694_105425911 | 153 |
| 340 | 3300025924 | Ga0207694_10656072 | Ga0207694_106560721 | 153 |
| 341 | 3300025925 | Ga0207650_10196792 | Ga0207650_101967922 | 153 |
| 342 | 3300025925 | Ga0207650_10469008 | Ga0207650_104690082 | 153 |
| 343 | 3300025928 | Ga0207700_10071177 | Ga0207700_100711772 | 153 |
| 344 | 3300025928 | Ga0207700_10195251 | Ga0207700_101952512 | 153 |
| 345 | 3300025928 | Ga0207700_11022037 | Ga0207700_110220371 | 153 |
| 346 | 3300025931 | Ga0207644_10000849 | Ga0207644_1000084922 | 153 |
| 347 | 3300025931 | Ga0207644_10070751 | Ga0207644_100707512 | 153 |
| 348 | 3300025932 | Ga0207690_10262869 | Ga0207690_102628692 | 153 |
| 349 | 3300025932 | Ga0207690_10314366 | Ga0207690_103143662 | 153 |
| 350 | 3300025933 | Ga0207706_10029314 | Ga0207706_100293146 | 153 |
| 351 | 3300025933 | Ga0207706_10225533 | Ga0207706_102255332 | 153 |
| 352 | 3300025939 | Ga0207665_10207380 | Ga0207665_102073802 | 153 |
| 353 | 3300025940 | Ga0207691_10022209 | Ga0207691_100222096 | 153 |
| 354 | 3300025942 | Ga0207689_10007824 | Ga0207689_100078246 | 153 |
| 355 | 3300025945 | Ga0207679_10298906 | Ga0207679_102989062 | 153 |
| 356 | 3300025949 | Ga0207667_10008280 | Ga0207667_100082807 | 153 |
| 357 | 3300025949 | Ga0207667_10022293 | Ga0207667_100222936 | 153 |
| 358 | 3300025949 | Ga0207667_10399268 | Ga0207667_103992682 | 153 |
| 359 | 3300025949 | Ga0207667_10898239 | Ga0207667_108982391 | 153 |
| 360 | 3300025960 | Ga0207651_10056253 | Ga0207651_100562532 | 153 |
| 361 | 3300025961 | Ga0207712_10025109 | Ga0207712_100251092 | 153 |
| 362 | 3300025961 | Ga0207712_10170455 | Ga0207712_101704552 | 153 |
| 363 | 3300025961 | Ga0207712_10558765 | Ga0207712_105587652 | 153 |
| 364 | 3300025972 | Ga0207668_10053771 | Ga0207668_100537712 | 153 |
| 365 | 3300025981 | Ga0207640_10169472 | Ga0207640_101694722 | 153 |
| 366 | 3300025986 | Ga0207658_10005893 | Ga0207658_100058934 | 153 |
| 367 | 3300025986 | Ga0207658_10235595 | Ga0207658_102355951 | 153 |
| 368 | 3300025986 | Ga0207658_10885531 | Ga0207658_108855312 | 153 |
| 369 | 3300026035 | Ga0207703_10000318 | Ga0207703_1000031832 | 153 |
| 370 | 3300026035 | Ga0207703_10000569 | Ga0207703_100005691 | 153 |
| 371 | 3300026035 | Ga0207703_11146149 | Ga0207703_111461491 | 153 |
| 372 | 3300026041 | Ga0207639_10105324 | Ga0207639_101053241 | 153 |
| 373 | 3300026041 | Ga0207639_10169799 | Ga0207639_101697992 | 153 |
| 374 | 3300026067 | Ga0207678_10008627 | Ga0207678_100086276 | 153 |
| 375 | 3300026075 | Ga0207708_10042933 | Ga0207708_100429332 | 153 |
| 376 | 3300026078 | Ga0207702_10878336 | Ga0207702_108783362 | 153 |
| 377 | 3300026078 | Ga0207702_10918833 | Ga0207702_109188331 | 153 |
| 378 | 3300026088 | Ga0207641_10006850 | Ga0207641_100068503 | 153 |
| 379 | 3300026088 | Ga0207641_10027150 | Ga0207641_100271504 | 153 |
| 380 | 3300026088 | Ga0207641_10098870 | Ga0207641_100988703 | 153 |
| 381 | 3300026089 | Ga0207648_10007613 | Ga0207648_1000761311 | 153 |
| 382 | 3300026116 | Ga0207674_10005707 | Ga0207674_1000570716 | 153 |
| 383 | 3300026116 | Ga0207674_10013448 | Ga0207674_100134483 | 153 |
| 384 | 3300026118 | Ga0207675_100001048 | Ga0207675_1000010488 | 153 |
| 385 | 3300026118 | Ga0207675_100037930 | Ga0207675_1000379303 | 153 |
| 386 | 3300026121 | Ga0207683_10060481 | Ga0207683_100604813 | 153 |
| 387 | 3300026142 | Ga0207698_10317964 | Ga0207698_103179642 | 153 |
| 388 | 3300027907 | Ga0207428_10005044 | Ga0207428_100050449 | 153 |
| 389 | 3300027907 | Ga0207428_10017053 | Ga0207428_100170533 | 153 |
| 390 | 3300027907 | Ga0207428_10118628 | Ga0207428_101186282 | 153 |
| 391 | 3300028379 | Ga0268266_10002296 | Ga0268266_1000229621 | 153 |
| 392 | 3300028379 | Ga0268266_10153297 | Ga0268266_101532972 | 153 |
| 393 | 3300028379 | Ga0268266_10251683 | Ga0268266_102516832 | 153 |
| 394 | 3300028379 | Ga0268266_10604522 | Ga0268266_106045221 | 153 |
| 395 | 3300028379 | Ga0268266_10886791 | Ga0268266_108867911 | 153 |
| 396 | 3300028380 | Ga0268265_10000313 | Ga0268265_1000031319 | 153 |
| 397 | 3300028380 | Ga0268265_11379604 | Ga0268265_113796041 | 153 |
| 398 | 3300028381 | Ga0268264_10004984 | Ga0268264_100049846 | 153 |
| 399 | 3300028381 | Ga0268264_10015749 | Ga0268264_100157497 | 153 |
| 400 | 3300028573 | Ga0265334_10011925 | Ga0265334_100119253 | 153 |
| 401 | 3300030521 | Ga0307511_10076666 | Ga0307511_100766662 | 153 |
| 402 | 3300030521 | Ga0307511_10456755 | Ga0307511_104567551 | 153 |
| 403 | 3300031239 | Ga0265328_10004713 | Ga0265328_100047132 | 153 |
| 404 | 3300031247 | Ga0265340_10127104 | Ga0265340_101271042 | 153 |
| 405 | 3300031250 | Ga0265331_10004757 | Ga0265331_100047578 | 153 |
| 406 | 3300031344 | Ga0265316_10028187 | Ga0265316_100281872 | 153 |
| 407 | 3300031507 | Ga0307509_10000001 | Ga0307509_10000001527 | 153 |
| 408 | 3300031507 | Ga0307509_10000554 | Ga0307509_100005544 | 153 |
| 409 | 3300031548 | Ga0307408_100017247 | Ga0307408_1000172472 | 153 |
| 410 | 3300031548 | Ga0307408_100355033 | Ga0307408_1003550332 | 153 |
| 411 | 3300031616 | Ga0307508_10159189 | Ga0307508_101591892 | 153 |
| 412 | 3300031616 | Ga0307508_10178293 | Ga0307508_101782932 | 153 |
| 413 | 3300031616 | Ga0307508_10235527 | Ga0307508_102355272 | 153 |
| 414 | 3300031711 | Ga0265314_10313682 | Ga0265314_103136821 | 153 |
| 415 | 3300031824 | Ga0307413_10423684 | Ga0307413_104236842 | 153 |
| 416 | 3300031901 | Ga0307406_10389611 | Ga0307406_103896112 | 153 |
| 417 | 3300032002 | Ga0307416_100766924 | Ga0307416_1007669242 | 153 |
| 418 | 3300032004 | Ga0307414_10833420 | Ga0307414_108334202 | 153 |
| 419 | 3300032005 | Ga0307411_10143875 | Ga0307411_101438752 | 153 |
| 420 | 3300033180 | Ga0307510_10000015 | Ga0307510_10000015143 | 153 |
| 421 | 3300035090 | Ga0373949_0149880 | Ga0373949_0149880_33_494 | 153 |
| 422 | 3300035091 | Ga0373951_0049530 | Ga0373951_0049530_344_805 | 153 |
| 423 | 3300035113 | Ga0373936_0012855 | Ga0373936_0012855_123_584 | 153 |
| 424 | 3300035242 | Ga0373962_0077850 | Ga0373962_0077850_420_881 | 153 |
| 425 | 3300035691 | Ga0373931_0087545 | Ga0373931_0087545_1241_1702 | 153 |
| 426 | 3300035691 | Ga0373931_0192299 | Ga0373931_0192299_235_696 | 153 |
| 427 | 3300035691 | Ga0373931_0330814 | Ga0373931_0330814_43_504 | 153 |
| 428 | 3300037068 | Ga0373925_0816262 | Ga0373925_0816262_214_675 | 153 |
| 429 | 3300037418 | Ga0395900_0136641 | Ga0395900_0136641_971_1432 | 153 |
| 430 | 3300037466 | Ga0395898_0115191 | Ga0395898_0115191_477_938 | 153 |
| 431 | 3300037471 | Ga0395905_1832136 | Ga0395905_1832136_28_489 | 153 |
| 432 | 3300037853 | Ga0436364_1369752 | Ga0436364_1369752_477_938 | 153 |
| 433 | 3300039437 | Ga0436365_1779381 | Ga0436365_1779381_2085_2546 | 153 |
| 434 | 3300039438 | Ga0436360_0420608 | Ga0436360_0420608_369_830 | 153 |
| 435 | 3300039450 | Ga0436363_0779673 | Ga0436363_0779673_112_573 | 153 |
| 436 | 3300041410 | Ga0439461_0146707 | Ga0439461_0146707_119_583 | 153 |
| 437 | 3300042002 | Ga0439442_044239 | Ga0439442_044239_284_844 | 153 |
| 438 | 3300042014 | Ga0439457_153439 | Ga0439457_153439_56_517 | 153 |
| 439 | 3300042134 | Ga0450898_119414 | Ga0450898_119414_79_540 | 153 |
| 440 | 3300042437 | Ga0439444_0009016 | Ga0439444_0009016_676_1140 | 153 |
| 441 | 3300042439 | Ga0439464_0084597 | Ga0439464_0084597_286_747 | 153 |
| 442 | 3300042876 | Ga0451577_0004096 | Ga0451577_0004096_13132_13608 | 153 |
| 443 | 3300044656 | Ga0466969_0077784 | Ga0466969_0077784_1057_1518 | 153 |
| 444 | 3300044656 | Ga0466969_0299103 | Ga0466969_0299103_38_499 | 153 |
| 445 | 3300044684 | Ga0466966_0021523 | Ga0466966_0021523_1005_1466 | 153 |
| 446 | 3300044684 | Ga0466966_0151508 | Ga0466966_0151508_544_1005 | 153 |
| 447 | 3300044684 | Ga0466966_0167799 | Ga0466966_0167799_388_849 | 153 |
| 448 | 3300044684 | Ga0466966_0217036 | Ga0466966_0217036_382_843 | 153 |
| 449 | 3300044693 | Ga0466961_0261051 | Ga0466961_0261051_305_766 | 153 |
| 450 | 3300044706 | Ga0466964_0000478 | Ga0466964_0000478_7428_7889 | 153 |
| 451 | 3300044712 | Ga0453684_0571964 | Ga0453684_0571964_659_1135 | 153 |
| 452 | 3300044719 | Ga0466971_0000470 | Ga0466971_0000470_6001_6462 | 153 |
| 453 | 3300044765 | Ga0466970_0025227 | Ga0466970_0025227_2272_2733 | 153 |
| 454 | 3300044842 | Ga0466957_0002617 | Ga0466957_0002617_1604_2065 | 153 |
| 455 | 3300045049 | Ga0466959_0004566 | Ga0466959_0004566_8067_8528 | 153 |
| 456 | 3300045049 | Ga0466959_0005871 | Ga0466959_0005871_5276_5737 | 153 |
| 457 | 3300045049 | Ga0466959_0023734 | Ga0466959_0023734_1435_1896 | 153 |
| 458 | 3300045049 | Ga0466959_0054468 | Ga0466959_0054468_556_1017 | 153 |
| 459 | 3300045049 | Ga0466959_0058237 | Ga0466959_0058237_2038_2499 | 153 |
| 460 | 3300045049 | Ga0466959_0184477 | Ga0466959_0184477_297_758 | 153 |
| 461 | 3300045049 | Ga0466959_0566920 | Ga0466959_0566920_195_656 | 153 |
| 462 | 3300045051 | Ga0451576_0354354 | Ga0451576_0354354_917_1378 | 153 |
| 463 | 3300045836 | Ga0466958_0092844 | Ga0466958_0092844_1199_1660 | 153 |
| 464 | 3300046457 | Ga0495590_0175186 | Ga0495590_0175186_235_696 | 153 |
| 465 | 3300046460 | Ga0495638_0000932 | Ga0495638_0000932_5832_6305 | 153 |
| 466 | 3300046473 | Ga0495582_0683247 | Ga0495582_0683247_79_540 | 153 |
| 467 | 3300046507 | Ga0495606_0435619 | Ga0495606_0435619_62_523 | 153 |
| 468 | 3300046517 | Ga0495630_0590660 | Ga0495630_0590660_357_818 | 153 |
| 469 | 3300046519 | Ga0495632_0082221 | Ga0495632_0082221_561_1022 | 153 |
| 470 | 3300046522 | Ga0495643_0171842 | Ga0495643_0171842_480_941 | 153 |
| 471 | 3300046648 | Ga0495611_0536452 | Ga0495611_0536452_14_475 | 153 |
| 472 | 3300046660 | Ga0495625_0003435 | Ga0495625_0003435_13204_13677 | 153 |
| 473 | 3300046692 | Ga0495671_0022729 | Ga0495671_0022729_1238_1708 | 153 |
| 474 | 3300046692 | Ga0495671_0582745 | Ga0495671_0582745_39_500 | 153 |
| 475 | 3300046694 | Ga0495649_0312938 | Ga0495649_0312938_52_513 | 153 |
| 476 | 3300047443 | Ga0495687_076708 | Ga0495687_076708_71_532 | 153 |
| 477 | 3300047469 | Ga0495673_0082233 | Ga0495673_0082233_372_833 | 153 |
| 478 | 3300047472 | Ga0495686_0669988 | Ga0495686_0669988_60_521 | 153 |
| 479 | 3300048905 | Ga0496102_0078502 | Ga0496102_0078502_795_1256 | 153 |
| 480 | 3300048905 | Ga0496102_0210917 | Ga0496102_0210917_1058_1519 | 153 |
| 481 | 3300048906 | Ga0496103_0406641 | Ga0496103_0406641_291_752 | 153 |
| 482 | 3300048907 | Ga0496104_0646270 | Ga0496104_0646270_468_929 | 153 |
| 483 | 3300048910 | Ga0496107_0257713 | Ga0496107_0257713_504_965 | 153 |
| 484 | 3300048911 | Ga0496108_0020014 | Ga0496108_0020014_4404_4865 | 153 |
| 485 | 3300048912 | Ga0496109_0032431 | Ga0496109_0032431_2740_3201 | 153 |
| 486 | 3300048912 | Ga0496109_1455282 | Ga0496109_1455282_57_518 | 153 |
| 487 | 3300048913 | Ga0496110_0078250 | Ga0496110_0078250_1933_2394 | 153 |
| 488 | 3300048915 | Ga0496112_0030321 | Ga0496112_0030321_4238_4699 | 153 |
| 489 | 3300048916 | Ga0496113_0043951 | Ga0496113_0043951_248_709 | 153 |
| 490 | 3300048918 | Ga0496115_1149903 | Ga0496115_1149903_55_516 | 153 |
| 491 | 3300048919 | Ga0496116_0032043 | Ga0496116_0032043_738_1199 | 153 |
| 492 | 3300048920 | Ga0496117_0000208 | Ga0496117_0000208_7672_8133 | 153 |
| 493 | 3300048920 | Ga0496117_0086115 | Ga0496117_0086115_465_938 | 153 |
| 494 | 3300048921 | Ga0496118_0000005 | Ga0496118_0000005_408111_408572 | 153 |
| 495 | 3300048921 | Ga0496118_0345110 | Ga0496118_0345110_64_525 | 153 |
| 496 | 3300048922 | Ga0496119_0000983 | Ga0496119_0000983_33459_33920 | 153 |
| 497 | 3300048922 | Ga0496119_0003655 | Ga0496119_0003655_14058_14519 | 153 |
| 498 | 3300048923 | Ga0496120_0000199 | Ga0496120_0000199_54726_55187 | 153 |
| 499 | 3300048923 | Ga0496120_0043028 | Ga0496120_0043028_674_1135 | 153 |
| 500 | 3300048924 | Ga0496121_0001978 | Ga0496121_0001978_13127_13588 | 153 |
| 501 | 3300048924 | Ga0496121_0028102 | Ga0496121_0028102_3847_4368 | 153 |
| 502 | 3300048924 | Ga0496121_0508052 | Ga0496121_0508052_283_744 | 153 |
| 503 | 3300048927 | Ga0496124_0379754 | Ga0496124_0379754_498_959 | 153 |
| 504 | 3300048928 | Ga0496125_0003265 | Ga0496125_0003265_15103_15564 | 153 |
| 505 | 3300048928 | Ga0496125_0048773 | Ga0496125_0048773_1451_1912 | 153 |
| 506 | 3300048928 | Ga0496125_0087137 | Ga0496125_0087137_1784_2245 | 153 |
| 507 | 3300048929 | Ga0496126_0006026 | Ga0496126_0006026_6759_7220 | 153 |
| 508 | 3300048929 | Ga0496126_0088648 | Ga0496126_0088648_511_972 | 153 |
| 509 | 3300049579 | Ga0501043_0340118 | Ga0501043_0340118_349_810 | 153 |
| 510 | 3300049582 | Ga0501048_0270626 | Ga0501048_0270626_635_1099 | 153 |
| 511 | 3300049588 | Ga0501072_0046065 | Ga0501072_0046065_2573_3037 | 153 |
| 512 | 3300049591 | Ga0501075_0495285 | Ga0501075_0495285_423_887 | 153 |
| 513 | 3300049659 | Ga0501214_006239 | Ga0501214_006239_334_795 | 153 |
| 514 | 3300049679 | Ga0501249_056265 | Ga0501249_056265_239_700 | 153 |
| 515 | 3300049824 | Ga0501045_0017416 | Ga0501045_0017416_461_925 | 153 |
| 516 | 3300050507 | nmdc:mga05p37_119227_c1 | nmdc:mga05p37_119227_c1_654_1115 | 153 |
| 517 | 3300050507 | nmdc:mga05p37_7589_c1 | nmdc:mga05p37_7589_c1_4832_5293 | 153 |
| 518 | 3300050508 | nmdc:mga09592_17903_c1 | nmdc:mga09592_17903_c1_316_777 | 153 |
| 519 | 3300050508 | nmdc:mga09592_97499_c1 | nmdc:mga09592_97499_c1_433_894 | 153 |
| 520 | 3300050508 | nmdc:mga09592_9989_c1 | nmdc:mga09592_9989_c1_2593_3054 | 153 |
| 521 | 3300050509 | nmdc:mga0qj67_1028165_c1 | nmdc:mga0qj67_1028165_c1_162_623 | 153 |
| 522 | 3300050509 | nmdc:mga0qj67_112863_c1 | nmdc:mga0qj67_112863_c1_1125_1586 | 153 |
| 523 | 3300050509 | nmdc:mga0qj67_122705_c1 | nmdc:mga0qj67_122705_c1_1613_2074 | 153 |
| 524 | 3300050509 | nmdc:mga0qj67_342063_c1 | nmdc:mga0qj67_342063_c1_436_900 | 153 |
| 525 | 3300050509 | nmdc:mga0qj67_3628_c1 | nmdc:mga0qj67_3628_c1_8045_8506 | 153 |
| 526 | 3300050509 | nmdc:mga0qj67_497912_c1 | nmdc:mga0qj67_497912_c1_159_620 | 153 |
| 527 | 3300050509 | nmdc:mga0qj67_6592_c1 | nmdc:mga0qj67_6592_c1_3807_4268 | 153 |
| 528 | 3300050509 | nmdc:mga0qj67_763115_c1 | nmdc:mga0qj67_763115_c1_109_570 | 153 |
| 529 | 3300050510 | nmdc:mga06r32_1040355_c1 | nmdc:mga06r32_1040355_c1_45_506 | 153 |
| 530 | 3300050510 | nmdc:mga06r32_1127223_c1 | nmdc:mga06r32_1127223_c1_234_695 | 153 |
| 531 | 3300050510 | nmdc:mga06r32_1204_c1 | nmdc:mga06r32_1204_c1_7039_7500 | 153 |
| 532 | 3300050510 | nmdc:mga06r32_181_c1 | nmdc:mga06r32_181_c1_9723_10184 | 153 |
| 533 | 3300050510 | nmdc:mga06r32_256658_c1 | nmdc:mga06r32_256658_c1_289_753 | 153 |
| 534 | 3300050510 | nmdc:mga06r32_370_c1 | nmdc:mga06r32_370_c1_2989_3450 | 153 |
| 535 | 3300050511 | nmdc:mga08y16_16866_c1 | nmdc:mga08y16_16866_c1_5204_5665 | 153 |
| 536 | 3300050511 | nmdc:mga08y16_204011_c1 | nmdc:mga08y16_204011_c1_1413_1874 | 153 |
| 537 | 3300050511 | nmdc:mga08y16_3086_c1 | nmdc:mga08y16_3086_c1_13010_13471 | 153 |
| 538 | 3300050512 | nmdc:mga0n895_416185_c1 | nmdc:mga0n895_416185_c1_682_1143 | 153 |
| 539 | 3300050513 | nmdc:mga0rr50_410930_c1 | nmdc:mga0rr50_410930_c1_468_929 | 153 |
| 540 | 3300050515 | nmdc:mga0a205_1124261_c1 | nmdc:mga0a205_1124261_c1_64_525 | 153 |
| 541 | 3300050515 | nmdc:mga0a205_683756_c1 | nmdc:mga0a205_683756_c1_180_641 | 153 |
| 542 | 3300053088 | Ga0500644_0011984 | Ga0500644_0011984_1769_2230 | 153 |
| 543 | 3300053092 | Ga0500583_0101567 | Ga0500583_0101567_238_699 | 153 |
| 544 | 3300053092 | Ga0500583_0347530 | Ga0500583_0347530_46_507 | 153 |
| 545 | 3300053093 | Ga0500651_0179121 | Ga0500651_0179121_206_667 | 153 |
| 546 | 3300053093 | Ga0500651_0373198 | Ga0500651_0373198_203_664 | 153 |
| 547 | 3300053104 | Ga0500556_0070350 | Ga0500556_0070350_651_1112 | 153 |
| 548 | 3300053115 | Ga0500591_063212 | Ga0500591_063212_33_494 | 153 |
| 549 | 3300053118 | Ga0500594_0177865 | Ga0500594_0177865_149_610 | 153 |
| 550 | 3300053124 | Ga0500617_033350 | Ga0500617_033350_101_562 | 153 |
| 551 | 3300053130 | Ga0500642_0066447 | Ga0500642_0066447_1105_1566 | 153 |
| 552 | 3300053131 | Ga0500652_067352 | Ga0500652_067352_381_842 | 153 |
| 553 | 3300053131 | Ga0500652_118413 | Ga0500652_118413_12_473 | 153 |
| 554 | 3300053133 | Ga0500655_023346 | Ga0500655_023346_292_753 | 153 |
| 555 | 3300053134 | Ga0500658_0048482 | Ga0500658_0048482_26_487 | 153 |
| 556 | 3300053139 | Ga0500568_0041422 | Ga0500568_0041422_85_546 | 153 |
| 557 | 3300053146 | Ga0500588_0006679 | Ga0500588_0006679_2105_2566 | 153 |
| 558 | 3300053148 | Ga0500590_170219 | Ga0500590_170219_36_497 | 153 |
| 559 | 3300053156 | Ga0500622_0035953 | Ga0500622_0035953_1236_1697 | 153 |
| 560 | 3300053158 | Ga0500627_0244881 | Ga0500627_0244881_111_572 | 153 |
| 561 | 3300053178 | Ga0500637_0008894 | Ga0500637_0008894_48_509 | 153 |
| 562 | 3300053178 | Ga0500637_0021154 | Ga0500637_0021154_2868_3329 | 153 |
| 563 | 3300053178 | Ga0500637_0025197 | Ga0500637_0025197_764_1225 | 153 |
| 564 | 3300053178 | Ga0500637_0080013 | Ga0500637_0080013_541_1002 | 153 |
| 565 | 3300053735 | Ga0500596_025439 | Ga0500596_025439_285_746 | 153 |
| 566 | 3300060353 | Ga0501082_0117803 | Ga0501082_0117803_485_949 | 153 |
| 567 | 3300061719 | Ga0466962_0008334 | Ga0466962_0008334_2195_2656 | 153 |
| 568 | 3300005338 | Ga0068868_100291310 | Ga0068868_1002913102 | 154 |
| 569 | 3300005347 | Ga0070668_100847046 | Ga0070668_1008470461 | 154 |
| 570 | 3300005353 | Ga0070669_100643161 | Ga0070669_1006431612 | 154 |
| 571 | 3300005354 | Ga0070675_101171453 | Ga0070675_1011714531 | 154 |
| 572 | 3300005354 | Ga0070675_101647428 | Ga0070675_1016474281 | 154 |
| 573 | 3300005355 | Ga0070671_100220916 | Ga0070671_1002209163 | 154 |
| 574 | 3300005364 | Ga0070673_100069325 | Ga0070673_1000693252 | 154 |
| 575 | 3300005364 | Ga0070673_100940430 | Ga0070673_1009404301 | 154 |
| 576 | 3300005435 | Ga0070714_100050721 | Ga0070714_1000507213 | 154 |
| 577 | 3300005436 | Ga0070713_100039876 | Ga0070713_1000398762 | 154 |
| 578 | 3300005437 | Ga0070710_10715711 | Ga0070710_107157111 | 154 |
| 579 | 3300005439 | Ga0070711_100109422 | Ga0070711_1001094222 | 154 |
| 580 | 3300005457 | Ga0070662_100981173 | Ga0070662_1009811731 | 154 |
| 581 | 3300005548 | Ga0070665_101211150 | Ga0070665_1012111502 | 154 |
| 582 | 3300005563 | Ga0068855_100000392 | Ga0068855_10000039222 | 154 |
| 583 | 3300005614 | Ga0068856_100004047 | Ga0068856_10000404714 | 154 |
| 584 | 3300005614 | Ga0068856_100027578 | Ga0068856_1000275785 | 154 |
| 585 | 3300005617 | Ga0068859_100125209 | Ga0068859_1001252092 | 154 |
| 586 | 3300005618 | Ga0068864_100855385 | Ga0068864_1008553851 | 154 |
| 587 | 3300005841 | Ga0068863_102412561 | Ga0068863_1024125611 | 154 |
| 588 | 3300005843 | Ga0068860_100961925 | Ga0068860_1009619251 | 154 |
| 589 | 3300005937 | Ga0081455_10158140 | Ga0081455_101581402 | 154 |
| 590 | 3300006028 | Ga0070717_10029245 | Ga0070717_100292453 | 154 |
| 591 | 3300006173 | Ga0070716_100361248 | Ga0070716_1003612481 | 154 |
| 592 | 3300006237 | Ga0097621_101395339 | Ga0097621_1013953391 | 154 |
| 593 | 3300006358 | Ga0068871_101318555 | Ga0068871_1013185551 | 154 |
| 594 | 3300006844 | Ga0075428_101898022 | Ga0075428_1018980221 | 154 |
| 595 | 3300006847 | Ga0075431_100018918 | Ga0075431_1000189184 | 154 |
| 596 | 3300006871 | Ga0075434_100630163 | Ga0075434_1006301632 | 154 |
| 597 | 3300006931 | Ga0097620_100125208 | Ga0097620_1001252082 | 154 |
| 598 | 3300009094 | Ga0111539_10172799 | Ga0111539_101727992 | 154 |
| 599 | 3300009094 | Ga0111539_10884749 | Ga0111539_108847491 | 154 |
| 600 | 3300009551 | Ga0105238_10056304 | Ga0105238_100563046 | 154 |
| 601 | 3300010375 | Ga0105239_10742520 | Ga0105239_107425202 | 154 |
| 602 | 3300013308 | Ga0157375_10255823 | Ga0157375_102558232 | 154 |
| 603 | 3300014326 | Ga0157380_10211485 | Ga0157380_102114851 | 154 |
| 604 | 3300014326 | Ga0157380_10350108 | Ga0157380_103501082 | 154 |
| 605 | 3300014969 | Ga0157376_10727490 | Ga0157376_107274902 | 154 |
| 606 | 3300017792 | Ga0163161_10419686 | Ga0163161_104196862 | 154 |
| 607 | 3300017792 | Ga0163161_10653297 | Ga0163161_106532971 | 154 |
| 608 | 3300025898 | Ga0207692_10905519 | Ga0207692_109055191 | 154 |
| 609 | 3300025908 | Ga0207643_10205250 | Ga0207643_102052502 | 154 |
| 610 | 3300025913 | Ga0207695_10067797 | Ga0207695_100677972 | 154 |
| 611 | 3300025916 | Ga0207663_10024741 | Ga0207663_100247413 | 154 |
| 612 | 3300025923 | Ga0207681_10119595 | Ga0207681_101195952 | 154 |
| 613 | 3300025924 | Ga0207694_10301691 | Ga0207694_103016912 | 154 |
| 614 | 3300025925 | Ga0207650_10257354 | Ga0207650_102573542 | 154 |
| 615 | 3300025925 | Ga0207650_10890658 | Ga0207650_108906582 | 154 |
| 616 | 3300025926 | Ga0207659_10038385 | Ga0207659_100383852 | 154 |
| 617 | 3300025926 | Ga0207659_11108433 | Ga0207659_111084332 | 154 |
| 618 | 3300025928 | Ga0207700_10153296 | Ga0207700_101532962 | 154 |
| 619 | 3300025929 | Ga0207664_10022653 | Ga0207664_100226534 | 154 |
| 620 | 3300025931 | Ga0207644_10366601 | Ga0207644_103666012 | 154 |
| 621 | 3300025939 | Ga0207665_10305866 | Ga0207665_103058662 | 154 |
| 622 | 3300025949 | Ga0207667_10004010 | Ga0207667_100040107 | 154 |
| 623 | 3300026078 | Ga0207702_10020022 | Ga0207702_100200225 | 154 |
| 624 | 3300026088 | Ga0207641_11324485 | Ga0207641_113244852 | 154 |
| 625 | 3300026089 | Ga0207648_10398394 | Ga0207648_103983942 | 154 |
| 626 | 3300026095 | Ga0207676_11279324 | Ga0207676_112793241 | 154 |
| 627 | 3300026116 | Ga0207674_10458894 | Ga0207674_104588942 | 154 |
| 628 | 3300026118 | Ga0207675_100615965 | Ga0207675_1006159652 | 154 |
| 629 | 3300028380 | Ga0268265_10324993 | Ga0268265_103249932 | 154 |
| 630 | 3300028381 | Ga0268264_11372393 | Ga0268264_113723932 | 154 |
| 631 | 3300028794 | Ga0307515_10001184 | Ga0307515_1000118419 | 154 |
| 632 | 3300031665 | Ga0316575_10054691 | Ga0316575_100546911 | 154 |
| 633 | 3300031727 | Ga0316576_10080340 | Ga0316576_100803402 | 154 |
| 634 | 3300031727 | Ga0316576_10134942 | Ga0316576_101349422 | 154 |
| 635 | 3300031728 | Ga0316578_10023547 | Ga0316578_100235474 | 154 |
| 636 | 3300035398 | Ga0316574_0005865 | Ga0316574_0005865_711_1175 | 154 |
| 637 | 3300035398 | Ga0316574_0073603 | Ga0316574_0073603_414_878 | 154 |
| 638 | 3300036647 | Ga0316582_0341214 | Ga0316582_0341214_10_474 | 154 |
| 639 | 3300036712 | Ga0316584_0074685 | Ga0316584_0074685_895_1359 | 154 |
| 640 | 3300036712 | Ga0316584_0118343 | Ga0316584_0118343_1465_1929 | 154 |
| 641 | 3300039450 | Ga0436363_0141791 | Ga0436363_0141791_5573_6037 | 154 |
| 642 | 3300042876 | Ga0451577_1213028 | Ga0451577_1213028_95_559 | 154 |
| 643 | 3300044712 | Ga0453684_1443869 | Ga0453684_1443869_187_651 | 154 |
| 644 | 3300046519 | Ga0495632_0026708 | Ga0495632_0026708_132_599 | 154 |
| 645 | 3300048905 | Ga0496102_0051798 | Ga0496102_0051798_952_1416 | 154 |
| 646 | 3300048905 | Ga0496102_0160941 | Ga0496102_0160941_1330_1797 | 154 |
| 647 | 3300048907 | Ga0496104_0159001 | Ga0496104_0159001_1258_1725 | 154 |
| 648 | 3300048909 | Ga0496106_0204087 | Ga0496106_0204087_489_992 | 154 |
| 649 | 3300048912 | Ga0496109_0862792 | Ga0496109_0862792_186_653 | 154 |
| 650 | 3300048920 | Ga0496117_0189248 | Ga0496117_0189248_540_1004 | 154 |
| 651 | 3300048921 | Ga0496118_0015547 | Ga0496118_0015547_1508_1972 | 154 |
| 652 | 3300050509 | nmdc:mga0qj67_58991_c1 | nmdc:mga0qj67_58991_c1_20_568 | 154 |
| 653 | 3300050510 | nmdc:mga06r32_283906_c1 | nmdc:mga06r32_283906_c1_148_666 | 154 |
| 654 | 3300050510 | nmdc:mga06r32_5580_c1 | nmdc:mga06r32_5580_c1_9476_10024 | 154 |
| 655 | 3300050515 | nmdc:mga0a205_469497_c1 | nmdc:mga0a205_469497_c1_67_570 | 154 |
| 656 | 3300053092 | Ga0500583_0108738 | Ga0500583_0108738_708_1175 | 154 |
| 657 | 3300053096 | Ga0500641_0014877 | Ga0500641_0014877_162_629 | 154 |
| 658 | 3300053108 | Ga0500562_063693 | Ga0500562_063693_100_567 | 154 |
| 659 | 3300032002 | Ga0307416_100682662 | Ga0307416_1006826622 | 155 |
| 660 | 3300042876 | Ga0451577_0161672 | Ga0451577_0161672_57_524 | 155 |
| 661 | 3300044712 | Ga0453684_0411613 | Ga0453684_0411613_693_1163 | 155 |
| 662 | 3300025254 | Ga0209148_1005584 | Ga0209148_10055844 | 156 |
| 663 | 3300025272 | Ga0209455_1000415 | Ga0209455_100041521 | 156 |
| 664 | 3300031727 | Ga0316576_10142746 | Ga0316576_101427462 | 156 |
| 665 | 3300031852 | Ga0307410_10029566 | Ga0307410_100295662 | 156 |
| 666 | 3300031995 | Ga0307409_100063729 | Ga0307409_1000637293 | 156 |
| 667 | 3300032005 | Ga0307411_10005541 | Ga0307411_100055416 | 156 |
| 668 | 3300035398 | Ga0316574_0053238 | Ga0316574_0053238_1975_2451 | 156 |
| 669 | 3300042876 | Ga0451577_0360128 | Ga0451577_0360128_400_870 | 156 |
| 670 | 3300042876 | Ga0451577_0452106 | Ga0451577_0452106_264_734 | 156 |
| 671 | 3300042876 | Ga0451577_0654313 | Ga0451577_0654313_450_920 | 156 |
| 672 | 3300044712 | Ga0453684_0554213 | Ga0453684_0554213_213_683 | 156 |
| 673 | 2162886007 | SwRhRL2b_contig_1383463 | SwRhRL2b_0421.00004470 | 157 |
| 674 | 3300005354 | Ga0070675_100872445 | Ga0070675_1008724452 | 157 |
| 675 | 3300005439 | Ga0070711_100029695 | Ga0070711_1000296954 | 157 |
| 676 | 3300006163 | Ga0070715_10427283 | Ga0070715_104272831 | 157 |
| 677 | 3300006175 | Ga0070712_100060593 | Ga0070712_1000605932 | 157 |
| 678 | 3300006358 | Ga0068871_101494549 | Ga0068871_1014945492 | 157 |
| 679 | 3300025905 | Ga0207685_10096108 | Ga0207685_100961082 | 157 |
| 680 | 3300025915 | Ga0207693_10028614 | Ga0207693_100286144 | 157 |
| 681 | 3300048904 | Ga0496101_0299771 | Ga0496101_0299771_720_1229 | 157 |
| 682 | 3300048918 | Ga0496115_0279494 | Ga0496115_0279494_734_1243 | 157 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3i4p-assembly1.cif.gz_A | crystal structure of asnc family transcriptional regulator from agrobacterium tumefaciens | 0.97 | 4 | 151 |
| 2gqq-assembly1.cif.gz_A-2 | crystal structure of e. coli leucine-responsive regulatory protein (lrp) | 0.9619 | 4 | 154 |
| 2p5v-assembly1.cif.gz_A | crystal structure of transcriptional regulator nmb0573 from neisseria meningitidis | 0.9599 | 1 | 154 |
| 2gqq-assembly1.cif.gz_A-2 | crystal structure of e. coli leucine-responsive regulatory protein (lrp) | 0.9437 | 4 | 154 |
| 2vc1-assembly1.cif.gz_B | feast or famine regulatory protein (rv3291c)from m. tuberculosis complexed with l-methionine | 0.9383 | 2 | 150 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2p5vE01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9984 | 4 | 55 | 1.10.10.10 |
| 2p6sC01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9971 | 4 | 55 | 1.10.10.10 |
| 2p5vH01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9967 | 4 | 55 | 1.10.10.10 |
| 2p5vC01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9957 | 4 | 55 | 1.10.10.10 |
| 2p6tF01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9956 | 4 | 55 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A239IPX8-F1-model_v4 | Transcriptional regulator, AsnC family | 0.9918 | 2 | 153 |
GO:0005829
GO:0043200 GO:0043565 |
| AF-A0A1N6PII9-F1-model_v4 | Transcriptional regulator, AsnC family | 0.9906 | 1 | 152 |
GO:0005829
GO:0043200 GO:0043565 |
| AF-A0A1I3F254-F1-model_v4 | Transcriptional regulator, AsnC family | 0.9902 | 3 | 153 |
GO:0005829
GO:0043200 GO:0043565 |
| AF-A0A6N8XAX8-F1-model_v4 | Lrp/AsnC family transcriptional regulator | 0.9898 | 1 | 153 |
GO:0005829
GO:0043200 GO:0043565 |
| AF-A0A0A1PGE5-F1-model_v4 | Leucine-responsive regulatory protein | 0.9896 | 4 | 152 |
GO:0005829
GO:0043200 GO:0043565 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar