F474925

General Info

Members Datasets Scaffolds Average Seq Length
682 315 681 154

Family's Representative Sequence

Representative Sequence 3300042002|Ga0439442_044239|Ga0439442_044239_284_844
Length 186
Sequence VAGSGRKLRESARSGQNVAESADIDLNTDGFLRMKLDRFDKAILQALQHDGRVSNAALAERLSLSESACLRRVRALEESGLVEGYTALINQQKAGCPVNVFVNITLDRQDETDLRRFEEAVRKIPEVMECYLMTGDYDYVVRVVVADTADFERLHSKHLTRLPGVARVHSSFALRTIQKSRELPIR

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2857553236 Duganella sp. R-74557 Isolate Unclassified
3 2919476304 Duganella sp. 3397 Isolate Unclassified
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
81 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
82 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
83 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
111 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
112 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
113 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
114 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
170 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
171 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
175 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
176 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
177 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
178 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
179 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
180 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
181 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
182 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
183 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
184 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
185 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
186 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
187 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
188 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
189 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
190 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
191 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
192 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
193 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
194 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
195 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
196 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
197 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
198 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
199 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
200 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
201 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
202 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
203 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
204 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
205 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
206 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
207 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
208 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
209 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
210 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
211 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
212 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
213 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
214 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
215 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
216 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
217 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
218 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
219 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
220 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
221 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
222 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
223 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
224 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
225 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
226 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
227 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
228 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
229 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
230 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
231 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
232 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
233 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
234 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
235 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
236 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
237 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
238 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
239 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
240 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
241 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
242 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
243 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
244 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
245 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
246 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
247 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
248 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
249 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
250 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
251 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
252 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
253 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
254 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
255 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
256 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
257 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
258 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
259 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
260 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
261 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
262 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
263 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
264 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
265 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
266 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
267 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
268 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
269 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
270 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
271 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
272 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
273 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
274 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
278 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
279 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
280 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
281 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
282 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
285 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
286 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
287 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
288 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
289 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
290 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
291 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
292 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
293 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
294 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
295 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
296 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
297 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
298 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
299 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
300 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
301 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
302 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
303 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
304 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
305 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
306 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
307 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
308 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
309 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
310 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
311 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
312 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
313 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
314 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
315 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.71
Metatranscriptomes 0
Isolates 0.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.13
Nodule 0.29
Rhizoplane 2.79
Rhizosphere 85.48
Stem 0
Stem Tuber 0
Unclassified 6.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1383463 2162886007 Bacteria 4249
2 rootH1_10045185 3300003316 Bacteria 3066
3 rootH1_10045185 3300003323 Bacteria 2482
4 rootH1_10000183 3300003323 Bacteria 3684
5 rootH1_10027822 3300003323 Bacteria 7994
6 Ga0065715_10130591 3300005293 Bacteria 2017
7 Ga0065707_10082632 3300005295 Bacteria 13146
8 Ga0065707_10098644 3300005295 Unclassified 3069
9 Ga0070658_10157495 3300005327 Bacteria 1904
10 Ga0070676_10155833 3300005328 Bacteria 1466
11 Ga0070690_100015129 3300005330 Bacteria 4595
12 Ga0070670_100035627 3300005331 Bacteria 4283
13 Ga0070670_100508339 3300005331 Bacteria 1072
14 Ga0068869_100008053 3300005334 Bacteria 6771
15 Ga0070666_10025693 3300005335 Bacteria 3841
16 Ga0070666_10085450 3300005335 Bacteria 2161
17 Ga0070680_100039302 3300005336 Bacteria 3829
18 Ga0070680_100040752 3300005336 Bacteria 3763
19 Ga0070680_100077678 3300005336 Bacteria 2734
20 Ga0070680_100336615 3300005336 Bacteria 1282
21 Ga0070682_100612757 3300005337 Bacteria 861
22 Ga0070682_101365767 3300005337 Unclassified 604
23 Ga0068868_100291310 3300005338 Bacteria 1384
24 Ga0070689_100011375 3300005340 Bacteria 6373
25 Ga0070661_100017056 3300005344 Bacteria 5146
26 Ga0070661_100164259 3300005344 Bacteria 1683
27 Ga0070661_100424054 3300005344 Bacteria 1055
28 Ga0070692_10406471 3300005345 Bacteria 861
29 Ga0070668_100019556 3300005347 Bacteria 5097
30 Ga0070668_100847046 3300005347 Unclassified 815
31 Ga0070669_100091784 3300005353 Bacteria 2278
32 Ga0070669_100234107 3300005353 Bacteria 1457
33 Ga0070669_100643161 3300005353 Bacteria 892
34 Ga0070675_100003796 3300005354 Bacteria 11475
35 Ga0070675_100872445 3300005354 Unclassified 824
36 Ga0070675_101171453 3300005354 Unclassified 707
37 Ga0070675_101647428 3300005354 Unclassified 592
38 Ga0070671_100054617 3300005355 Bacteria 3321
39 Ga0070671_100210386 3300005355 Bacteria 1649
40 Ga0070671_100220916 3300005355 Bacteria 1607
41 Ga0070673_100052109 3300005364 Bacteria 3209
42 Ga0070673_100069325 3300005364 Bacteria 2826
43 Ga0070673_100940430 3300005364 Bacteria 803
44 Ga0070659_100162435 3300005366 Bacteria 1827
45 Ga0070659_100377181 3300005366 Bacteria 1194
46 Ga0070659_101091248 3300005366 Bacteria 703
47 Ga0070667_100000455 3300005367 Bacteria 42084
48 Ga0070667_100013238 3300005367 Bacteria 6816
49 Ga0070667_100621768 3300005367 Bacteria 996
50 Ga0070667_100880119 3300005367 Bacteria 833
51 Ga0070667_101072832 3300005367 Bacteria 752
52 Ga0070714_100050721 3300005435 Bacteria 3536
53 Ga0070714_100710481 3300005435 Unclassified 970
54 Ga0070713_100039876 3300005436 Bacteria 3815
55 Ga0070713_100258185 3300005436 Bacteria 1592
56 Ga0070713_100439207 3300005436 Bacteria 1224
57 Ga0070713_100497601 3300005436 Bacteria 1150
58 Ga0070710_10715711 3300005437 Bacteria 708
59 Ga0070711_100029695 3300005439 Bacteria 3611
60 Ga0070711_100109422 3300005439 Bacteria 2026
61 Ga0070705_100063385 3300005440 Bacteria 2205
62 Ga0070700_100028515 3300005441 Bacteria 3322
63 Ga0070694_100189919 3300005444 Bacteria 1525
64 Ga0070663_100023055 3300005455 Bacteria 4167
65 Ga0070663_100314762 3300005455 Bacteria 1257
66 Ga0070678_100060782 3300005456 Bacteria 2783
67 Ga0070662_100020915 3300005457 Bacteria 4463
68 Ga0070662_100066597 3300005457 Bacteria 2643
69 Ga0070662_100981173 3300005457 Bacteria 723
70 Ga0070681_10009271 3300005458 Bacteria 9676
71 Ga0070681_10042578 3300005458 Bacteria 4550
72 Ga0070681_10043940 3300005458 Bacteria 4472
73 Ga0070681_10045191 3300005458 Bacteria 4407
74 Ga0070681_10182794 3300005458 Bacteria 2018
75 Ga0070681_11331870 3300005458 Unclassified 641
76 Ga0068867_100024408 3300005459 Bacteria 4332
77 Ga0070685_10019662 3300005466 Bacteria 3648
78 Ga0070706_100481873 3300005467 Bacteria 1154
79 Ga0070706_101576335 3300005467 Bacteria 599
80 Ga0070679_100055650 3300005530 Bacteria 3940
81 Ga0070679_100089032 3300005530 Bacteria 3074
82 Ga0070679_100243831 3300005530 Bacteria 1754
83 Ga0070679_100243929 3300005530 Bacteria 1754
84 Ga0070679_100414505 3300005530 Bacteria 1292
85 Ga0070684_100027241 3300005535 Bacteria 4821
86 Ga0070684_100047998 3300005535 Bacteria 3703
87 Ga0070684_100541448 3300005535 Bacteria 1080
88 Ga0068853_100157804 3300005539 Bacteria 2045
89 Ga0068853_101761120 3300005539 Bacteria 600
90 Ga0070672_100011242 3300005543 Bacteria 6242
91 Ga0070686_100026177 3300005544 Bacteria 3518
92 Ga0070686_100089977 3300005544 Bacteria 2051
93 Ga0070693_100259511 3300005547 Bacteria 1155
94 Ga0070693_100521083 3300005547 Bacteria 846
95 Ga0070665_100008225 3300005548 Bacteria 10560
96 Ga0070665_100019892 3300005548 Bacteria 6741
97 Ga0070665_100056754 3300005548 Bacteria 3926
98 Ga0070665_100239051 3300005548 Bacteria 1817
99 Ga0070665_100401891 3300005548 Bacteria 1378
100 Ga0070665_101211150 3300005548 Bacteria 766
101 Ga0070704_101569885 3300005549 Bacteria 606
102 Ga0068855_100000392 3300005563 Bacteria 53969
103 Ga0068855_100001597 3300005563 Bacteria 28472
104 Ga0068855_100008729 3300005563 Bacteria 12253
105 Ga0068855_100205149 3300005563 Bacteria 2218
106 Ga0068855_100923035 3300005563 Bacteria 921
107 Ga0070664_100181294 3300005564 Bacteria 1872
108 Ga0068857_100012011 3300005577 Bacteria 7533
109 Ga0068857_100125916 3300005577 Bacteria 2308
110 Ga0068857_100555750 3300005577 Bacteria 1082
111 Ga0068854_100198195 3300005578 Bacteria 1577
112 Ga0068856_100004047 3300005614 Bacteria 14685
113 Ga0068856_100027578 3300005614 Bacteria 5540
114 Ga0068856_100104027 3300005614 Bacteria 2832
115 Ga0070702_100004325 3300005615 Bacteria 6477
116 Ga0068852_100833159 3300005616 Bacteria 937
117 Ga0068852_101110060 3300005616 Bacteria 811
118 Ga0068859_100000092 3300005617 Bacteria 82442
119 Ga0068859_100001034 3300005617 Bacteria 28510
120 Ga0068859_100034199 3300005617 Bacteria 5102
121 Ga0068859_100125209 3300005617 Bacteria 2639
122 Ga0068864_100053523 3300005618 Bacteria 3482
123 Ga0068864_100634669 3300005618 Bacteria 1039
124 Ga0068864_100855385 3300005618 Unclassified 896
125 Ga0068866_10009522 3300005718 Bacteria 4128
126 Ga0068866_10067119 3300005718 Bacteria 1882
127 Ga0068861_100000011 3300005719 Bacteria 82099
128 Ga0068861_100035493 3300005719 Bacteria 3694
129 Ga0068851_10085808 3300005834 Unclassified 1650
130 Ga0068870_10053832 3300005840 Bacteria 2139
131 Ga0068870_10196986 3300005840 Bacteria 1219
132 Ga0068863_100009047 3300005841 Bacteria 9723
133 Ga0068863_100014747 3300005841 Bacteria 7518
134 Ga0068863_100023640 3300005841 Bacteria 5867
135 Ga0068863_100207876 3300005841 Bacteria 1884
136 Ga0068863_102412561 3300005841 Bacteria 535
137 Ga0068858_100006868 3300005842 Bacteria 11059
138 Ga0068858_100007426 3300005842 Bacteria 10601
139 Ga0068858_100082830 3300005842 Bacteria 2982
140 Ga0068860_100004269 3300005843 Bacteria 14632
141 Ga0068860_100045523 3300005843 Bacteria 4184
142 Ga0068860_100961925 3300005843 Bacteria 871
143 Ga0068860_101002359 3300005843 Bacteria 853
144 Ga0068862_100000888 3300005844 Bacteria 29098
145 Ga0068862_100002301 3300005844 Bacteria 17066
146 Ga0068862_100013400 3300005844 Bacteria 6783
147 Ga0068862_101478416 3300005844 Bacteria 684
148 Ga0081455_10000016 3300005937 Bacteria 176679
149 Ga0081455_10158140 3300005937 Bacteria 1740
150 Ga0081539_10000060 3300005985 Bacteria 252799
151 Ga0070717_10029245 3300006028 Bacteria 4418
152 Ga0070715_10427283 3300006163 Unclassified 743
153 Ga0070716_100164797 3300006173 Bacteria 1440
154 Ga0070716_100361248 3300006173 Bacteria 1031
155 Ga0070712_100060593 3300006175 Bacteria 2670
156 Ga0070712_100215381 3300006175 Bacteria 1517
157 Ga0070712_100797251 3300006175 Bacteria 810
158 Ga0097621_100331903 3300006237 Unclassified 1349
159 Ga0097621_101006599 3300006237 Bacteria 780
160 Ga0097621_101395339 3300006237 Bacteria 663
161 Ga0068871_100401767 3300006358 Bacteria 1220
162 Ga0068871_100991522 3300006358 Bacteria 782
163 Ga0068871_101318555 3300006358 Bacteria 679
164 Ga0068871_101494549 3300006358 Bacteria 638
165 Ga0075428_100000063 3300006844 Bacteria 86012
166 Ga0075428_100010087 3300006844 Bacteria 10494
167 Ga0075428_100011126 3300006844 Bacteria 10013
168 Ga0075428_101898022 3300006844 Bacteria 619
169 Ga0075430_100007097 3300006846 Bacteria 9448
170 Ga0075430_100008776 3300006846 Bacteria 8530
171 Ga0075430_100053377 3300006846 Bacteria 3403
172 Ga0075430_100360402 3300006846 Bacteria 1201
173 Ga0075430_100447589 3300006846 Bacteria 1066
174 Ga0075430_100459386 3300006846 Bacteria 1051
175 Ga0075431_100000298 3300006847 Bacteria 39052
176 Ga0075431_100003650 3300006847 Bacteria 14923
177 Ga0075431_100007451 3300006847 Bacteria 10898
178 Ga0075431_100018918 3300006847 Bacteria 7016
179 Ga0075431_100089184 3300006847 Bacteria 3183
180 Ga0075431_100179092 3300006847 Bacteria 2176
181 Ga0075434_100630163 3300006871 Bacteria 1091
182 Ga0075429_100005716 3300006880 Bacteria 10730
183 Ga0075429_100016693 3300006880 Bacteria 6358
184 Ga0075429_100096222 3300006880 Bacteria 2583
185 Ga0075429_100251907 3300006880 Bacteria 1546
186 Ga0097620_100000092 3300006931 Bacteria 82442
187 Ga0097620_100001034 3300006931 Bacteria 28510
188 Ga0097620_100034199 3300006931 Bacteria 5102
189 Ga0097620_100125208 3300006931 Bacteria 2639
190 Ga0079104_1027601 3300006946 Bacteria 1453
191 Ga0099794_10220632 3300007265 Bacteria 974
192 Ga0099795_10008188 3300007788 Bacteria 2966
193 Ga0105250_10000031 3300009092 Bacteria 170328
194 Ga0105250_10005907 3300009092 Bacteria 5417
195 Ga0105250_10037645 3300009092 Bacteria 1940
196 Ga0105250_10143792 3300009092 Bacteria 990
197 Ga0105240_10001742 3300009093 Bacteria 36760
198 Ga0105240_10016076 3300009093 Bacteria 10139
199 Ga0105240_10022235 3300009093 Bacteria 8413
200 Ga0105240_10034991 3300009093 Bacteria 6476
201 Ga0105240_10051007 3300009093 Bacteria 5210
202 Ga0105240_10080442 3300009093 Bacteria 4007
203 Ga0105240_10164811 3300009093 Bacteria 2629
204 Ga0105240_10332079 3300009093 Bacteria 1730
205 Ga0105240_10339259 3300009093 Bacteria 1708
206 Ga0111539_10000428 3300009094 Bacteria 52857
207 Ga0111539_10010330 3300009094 Bacteria 11754
208 Ga0111539_10032635 3300009094 Bacteria 6322
209 Ga0111539_10078027 3300009094 Bacteria 3897
210 Ga0111539_10172799 3300009094 Bacteria 2524
211 Ga0111539_10884749 3300009094 Bacteria 1039
212 Ga0105245_10568061 3300009098 Bacteria 1158
213 Ga0105247_10000482 3300009101 Bacteria 33256
214 Ga0105247_10007371 3300009101 Bacteria 6757
215 Ga0105247_10150790 3300009101 Bacteria 1532
216 Ga0114129_10007442 3300009147 Bacteria 15595
217 Ga0114129_10145822 3300009147 Bacteria 3243
218 Ga0105243_12343055 3300009148 Bacteria 572
219 Ga0105241_10019394 3300009174 Bacteria 5014
220 Ga0105241_10336679 3300009174 Bacteria 1306
221 Ga0105241_10751493 3300009174 Bacteria 894
222 Ga0105241_10829127 3300009174 Bacteria 854
223 Ga0105241_11158045 3300009174 Bacteria 731
224 Ga0105242_10074774 3300009176 Bacteria 2819
225 Ga0105248_10005260 3300009177 Bacteria 14242
226 Ga0105248_10033557 3300009177 Bacteria 5735
227 Ga0105248_10088707 3300009177 Bacteria 3481
228 Ga0105237_10042229 3300009545 Bacteria 4600
229 Ga0105237_10100121 3300009545 Bacteria 2889
230 Ga0105237_10331497 3300009545 Bacteria 1526
231 Ga0105237_10481995 3300009545 Bacteria 1247
232 Ga0105237_10762756 3300009545 Bacteria 974
233 Ga0105237_10834266 3300009545 Bacteria 928
234 Ga0105237_11554545 3300009545 Unclassified 668
235 Ga0105238_10047524 3300009551 Bacteria 4326
236 Ga0105238_10052665 3300009551 Bacteria 4091
237 Ga0105238_10056304 3300009551 Bacteria 3945
238 Ga0105238_10079682 3300009551 Bacteria 3265
239 Ga0105238_10156877 3300009551 Bacteria 2251
240 Ga0105238_10415384 3300009551 Bacteria 1339
241 Ga0105238_11649597 3300009551 Unclassified 672
242 Ga0105238_12434992 3300009551 Unclassified 559
243 Ga0105249_10008115 3300009553 Bacteria 9153
244 Ga0105249_10073625 3300009553 Bacteria 3160
245 Ga0105249_10084364 3300009553 Bacteria 2958
246 Ga0105249_10106648 3300009553 Bacteria 2643
247 Ga0105249_10289876 3300009553 Bacteria 1638
248 Ga0105249_10400818 3300009553 Bacteria 1402
249 Ga0105249_10799456 3300009553 Bacteria 1007
250 Ga0099796_10021732 3300010159 Bacteria 1980
251 Ga0105239_10146473 3300010375 Unclassified 2634
252 Ga0105239_10573183 3300010375 Bacteria 1286
253 Ga0105239_10742520 3300010375 Unclassified 1123
254 Ga0105239_11521453 3300010375 Unclassified 773
255 Ga0105246_10084901 3300011119 Bacteria 2266
256 Ga0105246_10195242 3300011119 Bacteria 1570
257 Ga0105246_10905409 3300011119 Bacteria 791
258 Ga0157369_10023283 3300013105 Bacteria 6899
259 Ga0157369_10096890 3300013105 Bacteria 3146
260 Ga0157369_10627881 3300013105 Bacteria 1108
261 Ga0157369_10883122 3300013105 Bacteria 917
262 Ga0157374_10038537 3300013296 Bacteria 4394
263 Ga0157374_10577519 3300013296 Bacteria 1133
264 Ga0157378_10813997 3300013297 Bacteria 960
265 Ga0163162_10114758 3300013306 Bacteria 2793
266 Ga0163162_10122167 3300013306 Bacteria 2709
267 Ga0163162_10646610 3300013306 Bacteria 1181
268 Ga0163162_10857284 3300013306 Bacteria 1023
269 Ga0157372_10158176 3300013307 Bacteria 2618
270 Ga0157372_10348192 3300013307 Bacteria 1726
271 Ga0157372_10400366 3300013307 Unclassified 1600
272 Ga0157372_10767954 3300013307 Bacteria 1120
273 Ga0157372_10824616 3300013307 Bacteria 1077
274 Ga0157372_12149748 3300013307 Bacteria 641
275 Ga0157375_10055528 3300013308 Bacteria 3906
276 Ga0157375_10255823 3300013308 Bacteria 1912
277 Ga0163163_10030495 3300014325 Bacteria 5196
278 Ga0163163_10051897 3300014325 Bacteria 4044
279 Ga0163163_10095081 3300014325 Bacteria 2999
280 Ga0163163_10119562 3300014325 Bacteria 2668
281 Ga0163163_11748340 3300014325 Bacteria 682
282 Ga0157380_10017020 3300014326 Bacteria 5371
283 Ga0157380_10211485 3300014326 Bacteria 1729
284 Ga0157380_10350108 3300014326 Bacteria 1382
285 Ga0157380_10407320 3300014326 Bacteria 1292
286 Ga0157377_10012711 3300014745 Bacteria 4241
287 Ga0157379_10018854 3300014968 Bacteria 6087
288 Ga0157379_10137671 3300014968 Bacteria 2200
289 Ga0157379_10145998 3300014968 Bacteria 2133
290 Ga0157379_10394009 3300014968 Bacteria 1272
291 Ga0157379_10544970 3300014968 Bacteria 1079
292 Ga0157379_10903876 3300014968 Bacteria 838
293 Ga0157376_10369143 3300014969 Bacteria 1379
294 Ga0157376_10727490 3300014969 Bacteria 1000
295 Ga0157376_12229098 3300014969 Unclassified 587
296 Ga0182006_1000008 3300015261 Bacteria 449652
297 Ga0182005_1000008 3300015265 Bacteria 471394
298 Ga0163161_10301543 3300017792 Bacteria 1262
299 Ga0163161_10419686 3300017792 Bacteria 1076
300 Ga0163161_10653297 3300017792 Bacteria 872
301 Ga0163161_11313276 3300017792 Unclassified 629
302 Ga0213876_10143292 3300021384 Bacteria 1271
303 Ga0209148_1005584 3300025254 Bacteria 2861
304 Ga0209455_1000415 3300025272 Bacteria 34158
305 Ga0207656_10096370 3300025321 Bacteria 1350
306 Ga0207696_1000125 3300025711 Bacteria 138603
307 Ga0207692_10224286 3300025898 Bacteria 1115
308 Ga0207692_10905519 3300025898 Bacteria 580
309 Ga0207642_10037517 3300025899 Bacteria 2089
310 Ga0207710_10000962 3300025900 Bacteria 15164
311 Ga0207710_10112003 3300025900 Bacteria 1296
312 Ga0207688_10028551 3300025901 Bacteria 3069
313 Ga0207680_10044294 3300025903 Bacteria 2616
314 Ga0207680_10061639 3300025903 Bacteria 2288
315 Ga0207680_10263133 3300025903 Bacteria 1194
316 Ga0207680_10486494 3300025903 Bacteria 878
317 Ga0207647_10043235 3300025904 Bacteria 2820
318 Ga0207685_10096108 3300025905 Bacteria 1258
319 Ga0207645_10195195 3300025907 Bacteria 1331
320 Ga0207643_10016609 3300025908 Bacteria 4015
321 Ga0207643_10171636 3300025908 Bacteria 1309
322 Ga0207643_10205250 3300025908 Unclassified 1201
323 Ga0207684_10302649 3300025910 Bacteria 1379
324 Ga0207654_10440789 3300025911 Bacteria 912
325 Ga0207707_10008529 3300025912 Bacteria 8885
326 Ga0207707_10019302 3300025912 Bacteria 5950
327 Ga0207707_10021313 3300025912 Bacteria 5665
328 Ga0207707_10159707 3300025912 Bacteria 1971
329 Ga0207707_10247068 3300025912 Bacteria 1550
330 Ga0207695_10020298 3300025913 Bacteria 7615
331 Ga0207695_10028556 3300025913 Bacteria 6182
332 Ga0207695_10067797 3300025913 Bacteria 3658
333 Ga0207695_10083370 3300025913 Bacteria 3229
334 Ga0207695_10096811 3300025913 Bacteria 2953
335 Ga0207695_10109548 3300025913 Bacteria 2743
336 Ga0207695_10118721 3300025913 Bacteria 2615
337 Ga0207695_10349777 3300025913 Bacteria 1365
338 Ga0207695_10414347 3300025913 Bacteria 1232
339 Ga0207695_10534362 3300025913 Bacteria 1054
340 Ga0207671_10522893 3300025914 Bacteria 946
341 Ga0207671_10912553 3300025914 Unclassified 694
342 Ga0207693_10028614 3300025915 Bacteria 4404
343 Ga0207693_10123844 3300025915 Bacteria 2031
344 Ga0207663_10024741 3300025916 Bacteria 3462
345 Ga0207660_10133523 3300025917 Bacteria 1892
346 Ga0207660_10219013 3300025917 Bacteria 1493
347 Ga0207660_10250308 3300025917 Bacteria 1398
348 Ga0207660_10349558 3300025917 Bacteria 1185
349 Ga0207660_10880834 3300025917 Bacteria 731
350 Ga0207662_10019026 3300025918 Bacteria 3902
351 Ga0207649_10014316 3300025920 Bacteria 4439
352 Ga0207649_10252338 3300025920 Bacteria 1271
353 Ga0207652_10112524 3300025921 Bacteria 2416
354 Ga0207652_10143680 3300025921 Bacteria 2134
355 Ga0207652_10211692 3300025921 Bacteria 1745
356 Ga0207652_10303953 3300025921 Bacteria 1440
357 Ga0207681_10018138 3300025923 Bacteria 4431
358 Ga0207681_10019833 3300025923 Bacteria 4256
359 Ga0207681_10119595 3300025923 Bacteria 1930
360 Ga0207694_10131129 3300025924 Bacteria 2009
361 Ga0207694_10190755 3300025924 Bacteria 1665
362 Ga0207694_10292770 3300025924 Bacteria 1339
363 Ga0207694_10301691 3300025924 Bacteria 1319
364 Ga0207694_10494295 3300025924 Bacteria 1024
365 Ga0207694_10542591 3300025924 Bacteria 975
366 Ga0207694_10656072 3300025924 Bacteria 884
367 Ga0207650_10196792 3300025925 Bacteria 1613
368 Ga0207650_10257354 3300025925 Unclassified 1415
369 Ga0207650_10469008 3300025925 Bacteria 1049
370 Ga0207650_10890658 3300025925 Bacteria 755
371 Ga0207659_10038385 3300025926 Bacteria 3331
372 Ga0207659_11108433 3300025926 Unclassified 681
373 Ga0207700_10071177 3300025928 Bacteria 2677
374 Ga0207700_10153296 3300025928 Bacteria 1906
375 Ga0207700_10195251 3300025928 Bacteria 1703
376 Ga0207700_11022037 3300025928 Unclassified 739
377 Ga0207664_10022653 3300025929 Bacteria 4695
378 Ga0207644_10000849 3300025931 Bacteria 19352
379 Ga0207644_10070751 3300025931 Bacteria 2551
380 Ga0207644_10366601 3300025931 Bacteria 1173
381 Ga0207690_10262869 3300025932 Bacteria 1338
382 Ga0207690_10314366 3300025932 Bacteria 1229
383 Ga0207706_10029314 3300025933 Bacteria 4913
384 Ga0207706_10225533 3300025933 Bacteria 1640
385 Ga0207665_10207380 3300025939 Bacteria 1430
386 Ga0207665_10305866 3300025939 Bacteria 1190
387 Ga0207691_10022209 3300025940 Bacteria 5986
388 Ga0207689_10007824 3300025942 Bacteria 9347
389 Ga0207679_10298906 3300025945 Bacteria 1387
390 Ga0207667_10004010 3300025949 Bacteria 18096
391 Ga0207667_10008280 3300025949 Bacteria 12370
392 Ga0207667_10022293 3300025949 Bacteria 6999
393 Ga0207667_10399268 3300025949 Bacteria 1400
394 Ga0207667_10898239 3300025949 Bacteria 878
395 Ga0207651_10056253 3300025960 Bacteria 2706
396 Ga0207712_10025109 3300025961 Bacteria 3956
397 Ga0207712_10082802 3300025961 Bacteria 2340
398 Ga0207712_10170455 3300025961 Bacteria 1701
399 Ga0207712_10558765 3300025961 Bacteria 985
400 Ga0207668_10053771 3300025972 Bacteria 2792
401 Ga0207640_10169472 3300025981 Bacteria 1625
402 Ga0207658_10005893 3300025986 Bacteria 8375
403 Ga0207658_10235595 3300025986 Bacteria 1547
404 Ga0207658_10885531 3300025986 Bacteria 812
405 Ga0207703_10000318 3300026035 Bacteria 52249
406 Ga0207703_10000569 3300026035 Bacteria 37992
407 Ga0207703_11146149 3300026035 Bacteria 747
408 Ga0207639_10105324 3300026041 Bacteria 2288
409 Ga0207639_10169799 3300026041 Bacteria 1846
410 Ga0207678_10008627 3300026067 Bacteria 8983
411 Ga0207708_10042933 3300026075 Bacteria 3445
412 Ga0207702_10020022 3300026078 Bacteria 5544
413 Ga0207702_10878336 3300026078 Bacteria 888
414 Ga0207702_10918833 3300026078 Bacteria 867
415 Ga0207641_10006850 3300026088 Bacteria 9541
416 Ga0207641_10027150 3300026088 Bacteria 4727
417 Ga0207641_10098870 3300026088 Bacteria 2566
418 Ga0207641_11324485 3300026088 Bacteria 721
419 Ga0207648_10007613 3300026089 Bacteria 10616
420 Ga0207648_10398394 3300026089 Bacteria 1247
421 Ga0207676_11279324 3300026095 Unclassified 728
422 Ga0207674_10005707 3300026116 Bacteria 14753
423 Ga0207674_10013448 3300026116 Bacteria 9080
424 Ga0207674_10458894 3300026116 Bacteria 1231
425 Ga0207675_100001048 3300026118 Bacteria 27391
426 Ga0207675_100037930 3300026118 Bacteria 4496
427 Ga0207675_100615965 3300026118 Bacteria 1090
428 Ga0207683_10060481 3300026121 Bacteria 3330
429 Ga0207698_10317964 3300026142 Bacteria 1457
430 Ga0209281_1010131 3300027111 Bacteria 2174
431 Ga0207428_10005044 3300027907 Bacteria 12405
432 Ga0207428_10017053 3300027907 Bacteria 6239
433 Ga0207428_10118628 3300027907 Bacteria 2030
434 Ga0268266_10002296 3300028379 Bacteria 20741
435 Ga0268266_10153297 3300028379 Bacteria 2079
436 Ga0268266_10251683 3300028379 Bacteria 1634
437 Ga0268266_10604522 3300028379 Bacteria 1053
438 Ga0268266_10886791 3300028379 Bacteria 862
439 Ga0268265_10000313 3300028380 Bacteria 53636
440 Ga0268265_10324993 3300028380 Bacteria 1395
441 Ga0268265_11379604 3300028380 Bacteria 706
442 Ga0268264_10004984 3300028381 Bacteria 11243
443 Ga0268264_10015749 3300028381 Bacteria 6191
444 Ga0268264_11372393 3300028381 Bacteria 717
445 Ga0265334_10011925 3300028573 Bacteria 3651
446 Ga0307515_10001184 3300028794 Bacteria 59700
447 Ga0307515_10254863 3300028794 Bacteria 1501
448 Ga0307511_10076666 3300030521 Bacteria 2388
449 Ga0307511_10456755 3300030521 Bacteria 503
450 Ga0265328_10004713 3300031239 Bacteria 5894
451 Ga0265340_10127104 3300031247 Bacteria 1171
452 Ga0265331_10004757 3300031250 Bacteria 8380
453 Ga0265316_10028187 3300031344 Bacteria 4636
454 Ga0307509_10000001 3300031507 Bacteria 629324
455 Ga0307509_10000554 3300031507 Bacteria 63868
456 Ga0307509_10384335 3300031507 Bacteria 1116
457 Ga0307408_100017247 3300031548 Bacteria 4831
458 Ga0307408_100355033 3300031548 Bacteria 1245
459 Ga0307508_10159189 3300031616 Bacteria 1862
460 Ga0307508_10178293 3300031616 Bacteria 1728
461 Ga0307508_10235527 3300031616 Bacteria 1429
462 Ga0316575_10054691 3300031665 Bacteria 1589
463 Ga0265314_10313682 3300031711 Bacteria 875
464 Ga0316576_10080340 3300031727 Bacteria 2418
465 Ga0316576_10134942 3300031727 Bacteria 1857
466 Ga0316576_10142746 3300031727 Bacteria 1803
467 Ga0316578_10023547 3300031728 Bacteria 3446
468 Ga0307413_10423684 3300031824 Bacteria 1049
469 Ga0307410_10029566 3300031852 Bacteria 3491
470 Ga0307406_10389611 3300031901 Bacteria 1101
471 Ga0307409_100063729 3300031995 Bacteria 2892
472 Ga0307416_100682662 3300032002 Bacteria 1115
473 Ga0307416_100766924 3300032002 Bacteria 1058
474 Ga0307414_10833420 3300032004 Bacteria 843
475 Ga0307411_10005541 3300032005 Bacteria 6213
476 Ga0307411_10143875 3300032005 Bacteria 1762
477 Ga0307510_10000015 3300033180 Bacteria 258937
478 Ga0373949_0149880 3300035090 Bacteria 674
479 Ga0373951_0049530 3300035091 Bacteria 1031
480 Ga0373936_0012855 3300035113 Bacteria 3191
481 Ga0373962_0077850 3300035242 Bacteria 1002
482 Ga0316574_0005865 3300035398 Bacteria 6593
483 Ga0316574_0053238 3300035398 Bacteria 2526
484 Ga0316574_0073603 3300035398 Bacteria 2160
485 Ga0316574_0135596 3300035398 Bacteria 1585
486 Ga0373931_0087545 3300035691 Bacteria 1730
487 Ga0373931_0192299 3300035691 Bacteria 1215
488 Ga0373931_0330814 3300035691 Bacteria 949
489 Ga0316582_0341214 3300036647 Bacteria 1030
490 Ga0316584_0074685 3300036712 Bacteria 2541
491 Ga0316584_0118343 3300036712 Bacteria 1981
492 Ga0373925_0816262 3300037068 Bacteria 769
493 Ga0395900_0136641 3300037418 Bacteria 2512
494 Ga0395898_0115191 3300037466 Bacteria 2575
495 Ga0395905_1832136 3300037471 Unclassified 513
496 Ga0436364_1369752 3300037853 Bacteria 1165
497 Ga0436365_1779381 3300039437 Bacteria 2792
498 Ga0436360_0420608 3300039438 Bacteria 842
499 Ga0436363_0141791 3300039450 Bacteria 6171
500 Ga0436363_0779673 3300039450 Bacteria 893
501 Ga0439461_0146707 3300041410 Bacteria 607
502 Ga0439442_044239 3300042002 Bacteria 938
503 Ga0439457_153439 3300042014 Unclassified 555
504 Ga0450898_119414 3300042134 Bacteria 562
505 Ga0439444_0009016 3300042437 Bacteria 1564
506 Ga0439464_0084597 3300042439 Bacteria 951
507 Ga0451577_0004096 3300042876 Bacteria 15654
508 Ga0451577_0043777 3300042876 Bacteria 4009
509 Ga0451577_0161672 3300042876 Bacteria 2016
510 Ga0451577_0360128 3300042876 Bacteria 1319
511 Ga0451577_0452106 3300042876 Bacteria 1166
512 Ga0451577_0654313 3300042876 Bacteria 953
513 Ga0451577_1213028 3300042876 Unclassified 673
514 Ga0466969_0077784 3300044656 Bacteria 1587
515 Ga0466969_0299103 3300044656 Bacteria 728
516 Ga0466972_0126124 3300044658 Bacteria 1206
517 Ga0466965_0159623 3300044683 Bacteria 1182
518 Ga0466966_0021523 3300044684 Bacteria 4234
519 Ga0466966_0151508 3300044684 Bacteria 1414
520 Ga0466966_0167799 3300044684 Bacteria 1335
521 Ga0466966_0217036 3300044684 Bacteria 1155
522 Ga0466961_0261051 3300044693 Bacteria 1062
523 Ga0466964_0000478 3300044706 Bacteria 12333
524 Ga0453684_0411613 3300044712 Bacteria 1512
525 Ga0453684_0554213 3300044712 Bacteria 1266
526 Ga0453684_0571964 3300044712 Bacteria 1242
527 Ga0453684_1443869 3300044712 Bacteria 712
528 Ga0466971_0000470 3300044719 Bacteria 15837
529 Ga0466970_0025227 3300044765 Bacteria 3112
530 Ga0466957_0002617 3300044842 Bacteria 9705
531 Ga0466960_0021167 3300044901 Bacteria 2892
532 Ga0466959_0004566 3300045049 Bacteria 9292
533 Ga0466959_0005871 3300045049 Bacteria 8455
534 Ga0466959_0023734 3300045049 Bacteria 4540
535 Ga0466959_0054468 3300045049 Bacteria 2922
536 Ga0466959_0058237 3300045049 Bacteria 2814
537 Ga0466959_0184477 3300045049 Bacteria 1458
538 Ga0466959_0566920 3300045049 Unclassified 765
539 Ga0451576_0354354 3300045051 Bacteria 1536
540 Ga0466958_0092844 3300045836 Bacteria 1869
541 Ga0495627_000001 3300046453 Bacteria 1104709
542 Ga0495590_0175186 3300046457 Bacteria 783
543 Ga0495638_0000932 3300046460 Bacteria 29683
544 Ga0495582_0683247 3300046473 Bacteria 594
545 Ga0495606_0000449 3300046507 Bacteria 67234
546 Ga0495606_0435619 3300046507 Bacteria 675
547 Ga0495630_0590660 3300046517 Bacteria 851
548 Ga0495632_0026708 3300046519 Bacteria 3035
549 Ga0495632_0082221 3300046519 Bacteria 1535
550 Ga0495643_0171842 3300046522 Bacteria 1059
551 Ga0495609_0000667 3300046538 Bacteria 26626
552 Ga0495611_0536452 3300046648 Bacteria 530
553 Ga0495625_0003435 3300046660 Bacteria 15797
554 Ga0495671_0022729 3300046692 Bacteria 3282
555 Ga0495671_0582745 3300046692 Bacteria 532
556 Ga0495649_0312938 3300046694 Bacteria 798
557 Ga0495660_0000400 3300046810 Bacteria 37396
558 Ga0495660_0000647 3300046810 Bacteria 27034
559 Ga0495687_076708 3300047443 Bacteria 1322
560 Ga0495679_069083 3300047446 Bacteria 1021
561 Ga0495673_0082233 3300047469 Unclassified 1332
562 Ga0495681_0127418 3300047470 Bacteria 1086
563 Ga0495686_0669988 3300047472 Bacteria 531
564 Ga0496101_0299771 3300048904 Bacteria 1259
565 Ga0496102_0051798 3300048905 Bacteria 3739
566 Ga0496102_0078502 3300048905 Bacteria 3039
567 Ga0496102_0160941 3300048905 Bacteria 2112
568 Ga0496102_0210917 3300048905 Bacteria 1831
569 Ga0496103_0406641 3300048906 Bacteria 874
570 Ga0496104_0159001 3300048907 Bacteria 2168
571 Ga0496104_0646270 3300048907 Bacteria 967
572 Ga0496106_0204087 3300048909 Bacteria 1574
573 Ga0496107_0257713 3300048910 Bacteria 1298
574 Ga0496108_0020014 3300048911 Bacteria 5499
575 Ga0496109_0032431 3300048912 Bacteria 4696
576 Ga0496109_0862792 3300048912 Bacteria 843
577 Ga0496109_1455282 3300048912 Bacteria 620
578 Ga0496110_0078250 3300048913 Bacteria 2944
579 Ga0496112_0030321 3300048915 Bacteria 5233
580 Ga0496113_0043951 3300048916 Bacteria 3308
581 Ga0496115_0279494 3300048918 Unclassified 1371
582 Ga0496115_1149903 3300048918 Bacteria 586
583 Ga0496116_0016797 3300048919 Bacteria 5712
584 Ga0496116_0032043 3300048919 Bacteria 3753
585 Ga0496117_0000208 3300048920 Bacteria 113931
586 Ga0496117_0086115 3300048920 Bacteria 2043
587 Ga0496117_0189248 3300048920 Bacteria 1174
588 Ga0496118_0000005 3300048921 Bacteria 697350
589 Ga0496118_0015547 3300048921 Bacteria 7039
590 Ga0496118_0345110 3300048921 Bacteria 796
591 Ga0496119_0000983 3300048922 Bacteria 36653
592 Ga0496119_0003655 3300048922 Bacteria 15792
593 Ga0496120_0000199 3300048923 Bacteria 103142
594 Ga0496120_0043028 3300048923 Bacteria 2634
595 Ga0496121_0001978 3300048924 Bacteria 32561
596 Ga0496121_0028102 3300048924 Bacteria 5244
597 Ga0496121_0508052 3300048924 Bacteria 763
598 Ga0496124_0104529 3300048927 Bacteria 2290
599 Ga0496124_0379754 3300048927 Bacteria 988
600 Ga0496125_0003265 3300048928 Bacteria 19952
601 Ga0496125_0048773 3300048928 Bacteria 3526
602 Ga0496125_0087137 3300048928 Bacteria 2359
603 Ga0496126_0006026 3300048929 Bacteria 13607
604 Ga0496126_0088648 3300048929 Bacteria 2725
605 Ga0495678_000002 3300049459 Bacteria 999613
606 Ga0501037_0075157 3300049573 Bacteria 2454
607 Ga0501043_0340118 3300049579 Bacteria 1142
608 Ga0501047_0490289 3300049581 Bacteria 1056
609 Ga0501048_0270626 3300049582 Bacteria 1207
610 Ga0501072_0046065 3300049588 Bacteria 3431
611 Ga0501075_0495285 3300049591 Bacteria 932
612 Ga0501214_006239 3300049659 Bacteria 1177
613 Ga0501249_056265 3300049679 Bacteria 908
614 Ga0501035_0406385 3300049822 Bacteria 1132
615 Ga0501044_0597971 3300049823 Bacteria 996
616 Ga0501045_0017416 3300049824 Bacteria 5101
617 nmdc:mga05p37_119227_c1 3300050507 Bacteria 3242
618 nmdc:mga05p37_7589_c1 3300050507 Bacteria 12794
619 nmdc:mga09592_17903_c1 3300050508 Bacteria 5805
620 nmdc:mga09592_97499_c1 3300050508 Bacteria 2516
621 nmdc:mga09592_9989_c1 3300050508 Bacteria 7720
622 nmdc:mga0qj67_1028165_c1 3300050509 Unclassified 646
623 nmdc:mga0qj67_112863_c1 3300050509 Bacteria 2194
624 nmdc:mga0qj67_122705_c1 3300050509 Bacteria 2102
625 nmdc:mga0qj67_342063_c1 3300050509 Bacteria 1210
626 nmdc:mga0qj67_3628_c1 3300050509 Bacteria 11139
627 nmdc:mga0qj67_497912_c1 3300050509 Bacteria 980
628 nmdc:mga0qj67_58991_c1 3300050509 Bacteria 3043
629 nmdc:mga0qj67_6592_c1 3300050509 Bacteria 8530
630 nmdc:mga0qj67_763115_c1 3300050509 Bacteria 767
631 nmdc:mga06r32_1040355_c1 3300050510 Bacteria 770
632 nmdc:mga06r32_1127223_c1 3300050510 Bacteria 733
633 nmdc:mga06r32_1204_c1 3300050510 Bacteria 14841
634 nmdc:mga06r32_181_c1 3300050510 Bacteria 49505
635 nmdc:mga06r32_256658_c1 3300050510 Bacteria 1736
636 nmdc:mga06r32_283906_c1 3300050510 Bacteria 1642
637 nmdc:mga06r32_370_c1 3300050510 Bacteria 37940
638 nmdc:mga06r32_5580_c1 3300050510 Bacteria 11326
639 nmdc:mga08y16_16866_c1 3300050511 Bacteria 7689
640 nmdc:mga08y16_204011_c1 3300050511 Bacteria 2049
641 nmdc:mga08y16_3086_c1 3300050511 Bacteria 17228
642 nmdc:mga0n895_416185_c1 3300050512 Bacteria 1359
643 nmdc:mga0rr50_410930_c1 3300050513 Bacteria 1144
644 nmdc:mga0a205_1124261_c1 3300050515 Bacteria 633
645 nmdc:mga0a205_469497_c1 3300050515 Bacteria 1117
646 nmdc:mga0a205_683756_c1 3300050515 Bacteria 876
647 Ga0500644_0011984 3300053088 Bacteria 2385
648 Ga0500583_0082219 3300053092 Bacteria 1557
649 Ga0500583_0101567 3300053092 Bacteria 1409
650 Ga0500583_0108738 3300053092 Unclassified 1363
651 Ga0500583_0347530 3300053092 Bacteria 719
652 Ga0500651_0179121 3300053093 Bacteria 1260
653 Ga0500651_0373198 3300053093 Bacteria 806
654 Ga0500641_0014877 3300053096 Bacteria 2877
655 Ga0500556_0070350 3300053104 Bacteria 1306
656 Ga0500562_063693 3300053108 Bacteria 992
657 Ga0500562_077323 3300053108 Bacteria 900
658 Ga0500591_063212 3300053115 Bacteria 1700
659 Ga0500594_0177865 3300053118 Bacteria 693
660 Ga0500617_033350 3300053124 Bacteria 2306
661 Ga0500642_0066447 3300053130 Bacteria 1632
662 Ga0500642_0259738 3300053130 Bacteria 795
663 Ga0500652_067352 3300053131 Bacteria 1480
664 Ga0500652_118413 3300053131 Bacteria 1107
665 Ga0500655_023346 3300053133 Bacteria 1168
666 Ga0500658_0048482 3300053134 Unclassified 1727
667 Ga0500658_0092238 3300053134 Bacteria 1311
668 Ga0500568_0041422 3300053139 Bacteria 1850
669 Ga0500577_0297902 3300053142 Bacteria 704
670 Ga0500588_0006679 3300053146 Bacteria 2627
671 Ga0500590_170219 3300053148 Bacteria 959
672 Ga0500622_0035953 3300053156 Bacteria 2590
673 Ga0500627_0244881 3300053158 Bacteria 795
674 Ga0500627_0383132 3300053158 Bacteria 602
675 Ga0500637_0008894 3300053178 Bacteria 5089
676 Ga0500637_0021154 3300053178 Bacteria 3532
677 Ga0500637_0025197 3300053178 Bacteria 3266
678 Ga0500637_0080013 3300053178 Bacteria 1887
679 Ga0500596_025439 3300053735 Bacteria 903
680 Ga0501082_0117803 3300060353 Bacteria 2301
681 Ga0466962_0008334 3300061719 Bacteria 4966

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2857553236 2857555184 147
2 iso_pu_bacteria 2919476304 2919477532 147
3 3300006946 Ga0079104_1027601 Ga0079104_10276012 151
4 3300015261 Ga0182006_1000008 Ga0182006_1000008199 151
5 3300015265 Ga0182005_1000008 Ga0182005_1000008398 151
6 3300027111 Ga0209281_1010131 Ga0209281_10101312 151
7 3300035398 Ga0316574_0135596 Ga0316574_0135596_621_1076 151
8 3300042876 Ga0451577_0043777 Ga0451577_0043777_1995_2450 151
9 3300046453 Ga0495627_000001 Ga0495627_000001_405574_406032 151
10 3300046507 Ga0495606_0000449 Ga0495606_0000449_14901_15359 151
11 3300046538 Ga0495609_0000667 Ga0495609_0000667_20479_20937 151
12 3300046810 Ga0495660_0000400 Ga0495660_0000400_20538_20996 151
13 3300046810 Ga0495660_0000647 Ga0495660_0000647_5212_5670 151
14 3300047446 Ga0495679_069083 Ga0495679_069083_407_865 151
15 3300047470 Ga0495681_0127418 Ga0495681_0127418_613_1071 151
16 3300048919 Ga0496116_0016797 Ga0496116_0016797_719_1177 151
17 3300048927 Ga0496124_0104529 Ga0496124_0104529_1188_1646 151
18 3300049459 Ga0495678_000002 Ga0495678_000002_103962_104420 151
19 3300005937 Ga0081455_10000016 Ga0081455_1000001623 152
20 3300005985 Ga0081539_10000060 Ga0081539_1000006074 152
21 3300009553 Ga0105249_10106648 Ga0105249_101066483 152
22 3300009553 Ga0105249_10799456 Ga0105249_107994562 152
23 3300025961 Ga0207712_10082802 Ga0207712_100828023 152
24 3300028794 Ga0307515_10254863 Ga0307515_102548632 152
25 3300031507 Ga0307509_10384335 Ga0307509_103843352 152
26 3300044658 Ga0466972_0126124 Ga0466972_0126124_232_690 152
27 3300044683 Ga0466965_0159623 Ga0466965_0159623_313_771 152
28 3300044901 Ga0466960_0021167 Ga0466960_0021167_190_648 152
29 3300049573 Ga0501037_0075157 Ga0501037_0075157_298_816 152
30 3300049581 Ga0501047_0490289 Ga0501047_0490289_152_610 152
31 3300049822 Ga0501035_0406385 Ga0501035_0406385_422_940 152
32 3300049823 Ga0501044_0597971 Ga0501044_0597971_180_698 152
33 3300053092 Ga0500583_0082219 Ga0500583_0082219_145_603 152
34 3300053108 Ga0500562_077323 Ga0500562_077323_134_592 152
35 3300053130 Ga0500642_0259738 Ga0500642_0259738_247_705 152
36 3300053134 Ga0500658_0092238 Ga0500658_0092238_842_1300 152
37 3300053142 Ga0500577_0297902 Ga0500577_0297902_203_661 152
38 3300053158 Ga0500627_0383132 Ga0500627_0383132_86_544 152
39 3300003316 rootH1_10045185 rootH1_100451855 153
40 3300003323 rootH1_10000183 rootH1_100001832 153
41 3300003323 rootH1_10027822 rootH1_100278222 153
42 3300005293 Ga0065715_10130591 Ga0065715_101305913 153
43 3300005295 Ga0065707_10082632 Ga0065707_100826324 153
44 3300005295 Ga0065707_10098644 Ga0065707_100986444 153
45 3300005327 Ga0070658_10157495 Ga0070658_101574953 153
46 3300005328 Ga0070676_10155833 Ga0070676_101558332 153
47 3300005330 Ga0070690_100015129 Ga0070690_1000151293 153
48 3300005331 Ga0070670_100035627 Ga0070670_1000356272 153
49 3300005331 Ga0070670_100508339 Ga0070670_1005083392 153
50 3300005334 Ga0068869_100008053 Ga0068869_1000080536 153
51 3300005335 Ga0070666_10025693 Ga0070666_100256934 153
52 3300005335 Ga0070666_10085450 Ga0070666_100854502 153
53 3300005336 Ga0070680_100039302 Ga0070680_1000393024 153
54 3300005336 Ga0070680_100040752 Ga0070680_1000407524 153
55 3300005336 Ga0070680_100077678 Ga0070680_1000776781 153
56 3300005336 Ga0070680_100336615 Ga0070680_1003366152 153
57 3300005337 Ga0070682_100612757 Ga0070682_1006127572 153
58 3300005337 Ga0070682_101365767 Ga0070682_1013657671 153
59 3300005340 Ga0070689_100011375 Ga0070689_1000113754 153
60 3300005344 Ga0070661_100017056 Ga0070661_1000170564 153
61 3300005344 Ga0070661_100164259 Ga0070661_1001642592 153
62 3300005344 Ga0070661_100424054 Ga0070661_1004240542 153
63 3300005345 Ga0070692_10406471 Ga0070692_104064712 153
64 3300005347 Ga0070668_100019556 Ga0070668_1000195566 153
65 3300005353 Ga0070669_100091784 Ga0070669_1000917841 153
66 3300005353 Ga0070669_100234107 Ga0070669_1002341071 153
67 3300005354 Ga0070675_100003796 Ga0070675_1000037962 153
68 3300005355 Ga0070671_100054617 Ga0070671_1000546173 153
69 3300005355 Ga0070671_100210386 Ga0070671_1002103862 153
70 3300005364 Ga0070673_100052109 Ga0070673_1000521092 153
71 3300005366 Ga0070659_100162435 Ga0070659_1001624352 153
72 3300005366 Ga0070659_100377181 Ga0070659_1003771812 153
73 3300005366 Ga0070659_101091248 Ga0070659_1010912481 153
74 3300005367 Ga0070667_100000455 Ga0070667_10000045518 153
75 3300005367 Ga0070667_100013238 Ga0070667_1000132383 153
76 3300005367 Ga0070667_100621768 Ga0070667_1006217681 153
77 3300005367 Ga0070667_100880119 Ga0070667_1008801191 153
78 3300005367 Ga0070667_101072832 Ga0070667_1010728321 153
79 3300005435 Ga0070714_100710481 Ga0070714_1007104811 153
80 3300005436 Ga0070713_100258185 Ga0070713_1002581852 153
81 3300005436 Ga0070713_100439207 Ga0070713_1004392072 153
82 3300005436 Ga0070713_100497601 Ga0070713_1004976011 153
83 3300005440 Ga0070705_100063385 Ga0070705_1000633852 153
84 3300005441 Ga0070700_100028515 Ga0070700_1000285152 153
85 3300005444 Ga0070694_100189919 Ga0070694_1001899192 153
86 3300005455 Ga0070663_100023055 Ga0070663_1000230553 153
87 3300005455 Ga0070663_100314762 Ga0070663_1003147622 153
88 3300005456 Ga0070678_100060782 Ga0070678_1000607822 153
89 3300005457 Ga0070662_100020915 Ga0070662_1000209154 153
90 3300005457 Ga0070662_100066597 Ga0070662_1000665973 153
91 3300005458 Ga0070681_10009271 Ga0070681_100092718 153
92 3300005458 Ga0070681_10042578 Ga0070681_100425785 153
93 3300005458 Ga0070681_10043940 Ga0070681_100439402 153
94 3300005458 Ga0070681_10045191 Ga0070681_100451912 153
95 3300005458 Ga0070681_10182794 Ga0070681_101827942 153
96 3300005458 Ga0070681_11331870 Ga0070681_113318701 153
97 3300005459 Ga0068867_100024408 Ga0068867_1000244084 153
98 3300005466 Ga0070685_10019662 Ga0070685_100196623 153
99 3300005467 Ga0070706_100481873 Ga0070706_1004818732 153
100 3300005467 Ga0070706_101576335 Ga0070706_1015763351 153
101 3300005530 Ga0070679_100055650 Ga0070679_1000556502 153
102 3300005530 Ga0070679_100089032 Ga0070679_1000890322 153
103 3300005530 Ga0070679_100243831 Ga0070679_1002438312 153
104 3300005530 Ga0070679_100243929 Ga0070679_1002439292 153
105 3300005530 Ga0070679_100414505 Ga0070679_1004145052 153
106 3300005535 Ga0070684_100027241 Ga0070684_1000272414 153
107 3300005535 Ga0070684_100047998 Ga0070684_1000479984 153
108 3300005535 Ga0070684_100541448 Ga0070684_1005414482 153
109 3300005539 Ga0068853_100157804 Ga0068853_1001578042 153
110 3300005539 Ga0068853_101761120 Ga0068853_1017611201 153
111 3300005543 Ga0070672_100011242 Ga0070672_1000112426 153
112 3300005544 Ga0070686_100026177 Ga0070686_1000261772 153
113 3300005544 Ga0070686_100089977 Ga0070686_1000899773 153
114 3300005547 Ga0070693_100259511 Ga0070693_1002595111 153
115 3300005547 Ga0070693_100521083 Ga0070693_1005210831 153
116 3300005548 Ga0070665_100008225 Ga0070665_1000082254 153
117 3300005548 Ga0070665_100019892 Ga0070665_1000198923 153
118 3300005548 Ga0070665_100056754 Ga0070665_1000567542 153
119 3300005548 Ga0070665_100239051 Ga0070665_1002390513 153
120 3300005548 Ga0070665_100401891 Ga0070665_1004018912 153
121 3300005549 Ga0070704_101569885 Ga0070704_1015698851 153
122 3300005563 Ga0068855_100001597 Ga0068855_10000159713 153
123 3300005563 Ga0068855_100008729 Ga0068855_1000087298 153
124 3300005563 Ga0068855_100205149 Ga0068855_1002051493 153
125 3300005563 Ga0068855_100923035 Ga0068855_1009230351 153
126 3300005564 Ga0070664_100181294 Ga0070664_1001812942 153
127 3300005577 Ga0068857_100012011 Ga0068857_1000120111 153
128 3300005577 Ga0068857_100125916 Ga0068857_1001259163 153
129 3300005577 Ga0068857_100555750 Ga0068857_1005557501 153
130 3300005578 Ga0068854_100198195 Ga0068854_1001981952 153
131 3300005614 Ga0068856_100104027 Ga0068856_1001040273 153
132 3300005615 Ga0070702_100004325 Ga0070702_1000043252 153
133 3300005616 Ga0068852_100833159 Ga0068852_1008331592 153
134 3300005616 Ga0068852_101110060 Ga0068852_1011100601 153
135 3300005617 Ga0068859_100000092 Ga0068859_10000009232 153
136 3300005617 Ga0068859_100001034 Ga0068859_1000010346 153
137 3300005617 Ga0068859_100034199 Ga0068859_1000341992 153
138 3300005618 Ga0068864_100053523 Ga0068864_1000535232 153
139 3300005618 Ga0068864_100634669 Ga0068864_1006346692 153
140 3300005718 Ga0068866_10009522 Ga0068866_100095226 153
141 3300005718 Ga0068866_10067119 Ga0068866_100671192 153
142 3300005719 Ga0068861_100000011 Ga0068861_10000001174 153
143 3300005719 Ga0068861_100035493 Ga0068861_1000354932 153
144 3300005834 Ga0068851_10085808 Ga0068851_100858083 153
145 3300005840 Ga0068870_10053832 Ga0068870_100538322 153
146 3300005840 Ga0068870_10196986 Ga0068870_101969862 153
147 3300005841 Ga0068863_100009047 Ga0068863_1000090478 153
148 3300005841 Ga0068863_100014747 Ga0068863_1000147476 153
149 3300005841 Ga0068863_100023640 Ga0068863_1000236408 153
150 3300005841 Ga0068863_100207876 Ga0068863_1002078762 153
151 3300005842 Ga0068858_100006868 Ga0068858_10000686810 153
152 3300005842 Ga0068858_100007426 Ga0068858_1000074269 153
153 3300005842 Ga0068858_100082830 Ga0068858_1000828304 153
154 3300005843 Ga0068860_100004269 Ga0068860_1000042696 153
155 3300005843 Ga0068860_100045523 Ga0068860_1000455237 153
156 3300005843 Ga0068860_101002359 Ga0068860_1010023591 153
157 3300005844 Ga0068862_100000888 Ga0068862_1000008887 153
158 3300005844 Ga0068862_100002301 Ga0068862_10000230113 153
159 3300005844 Ga0068862_100013400 Ga0068862_10001340010 153
160 3300005844 Ga0068862_101478416 Ga0068862_1014784162 153
161 3300006173 Ga0070716_100164797 Ga0070716_1001647972 153
162 3300006175 Ga0070712_100215381 Ga0070712_1002153812 153
163 3300006175 Ga0070712_100797251 Ga0070712_1007972511 153
164 3300006237 Ga0097621_100331903 Ga0097621_1003319032 153
165 3300006237 Ga0097621_101006599 Ga0097621_1010065991 153
166 3300006358 Ga0068871_100401767 Ga0068871_1004017672 153
167 3300006358 Ga0068871_100991522 Ga0068871_1009915222 153
168 3300006844 Ga0075428_100000063 Ga0075428_10000006354 153
169 3300006844 Ga0075428_100010087 Ga0075428_1000100878 153
170 3300006844 Ga0075428_100011126 Ga0075428_1000111265 153
171 3300006846 Ga0075430_100007097 Ga0075430_10000709711 153
172 3300006846 Ga0075430_100008776 Ga0075430_1000087767 153
173 3300006846 Ga0075430_100053377 Ga0075430_1000533772 153
174 3300006846 Ga0075430_100360402 Ga0075430_1003604022 153
175 3300006846 Ga0075430_100447589 Ga0075430_1004475891 153
176 3300006846 Ga0075430_100459386 Ga0075430_1004593862 153
177 3300006847 Ga0075431_100000298 Ga0075431_10000029811 153
178 3300006847 Ga0075431_100003650 Ga0075431_10000365014 153
179 3300006847 Ga0075431_100007451 Ga0075431_10000745112 153
180 3300006847 Ga0075431_100089184 Ga0075431_1000891842 153
181 3300006847 Ga0075431_100179092 Ga0075431_1001790923 153
182 3300006880 Ga0075429_100005716 Ga0075429_1000057164 153
183 3300006880 Ga0075429_100016693 Ga0075429_1000166932 153
184 3300006880 Ga0075429_100096222 Ga0075429_1000962222 153
185 3300006880 Ga0075429_100251907 Ga0075429_1002519072 153
186 3300006931 Ga0097620_100000092 Ga0097620_10000009232 153
187 3300006931 Ga0097620_100001034 Ga0097620_1000010346 153
188 3300006931 Ga0097620_100034199 Ga0097620_1000341992 153
189 3300007265 Ga0099794_10220632 Ga0099794_102206322 153
190 3300007788 Ga0099795_10008188 Ga0099795_100081882 153
191 3300009092 Ga0105250_10000031 Ga0105250_10000031109 153
192 3300009092 Ga0105250_10005907 Ga0105250_100059073 153
193 3300009092 Ga0105250_10037645 Ga0105250_100376452 153
194 3300009092 Ga0105250_10143792 Ga0105250_101437922 153
195 3300009093 Ga0105240_10001742 Ga0105240_1000174212 153
196 3300009093 Ga0105240_10016076 Ga0105240_1001607610 153
197 3300009093 Ga0105240_10022235 Ga0105240_100222352 153
198 3300009093 Ga0105240_10034991 Ga0105240_100349916 153
199 3300009093 Ga0105240_10051007 Ga0105240_100510073 153
200 3300009093 Ga0105240_10080442 Ga0105240_100804422 153
201 3300009093 Ga0105240_10164811 Ga0105240_101648114 153
202 3300009093 Ga0105240_10332079 Ga0105240_103320792 153
203 3300009093 Ga0105240_10339259 Ga0105240_103392592 153
204 3300009094 Ga0111539_10000428 Ga0111539_1000042835 153
205 3300009094 Ga0111539_10010330 Ga0111539_100103302 153
206 3300009094 Ga0111539_10032635 Ga0111539_100326352 153
207 3300009094 Ga0111539_10078027 Ga0111539_100780275 153
208 3300009098 Ga0105245_10568061 Ga0105245_105680612 153
209 3300009101 Ga0105247_10000482 Ga0105247_100004827 153
210 3300009101 Ga0105247_10007371 Ga0105247_100073715 153
211 3300009101 Ga0105247_10150790 Ga0105247_101507902 153
212 3300009147 Ga0114129_10007442 Ga0114129_1000744211 153
213 3300009147 Ga0114129_10145822 Ga0114129_101458222 153
214 3300009148 Ga0105243_12343055 Ga0105243_123430551 153
215 3300009174 Ga0105241_10019394 Ga0105241_100193946 153
216 3300009174 Ga0105241_10336679 Ga0105241_103366792 153
217 3300009174 Ga0105241_10751493 Ga0105241_107514932 153
218 3300009174 Ga0105241_10829127 Ga0105241_108291272 153
219 3300009174 Ga0105241_11158045 Ga0105241_111580452 153
220 3300009176 Ga0105242_10074774 Ga0105242_100747741 153
221 3300009177 Ga0105248_10005260 Ga0105248_1000526011 153
222 3300009177 Ga0105248_10033557 Ga0105248_100335574 153
223 3300009177 Ga0105248_10088707 Ga0105248_100887075 153
224 3300009545 Ga0105237_10042229 Ga0105237_100422295 153
225 3300009545 Ga0105237_10100121 Ga0105237_101001214 153
226 3300009545 Ga0105237_10331497 Ga0105237_103314972 153
227 3300009545 Ga0105237_10481995 Ga0105237_104819952 153
228 3300009545 Ga0105237_10762756 Ga0105237_107627562 153
229 3300009545 Ga0105237_10834266 Ga0105237_108342662 153
230 3300009545 Ga0105237_11554545 Ga0105237_115545451 153
231 3300009551 Ga0105238_10047524 Ga0105238_100475242 153
232 3300009551 Ga0105238_10052665 Ga0105238_100526653 153
233 3300009551 Ga0105238_10079682 Ga0105238_100796823 153
234 3300009551 Ga0105238_10156877 Ga0105238_101568773 153
235 3300009551 Ga0105238_10415384 Ga0105238_104153842 153
236 3300009551 Ga0105238_11649597 Ga0105238_116495971 153
237 3300009551 Ga0105238_12434992 Ga0105238_124349921 153
238 3300009553 Ga0105249_10008115 Ga0105249_100081156 153
239 3300009553 Ga0105249_10073625 Ga0105249_100736253 153
240 3300009553 Ga0105249_10084364 Ga0105249_100843642 153
241 3300009553 Ga0105249_10289876 Ga0105249_102898762 153
242 3300009553 Ga0105249_10400818 Ga0105249_104008182 153
243 3300010159 Ga0099796_10021732 Ga0099796_100217322 153
244 3300010375 Ga0105239_10146473 Ga0105239_101464734 153
245 3300010375 Ga0105239_10573183 Ga0105239_105731832 153
246 3300010375 Ga0105239_11521453 Ga0105239_115214531 153
247 3300011119 Ga0105246_10084901 Ga0105246_100849012 153
248 3300011119 Ga0105246_10195242 Ga0105246_101952421 153
249 3300011119 Ga0105246_10905409 Ga0105246_109054091 153
250 3300013105 Ga0157369_10023283 Ga0157369_100232836 153
251 3300013105 Ga0157369_10096890 Ga0157369_100968903 153
252 3300013105 Ga0157369_10627881 Ga0157369_106278812 153
253 3300013105 Ga0157369_10883122 Ga0157369_108831222 153
254 3300013296 Ga0157374_10038537 Ga0157374_100385374 153
255 3300013296 Ga0157374_10577519 Ga0157374_105775192 153
256 3300013297 Ga0157378_10813997 Ga0157378_108139972 153
257 3300013306 Ga0163162_10114758 Ga0163162_101147582 153
258 3300013306 Ga0163162_10122167 Ga0163162_101221673 153
259 3300013306 Ga0163162_10646610 Ga0163162_106466102 153
260 3300013306 Ga0163162_10857284 Ga0163162_108572841 153
261 3300013307 Ga0157372_10158176 Ga0157372_101581763 153
262 3300013307 Ga0157372_10348192 Ga0157372_103481922 153
263 3300013307 Ga0157372_10400366 Ga0157372_104003662 153
264 3300013307 Ga0157372_10767954 Ga0157372_107679542 153
265 3300013307 Ga0157372_10824616 Ga0157372_108246162 153
266 3300013307 Ga0157372_12149748 Ga0157372_121497481 153
267 3300013308 Ga0157375_10055528 Ga0157375_100555284 153
268 3300014325 Ga0163163_10030495 Ga0163163_100304953 153
269 3300014325 Ga0163163_10051897 Ga0163163_100518973 153
270 3300014325 Ga0163163_10095081 Ga0163163_100950812 153
271 3300014325 Ga0163163_10119562 Ga0163163_101195622 153
272 3300014325 Ga0163163_11748340 Ga0163163_117483401 153
273 3300014326 Ga0157380_10017020 Ga0157380_100170205 153
274 3300014326 Ga0157380_10407320 Ga0157380_104073202 153
275 3300014745 Ga0157377_10012711 Ga0157377_100127114 153
276 3300014968 Ga0157379_10018854 Ga0157379_100188544 153
277 3300014968 Ga0157379_10137671 Ga0157379_101376713 153
278 3300014968 Ga0157379_10145998 Ga0157379_101459982 153
279 3300014968 Ga0157379_10394009 Ga0157379_103940092 153
280 3300014968 Ga0157379_10544970 Ga0157379_105449702 153
281 3300014968 Ga0157379_10903876 Ga0157379_109038762 153
282 3300014969 Ga0157376_10369143 Ga0157376_103691432 153
283 3300014969 Ga0157376_12229098 Ga0157376_122290981 153
284 3300017792 Ga0163161_10301543 Ga0163161_103015432 153
285 3300017792 Ga0163161_11313276 Ga0163161_113132761 153
286 3300021384 Ga0213876_10143292 Ga0213876_101432922 153
287 3300025321 Ga0207656_10096370 Ga0207656_100963702 153
288 3300025711 Ga0207696_1000125 Ga0207696_100012575 153
289 3300025898 Ga0207692_10224286 Ga0207692_102242862 153
290 3300025899 Ga0207642_10037517 Ga0207642_100375172 153
291 3300025900 Ga0207710_10000962 Ga0207710_100009622 153
292 3300025900 Ga0207710_10112003 Ga0207710_101120032 153
293 3300025901 Ga0207688_10028551 Ga0207688_100285514 153
294 3300025903 Ga0207680_10044294 Ga0207680_100442942 153
295 3300025903 Ga0207680_10061639 Ga0207680_100616392 153
296 3300025903 Ga0207680_10263133 Ga0207680_102631332 153
297 3300025903 Ga0207680_10486494 Ga0207680_104864942 153
298 3300025904 Ga0207647_10043235 Ga0207647_100432352 153
299 3300025907 Ga0207645_10195195 Ga0207645_101951952 153
300 3300025908 Ga0207643_10016609 Ga0207643_100166093 153
301 3300025908 Ga0207643_10171636 Ga0207643_101716362 153
302 3300025910 Ga0207684_10302649 Ga0207684_103026492 153
303 3300025911 Ga0207654_10440789 Ga0207654_104407892 153
304 3300025912 Ga0207707_10008529 Ga0207707_100085294 153
305 3300025912 Ga0207707_10019302 Ga0207707_100193026 153
306 3300025912 Ga0207707_10021313 Ga0207707_100213136 153
307 3300025912 Ga0207707_10159707 Ga0207707_101597072 153
308 3300025912 Ga0207707_10247068 Ga0207707_102470682 153
309 3300025913 Ga0207695_10020298 Ga0207695_100202984 153
310 3300025913 Ga0207695_10028556 Ga0207695_100285562 153
311 3300025913 Ga0207695_10083370 Ga0207695_100833703 153
312 3300025913 Ga0207695_10096811 Ga0207695_100968112 153
313 3300025913 Ga0207695_10109548 Ga0207695_101095483 153
314 3300025913 Ga0207695_10118721 Ga0207695_101187212 153
315 3300025913 Ga0207695_10349777 Ga0207695_103497772 153
316 3300025913 Ga0207695_10414347 Ga0207695_104143471 153
317 3300025913 Ga0207695_10534362 Ga0207695_105343622 153
318 3300025914 Ga0207671_10522893 Ga0207671_105228931 153
319 3300025914 Ga0207671_10912553 Ga0207671_109125531 153
320 3300025915 Ga0207693_10123844 Ga0207693_101238442 153
321 3300025917 Ga0207660_10133523 Ga0207660_101335232 153
322 3300025917 Ga0207660_10219013 Ga0207660_102190132 153
323 3300025917 Ga0207660_10250308 Ga0207660_102503081 153
324 3300025917 Ga0207660_10349558 Ga0207660_103495582 153
325 3300025917 Ga0207660_10880834 Ga0207660_108808341 153
326 3300025918 Ga0207662_10019026 Ga0207662_100190263 153
327 3300025920 Ga0207649_10014316 Ga0207649_100143164 153
328 3300025920 Ga0207649_10252338 Ga0207649_102523381 153
329 3300025921 Ga0207652_10112524 Ga0207652_101125242 153
330 3300025921 Ga0207652_10143680 Ga0207652_101436802 153
331 3300025921 Ga0207652_10211692 Ga0207652_102116922 153
332 3300025921 Ga0207652_10303953 Ga0207652_103039532 153
333 3300025923 Ga0207681_10018138 Ga0207681_100181383 153
334 3300025923 Ga0207681_10019833 Ga0207681_100198332 153
335 3300025924 Ga0207694_10131129 Ga0207694_101311291 153
336 3300025924 Ga0207694_10190755 Ga0207694_101907552 153
337 3300025924 Ga0207694_10292770 Ga0207694_102927702 153
338 3300025924 Ga0207694_10494295 Ga0207694_104942952 153
339 3300025924 Ga0207694_10542591 Ga0207694_105425911 153
340 3300025924 Ga0207694_10656072 Ga0207694_106560721 153
341 3300025925 Ga0207650_10196792 Ga0207650_101967922 153
342 3300025925 Ga0207650_10469008 Ga0207650_104690082 153
343 3300025928 Ga0207700_10071177 Ga0207700_100711772 153
344 3300025928 Ga0207700_10195251 Ga0207700_101952512 153
345 3300025928 Ga0207700_11022037 Ga0207700_110220371 153
346 3300025931 Ga0207644_10000849 Ga0207644_1000084922 153
347 3300025931 Ga0207644_10070751 Ga0207644_100707512 153
348 3300025932 Ga0207690_10262869 Ga0207690_102628692 153
349 3300025932 Ga0207690_10314366 Ga0207690_103143662 153
350 3300025933 Ga0207706_10029314 Ga0207706_100293146 153
351 3300025933 Ga0207706_10225533 Ga0207706_102255332 153
352 3300025939 Ga0207665_10207380 Ga0207665_102073802 153
353 3300025940 Ga0207691_10022209 Ga0207691_100222096 153
354 3300025942 Ga0207689_10007824 Ga0207689_100078246 153
355 3300025945 Ga0207679_10298906 Ga0207679_102989062 153
356 3300025949 Ga0207667_10008280 Ga0207667_100082807 153
357 3300025949 Ga0207667_10022293 Ga0207667_100222936 153
358 3300025949 Ga0207667_10399268 Ga0207667_103992682 153
359 3300025949 Ga0207667_10898239 Ga0207667_108982391 153
360 3300025960 Ga0207651_10056253 Ga0207651_100562532 153
361 3300025961 Ga0207712_10025109 Ga0207712_100251092 153
362 3300025961 Ga0207712_10170455 Ga0207712_101704552 153
363 3300025961 Ga0207712_10558765 Ga0207712_105587652 153
364 3300025972 Ga0207668_10053771 Ga0207668_100537712 153
365 3300025981 Ga0207640_10169472 Ga0207640_101694722 153
366 3300025986 Ga0207658_10005893 Ga0207658_100058934 153
367 3300025986 Ga0207658_10235595 Ga0207658_102355951 153
368 3300025986 Ga0207658_10885531 Ga0207658_108855312 153
369 3300026035 Ga0207703_10000318 Ga0207703_1000031832 153
370 3300026035 Ga0207703_10000569 Ga0207703_100005691 153
371 3300026035 Ga0207703_11146149 Ga0207703_111461491 153
372 3300026041 Ga0207639_10105324 Ga0207639_101053241 153
373 3300026041 Ga0207639_10169799 Ga0207639_101697992 153
374 3300026067 Ga0207678_10008627 Ga0207678_100086276 153
375 3300026075 Ga0207708_10042933 Ga0207708_100429332 153
376 3300026078 Ga0207702_10878336 Ga0207702_108783362 153
377 3300026078 Ga0207702_10918833 Ga0207702_109188331 153
378 3300026088 Ga0207641_10006850 Ga0207641_100068503 153
379 3300026088 Ga0207641_10027150 Ga0207641_100271504 153
380 3300026088 Ga0207641_10098870 Ga0207641_100988703 153
381 3300026089 Ga0207648_10007613 Ga0207648_1000761311 153
382 3300026116 Ga0207674_10005707 Ga0207674_1000570716 153
383 3300026116 Ga0207674_10013448 Ga0207674_100134483 153
384 3300026118 Ga0207675_100001048 Ga0207675_1000010488 153
385 3300026118 Ga0207675_100037930 Ga0207675_1000379303 153
386 3300026121 Ga0207683_10060481 Ga0207683_100604813 153
387 3300026142 Ga0207698_10317964 Ga0207698_103179642 153
388 3300027907 Ga0207428_10005044 Ga0207428_100050449 153
389 3300027907 Ga0207428_10017053 Ga0207428_100170533 153
390 3300027907 Ga0207428_10118628 Ga0207428_101186282 153
391 3300028379 Ga0268266_10002296 Ga0268266_1000229621 153
392 3300028379 Ga0268266_10153297 Ga0268266_101532972 153
393 3300028379 Ga0268266_10251683 Ga0268266_102516832 153
394 3300028379 Ga0268266_10604522 Ga0268266_106045221 153
395 3300028379 Ga0268266_10886791 Ga0268266_108867911 153
396 3300028380 Ga0268265_10000313 Ga0268265_1000031319 153
397 3300028380 Ga0268265_11379604 Ga0268265_113796041 153
398 3300028381 Ga0268264_10004984 Ga0268264_100049846 153
399 3300028381 Ga0268264_10015749 Ga0268264_100157497 153
400 3300028573 Ga0265334_10011925 Ga0265334_100119253 153
401 3300030521 Ga0307511_10076666 Ga0307511_100766662 153
402 3300030521 Ga0307511_10456755 Ga0307511_104567551 153
403 3300031239 Ga0265328_10004713 Ga0265328_100047132 153
404 3300031247 Ga0265340_10127104 Ga0265340_101271042 153
405 3300031250 Ga0265331_10004757 Ga0265331_100047578 153
406 3300031344 Ga0265316_10028187 Ga0265316_100281872 153
407 3300031507 Ga0307509_10000001 Ga0307509_10000001527 153
408 3300031507 Ga0307509_10000554 Ga0307509_100005544 153
409 3300031548 Ga0307408_100017247 Ga0307408_1000172472 153
410 3300031548 Ga0307408_100355033 Ga0307408_1003550332 153
411 3300031616 Ga0307508_10159189 Ga0307508_101591892 153
412 3300031616 Ga0307508_10178293 Ga0307508_101782932 153
413 3300031616 Ga0307508_10235527 Ga0307508_102355272 153
414 3300031711 Ga0265314_10313682 Ga0265314_103136821 153
415 3300031824 Ga0307413_10423684 Ga0307413_104236842 153
416 3300031901 Ga0307406_10389611 Ga0307406_103896112 153
417 3300032002 Ga0307416_100766924 Ga0307416_1007669242 153
418 3300032004 Ga0307414_10833420 Ga0307414_108334202 153
419 3300032005 Ga0307411_10143875 Ga0307411_101438752 153
420 3300033180 Ga0307510_10000015 Ga0307510_10000015143 153
421 3300035090 Ga0373949_0149880 Ga0373949_0149880_33_494 153
422 3300035091 Ga0373951_0049530 Ga0373951_0049530_344_805 153
423 3300035113 Ga0373936_0012855 Ga0373936_0012855_123_584 153
424 3300035242 Ga0373962_0077850 Ga0373962_0077850_420_881 153
425 3300035691 Ga0373931_0087545 Ga0373931_0087545_1241_1702 153
426 3300035691 Ga0373931_0192299 Ga0373931_0192299_235_696 153
427 3300035691 Ga0373931_0330814 Ga0373931_0330814_43_504 153
428 3300037068 Ga0373925_0816262 Ga0373925_0816262_214_675 153
429 3300037418 Ga0395900_0136641 Ga0395900_0136641_971_1432 153
430 3300037466 Ga0395898_0115191 Ga0395898_0115191_477_938 153
431 3300037471 Ga0395905_1832136 Ga0395905_1832136_28_489 153
432 3300037853 Ga0436364_1369752 Ga0436364_1369752_477_938 153
433 3300039437 Ga0436365_1779381 Ga0436365_1779381_2085_2546 153
434 3300039438 Ga0436360_0420608 Ga0436360_0420608_369_830 153
435 3300039450 Ga0436363_0779673 Ga0436363_0779673_112_573 153
436 3300041410 Ga0439461_0146707 Ga0439461_0146707_119_583 153
437 3300042002 Ga0439442_044239 Ga0439442_044239_284_844 153
438 3300042014 Ga0439457_153439 Ga0439457_153439_56_517 153
439 3300042134 Ga0450898_119414 Ga0450898_119414_79_540 153
440 3300042437 Ga0439444_0009016 Ga0439444_0009016_676_1140 153
441 3300042439 Ga0439464_0084597 Ga0439464_0084597_286_747 153
442 3300042876 Ga0451577_0004096 Ga0451577_0004096_13132_13608 153
443 3300044656 Ga0466969_0077784 Ga0466969_0077784_1057_1518 153
444 3300044656 Ga0466969_0299103 Ga0466969_0299103_38_499 153
445 3300044684 Ga0466966_0021523 Ga0466966_0021523_1005_1466 153
446 3300044684 Ga0466966_0151508 Ga0466966_0151508_544_1005 153
447 3300044684 Ga0466966_0167799 Ga0466966_0167799_388_849 153
448 3300044684 Ga0466966_0217036 Ga0466966_0217036_382_843 153
449 3300044693 Ga0466961_0261051 Ga0466961_0261051_305_766 153
450 3300044706 Ga0466964_0000478 Ga0466964_0000478_7428_7889 153
451 3300044712 Ga0453684_0571964 Ga0453684_0571964_659_1135 153
452 3300044719 Ga0466971_0000470 Ga0466971_0000470_6001_6462 153
453 3300044765 Ga0466970_0025227 Ga0466970_0025227_2272_2733 153
454 3300044842 Ga0466957_0002617 Ga0466957_0002617_1604_2065 153
455 3300045049 Ga0466959_0004566 Ga0466959_0004566_8067_8528 153
456 3300045049 Ga0466959_0005871 Ga0466959_0005871_5276_5737 153
457 3300045049 Ga0466959_0023734 Ga0466959_0023734_1435_1896 153
458 3300045049 Ga0466959_0054468 Ga0466959_0054468_556_1017 153
459 3300045049 Ga0466959_0058237 Ga0466959_0058237_2038_2499 153
460 3300045049 Ga0466959_0184477 Ga0466959_0184477_297_758 153
461 3300045049 Ga0466959_0566920 Ga0466959_0566920_195_656 153
462 3300045051 Ga0451576_0354354 Ga0451576_0354354_917_1378 153
463 3300045836 Ga0466958_0092844 Ga0466958_0092844_1199_1660 153
464 3300046457 Ga0495590_0175186 Ga0495590_0175186_235_696 153
465 3300046460 Ga0495638_0000932 Ga0495638_0000932_5832_6305 153
466 3300046473 Ga0495582_0683247 Ga0495582_0683247_79_540 153
467 3300046507 Ga0495606_0435619 Ga0495606_0435619_62_523 153
468 3300046517 Ga0495630_0590660 Ga0495630_0590660_357_818 153
469 3300046519 Ga0495632_0082221 Ga0495632_0082221_561_1022 153
470 3300046522 Ga0495643_0171842 Ga0495643_0171842_480_941 153
471 3300046648 Ga0495611_0536452 Ga0495611_0536452_14_475 153
472 3300046660 Ga0495625_0003435 Ga0495625_0003435_13204_13677 153
473 3300046692 Ga0495671_0022729 Ga0495671_0022729_1238_1708 153
474 3300046692 Ga0495671_0582745 Ga0495671_0582745_39_500 153
475 3300046694 Ga0495649_0312938 Ga0495649_0312938_52_513 153
476 3300047443 Ga0495687_076708 Ga0495687_076708_71_532 153
477 3300047469 Ga0495673_0082233 Ga0495673_0082233_372_833 153
478 3300047472 Ga0495686_0669988 Ga0495686_0669988_60_521 153
479 3300048905 Ga0496102_0078502 Ga0496102_0078502_795_1256 153
480 3300048905 Ga0496102_0210917 Ga0496102_0210917_1058_1519 153
481 3300048906 Ga0496103_0406641 Ga0496103_0406641_291_752 153
482 3300048907 Ga0496104_0646270 Ga0496104_0646270_468_929 153
483 3300048910 Ga0496107_0257713 Ga0496107_0257713_504_965 153
484 3300048911 Ga0496108_0020014 Ga0496108_0020014_4404_4865 153
485 3300048912 Ga0496109_0032431 Ga0496109_0032431_2740_3201 153
486 3300048912 Ga0496109_1455282 Ga0496109_1455282_57_518 153
487 3300048913 Ga0496110_0078250 Ga0496110_0078250_1933_2394 153
488 3300048915 Ga0496112_0030321 Ga0496112_0030321_4238_4699 153
489 3300048916 Ga0496113_0043951 Ga0496113_0043951_248_709 153
490 3300048918 Ga0496115_1149903 Ga0496115_1149903_55_516 153
491 3300048919 Ga0496116_0032043 Ga0496116_0032043_738_1199 153
492 3300048920 Ga0496117_0000208 Ga0496117_0000208_7672_8133 153
493 3300048920 Ga0496117_0086115 Ga0496117_0086115_465_938 153
494 3300048921 Ga0496118_0000005 Ga0496118_0000005_408111_408572 153
495 3300048921 Ga0496118_0345110 Ga0496118_0345110_64_525 153
496 3300048922 Ga0496119_0000983 Ga0496119_0000983_33459_33920 153
497 3300048922 Ga0496119_0003655 Ga0496119_0003655_14058_14519 153
498 3300048923 Ga0496120_0000199 Ga0496120_0000199_54726_55187 153
499 3300048923 Ga0496120_0043028 Ga0496120_0043028_674_1135 153
500 3300048924 Ga0496121_0001978 Ga0496121_0001978_13127_13588 153
501 3300048924 Ga0496121_0028102 Ga0496121_0028102_3847_4368 153
502 3300048924 Ga0496121_0508052 Ga0496121_0508052_283_744 153
503 3300048927 Ga0496124_0379754 Ga0496124_0379754_498_959 153
504 3300048928 Ga0496125_0003265 Ga0496125_0003265_15103_15564 153
505 3300048928 Ga0496125_0048773 Ga0496125_0048773_1451_1912 153
506 3300048928 Ga0496125_0087137 Ga0496125_0087137_1784_2245 153
507 3300048929 Ga0496126_0006026 Ga0496126_0006026_6759_7220 153
508 3300048929 Ga0496126_0088648 Ga0496126_0088648_511_972 153
509 3300049579 Ga0501043_0340118 Ga0501043_0340118_349_810 153
510 3300049582 Ga0501048_0270626 Ga0501048_0270626_635_1099 153
511 3300049588 Ga0501072_0046065 Ga0501072_0046065_2573_3037 153
512 3300049591 Ga0501075_0495285 Ga0501075_0495285_423_887 153
513 3300049659 Ga0501214_006239 Ga0501214_006239_334_795 153
514 3300049679 Ga0501249_056265 Ga0501249_056265_239_700 153
515 3300049824 Ga0501045_0017416 Ga0501045_0017416_461_925 153
516 3300050507 nmdc:mga05p37_119227_c1 nmdc:mga05p37_119227_c1_654_1115 153
517 3300050507 nmdc:mga05p37_7589_c1 nmdc:mga05p37_7589_c1_4832_5293 153
518 3300050508 nmdc:mga09592_17903_c1 nmdc:mga09592_17903_c1_316_777 153
519 3300050508 nmdc:mga09592_97499_c1 nmdc:mga09592_97499_c1_433_894 153
520 3300050508 nmdc:mga09592_9989_c1 nmdc:mga09592_9989_c1_2593_3054 153
521 3300050509 nmdc:mga0qj67_1028165_c1 nmdc:mga0qj67_1028165_c1_162_623 153
522 3300050509 nmdc:mga0qj67_112863_c1 nmdc:mga0qj67_112863_c1_1125_1586 153
523 3300050509 nmdc:mga0qj67_122705_c1 nmdc:mga0qj67_122705_c1_1613_2074 153
524 3300050509 nmdc:mga0qj67_342063_c1 nmdc:mga0qj67_342063_c1_436_900 153
525 3300050509 nmdc:mga0qj67_3628_c1 nmdc:mga0qj67_3628_c1_8045_8506 153
526 3300050509 nmdc:mga0qj67_497912_c1 nmdc:mga0qj67_497912_c1_159_620 153
527 3300050509 nmdc:mga0qj67_6592_c1 nmdc:mga0qj67_6592_c1_3807_4268 153
528 3300050509 nmdc:mga0qj67_763115_c1 nmdc:mga0qj67_763115_c1_109_570 153
529 3300050510 nmdc:mga06r32_1040355_c1 nmdc:mga06r32_1040355_c1_45_506 153
530 3300050510 nmdc:mga06r32_1127223_c1 nmdc:mga06r32_1127223_c1_234_695 153
531 3300050510 nmdc:mga06r32_1204_c1 nmdc:mga06r32_1204_c1_7039_7500 153
532 3300050510 nmdc:mga06r32_181_c1 nmdc:mga06r32_181_c1_9723_10184 153
533 3300050510 nmdc:mga06r32_256658_c1 nmdc:mga06r32_256658_c1_289_753 153
534 3300050510 nmdc:mga06r32_370_c1 nmdc:mga06r32_370_c1_2989_3450 153
535 3300050511 nmdc:mga08y16_16866_c1 nmdc:mga08y16_16866_c1_5204_5665 153
536 3300050511 nmdc:mga08y16_204011_c1 nmdc:mga08y16_204011_c1_1413_1874 153
537 3300050511 nmdc:mga08y16_3086_c1 nmdc:mga08y16_3086_c1_13010_13471 153
538 3300050512 nmdc:mga0n895_416185_c1 nmdc:mga0n895_416185_c1_682_1143 153
539 3300050513 nmdc:mga0rr50_410930_c1 nmdc:mga0rr50_410930_c1_468_929 153
540 3300050515 nmdc:mga0a205_1124261_c1 nmdc:mga0a205_1124261_c1_64_525 153
541 3300050515 nmdc:mga0a205_683756_c1 nmdc:mga0a205_683756_c1_180_641 153
542 3300053088 Ga0500644_0011984 Ga0500644_0011984_1769_2230 153
543 3300053092 Ga0500583_0101567 Ga0500583_0101567_238_699 153
544 3300053092 Ga0500583_0347530 Ga0500583_0347530_46_507 153
545 3300053093 Ga0500651_0179121 Ga0500651_0179121_206_667 153
546 3300053093 Ga0500651_0373198 Ga0500651_0373198_203_664 153
547 3300053104 Ga0500556_0070350 Ga0500556_0070350_651_1112 153
548 3300053115 Ga0500591_063212 Ga0500591_063212_33_494 153
549 3300053118 Ga0500594_0177865 Ga0500594_0177865_149_610 153
550 3300053124 Ga0500617_033350 Ga0500617_033350_101_562 153
551 3300053130 Ga0500642_0066447 Ga0500642_0066447_1105_1566 153
552 3300053131 Ga0500652_067352 Ga0500652_067352_381_842 153
553 3300053131 Ga0500652_118413 Ga0500652_118413_12_473 153
554 3300053133 Ga0500655_023346 Ga0500655_023346_292_753 153
555 3300053134 Ga0500658_0048482 Ga0500658_0048482_26_487 153
556 3300053139 Ga0500568_0041422 Ga0500568_0041422_85_546 153
557 3300053146 Ga0500588_0006679 Ga0500588_0006679_2105_2566 153
558 3300053148 Ga0500590_170219 Ga0500590_170219_36_497 153
559 3300053156 Ga0500622_0035953 Ga0500622_0035953_1236_1697 153
560 3300053158 Ga0500627_0244881 Ga0500627_0244881_111_572 153
561 3300053178 Ga0500637_0008894 Ga0500637_0008894_48_509 153
562 3300053178 Ga0500637_0021154 Ga0500637_0021154_2868_3329 153
563 3300053178 Ga0500637_0025197 Ga0500637_0025197_764_1225 153
564 3300053178 Ga0500637_0080013 Ga0500637_0080013_541_1002 153
565 3300053735 Ga0500596_025439 Ga0500596_025439_285_746 153
566 3300060353 Ga0501082_0117803 Ga0501082_0117803_485_949 153
567 3300061719 Ga0466962_0008334 Ga0466962_0008334_2195_2656 153
568 3300005338 Ga0068868_100291310 Ga0068868_1002913102 154
569 3300005347 Ga0070668_100847046 Ga0070668_1008470461 154
570 3300005353 Ga0070669_100643161 Ga0070669_1006431612 154
571 3300005354 Ga0070675_101171453 Ga0070675_1011714531 154
572 3300005354 Ga0070675_101647428 Ga0070675_1016474281 154
573 3300005355 Ga0070671_100220916 Ga0070671_1002209163 154
574 3300005364 Ga0070673_100069325 Ga0070673_1000693252 154
575 3300005364 Ga0070673_100940430 Ga0070673_1009404301 154
576 3300005435 Ga0070714_100050721 Ga0070714_1000507213 154
577 3300005436 Ga0070713_100039876 Ga0070713_1000398762 154
578 3300005437 Ga0070710_10715711 Ga0070710_107157111 154
579 3300005439 Ga0070711_100109422 Ga0070711_1001094222 154
580 3300005457 Ga0070662_100981173 Ga0070662_1009811731 154
581 3300005548 Ga0070665_101211150 Ga0070665_1012111502 154
582 3300005563 Ga0068855_100000392 Ga0068855_10000039222 154
583 3300005614 Ga0068856_100004047 Ga0068856_10000404714 154
584 3300005614 Ga0068856_100027578 Ga0068856_1000275785 154
585 3300005617 Ga0068859_100125209 Ga0068859_1001252092 154
586 3300005618 Ga0068864_100855385 Ga0068864_1008553851 154
587 3300005841 Ga0068863_102412561 Ga0068863_1024125611 154
588 3300005843 Ga0068860_100961925 Ga0068860_1009619251 154
589 3300005937 Ga0081455_10158140 Ga0081455_101581402 154
590 3300006028 Ga0070717_10029245 Ga0070717_100292453 154
591 3300006173 Ga0070716_100361248 Ga0070716_1003612481 154
592 3300006237 Ga0097621_101395339 Ga0097621_1013953391 154
593 3300006358 Ga0068871_101318555 Ga0068871_1013185551 154
594 3300006844 Ga0075428_101898022 Ga0075428_1018980221 154
595 3300006847 Ga0075431_100018918 Ga0075431_1000189184 154
596 3300006871 Ga0075434_100630163 Ga0075434_1006301632 154
597 3300006931 Ga0097620_100125208 Ga0097620_1001252082 154
598 3300009094 Ga0111539_10172799 Ga0111539_101727992 154
599 3300009094 Ga0111539_10884749 Ga0111539_108847491 154
600 3300009551 Ga0105238_10056304 Ga0105238_100563046 154
601 3300010375 Ga0105239_10742520 Ga0105239_107425202 154
602 3300013308 Ga0157375_10255823 Ga0157375_102558232 154
603 3300014326 Ga0157380_10211485 Ga0157380_102114851 154
604 3300014326 Ga0157380_10350108 Ga0157380_103501082 154
605 3300014969 Ga0157376_10727490 Ga0157376_107274902 154
606 3300017792 Ga0163161_10419686 Ga0163161_104196862 154
607 3300017792 Ga0163161_10653297 Ga0163161_106532971 154
608 3300025898 Ga0207692_10905519 Ga0207692_109055191 154
609 3300025908 Ga0207643_10205250 Ga0207643_102052502 154
610 3300025913 Ga0207695_10067797 Ga0207695_100677972 154
611 3300025916 Ga0207663_10024741 Ga0207663_100247413 154
612 3300025923 Ga0207681_10119595 Ga0207681_101195952 154
613 3300025924 Ga0207694_10301691 Ga0207694_103016912 154
614 3300025925 Ga0207650_10257354 Ga0207650_102573542 154
615 3300025925 Ga0207650_10890658 Ga0207650_108906582 154
616 3300025926 Ga0207659_10038385 Ga0207659_100383852 154
617 3300025926 Ga0207659_11108433 Ga0207659_111084332 154
618 3300025928 Ga0207700_10153296 Ga0207700_101532962 154
619 3300025929 Ga0207664_10022653 Ga0207664_100226534 154
620 3300025931 Ga0207644_10366601 Ga0207644_103666012 154
621 3300025939 Ga0207665_10305866 Ga0207665_103058662 154
622 3300025949 Ga0207667_10004010 Ga0207667_100040107 154
623 3300026078 Ga0207702_10020022 Ga0207702_100200225 154
624 3300026088 Ga0207641_11324485 Ga0207641_113244852 154
625 3300026089 Ga0207648_10398394 Ga0207648_103983942 154
626 3300026095 Ga0207676_11279324 Ga0207676_112793241 154
627 3300026116 Ga0207674_10458894 Ga0207674_104588942 154
628 3300026118 Ga0207675_100615965 Ga0207675_1006159652 154
629 3300028380 Ga0268265_10324993 Ga0268265_103249932 154
630 3300028381 Ga0268264_11372393 Ga0268264_113723932 154
631 3300028794 Ga0307515_10001184 Ga0307515_1000118419 154
632 3300031665 Ga0316575_10054691 Ga0316575_100546911 154
633 3300031727 Ga0316576_10080340 Ga0316576_100803402 154
634 3300031727 Ga0316576_10134942 Ga0316576_101349422 154
635 3300031728 Ga0316578_10023547 Ga0316578_100235474 154
636 3300035398 Ga0316574_0005865 Ga0316574_0005865_711_1175 154
637 3300035398 Ga0316574_0073603 Ga0316574_0073603_414_878 154
638 3300036647 Ga0316582_0341214 Ga0316582_0341214_10_474 154
639 3300036712 Ga0316584_0074685 Ga0316584_0074685_895_1359 154
640 3300036712 Ga0316584_0118343 Ga0316584_0118343_1465_1929 154
641 3300039450 Ga0436363_0141791 Ga0436363_0141791_5573_6037 154
642 3300042876 Ga0451577_1213028 Ga0451577_1213028_95_559 154
643 3300044712 Ga0453684_1443869 Ga0453684_1443869_187_651 154
644 3300046519 Ga0495632_0026708 Ga0495632_0026708_132_599 154
645 3300048905 Ga0496102_0051798 Ga0496102_0051798_952_1416 154
646 3300048905 Ga0496102_0160941 Ga0496102_0160941_1330_1797 154
647 3300048907 Ga0496104_0159001 Ga0496104_0159001_1258_1725 154
648 3300048909 Ga0496106_0204087 Ga0496106_0204087_489_992 154
649 3300048912 Ga0496109_0862792 Ga0496109_0862792_186_653 154
650 3300048920 Ga0496117_0189248 Ga0496117_0189248_540_1004 154
651 3300048921 Ga0496118_0015547 Ga0496118_0015547_1508_1972 154
652 3300050509 nmdc:mga0qj67_58991_c1 nmdc:mga0qj67_58991_c1_20_568 154
653 3300050510 nmdc:mga06r32_283906_c1 nmdc:mga06r32_283906_c1_148_666 154
654 3300050510 nmdc:mga06r32_5580_c1 nmdc:mga06r32_5580_c1_9476_10024 154
655 3300050515 nmdc:mga0a205_469497_c1 nmdc:mga0a205_469497_c1_67_570 154
656 3300053092 Ga0500583_0108738 Ga0500583_0108738_708_1175 154
657 3300053096 Ga0500641_0014877 Ga0500641_0014877_162_629 154
658 3300053108 Ga0500562_063693 Ga0500562_063693_100_567 154
659 3300032002 Ga0307416_100682662 Ga0307416_1006826622 155
660 3300042876 Ga0451577_0161672 Ga0451577_0161672_57_524 155
661 3300044712 Ga0453684_0411613 Ga0453684_0411613_693_1163 155
662 3300025254 Ga0209148_1005584 Ga0209148_10055844 156
663 3300025272 Ga0209455_1000415 Ga0209455_100041521 156
664 3300031727 Ga0316576_10142746 Ga0316576_101427462 156
665 3300031852 Ga0307410_10029566 Ga0307410_100295662 156
666 3300031995 Ga0307409_100063729 Ga0307409_1000637293 156
667 3300032005 Ga0307411_10005541 Ga0307411_100055416 156
668 3300035398 Ga0316574_0053238 Ga0316574_0053238_1975_2451 156
669 3300042876 Ga0451577_0360128 Ga0451577_0360128_400_870 156
670 3300042876 Ga0451577_0452106 Ga0451577_0452106_264_734 156
671 3300042876 Ga0451577_0654313 Ga0451577_0654313_450_920 156
672 3300044712 Ga0453684_0554213 Ga0453684_0554213_213_683 156
673 2162886007 SwRhRL2b_contig_1383463 SwRhRL2b_0421.00004470 157
674 3300005354 Ga0070675_100872445 Ga0070675_1008724452 157
675 3300005439 Ga0070711_100029695 Ga0070711_1000296954 157
676 3300006163 Ga0070715_10427283 Ga0070715_104272831 157
677 3300006175 Ga0070712_100060593 Ga0070712_1000605932 157
678 3300006358 Ga0068871_101494549 Ga0068871_1014945492 157
679 3300025905 Ga0207685_10096108 Ga0207685_100961082 157
680 3300025915 Ga0207693_10028614 Ga0207693_100286144 157
681 3300048904 Ga0496101_0299771 Ga0496101_0299771_720_1229 157
682 3300048918 Ga0496115_0279494 Ga0496115_0279494_734_1243 157

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13404

HTH_AsnC-type

AsnC-type helix-turn-helix domain

36

77

0.99

PF13412

HTH_24

Winged helix-turn-helix DNA-binding

36

83

0.98

PF01037

AsnC_trans_reg

Lrp/AsnC ligand binding domain

102

176

0.97

PF12840

HTH_20

Helix-turn-helix domain

41

85

0.97

PF09339

HTH_IclR

IclR helix-turn-helix domain

42

84

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3i4p-assembly1.cif.gz_A crystal structure of asnc family transcriptional regulator from agrobacterium tumefaciens 0.97 4 151
2gqq-assembly1.cif.gz_A-2 crystal structure of e. coli leucine-responsive regulatory protein (lrp) 0.9619 4 154
2p5v-assembly1.cif.gz_A crystal structure of transcriptional regulator nmb0573 from neisseria meningitidis 0.9599 1 154
2gqq-assembly1.cif.gz_A-2 crystal structure of e. coli leucine-responsive regulatory protein (lrp) 0.9437 4 154
2vc1-assembly1.cif.gz_B feast or famine regulatory protein (rv3291c)from m. tuberculosis complexed with l-methionine 0.9383 2 150
ID Description Score Start End Superfamily
2p5vE01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9984 4 55 1.10.10.10
2p6sC01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9971 4 55 1.10.10.10
2p5vH01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9967 4 55 1.10.10.10
2p5vC01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9957 4 55 1.10.10.10
2p6tF01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9956 4 55 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A239IPX8-F1-model_v4 Transcriptional regulator, AsnC family 0.9918 2 153 GO:0005829
GO:0043200
GO:0043565
AF-A0A1N6PII9-F1-model_v4 Transcriptional regulator, AsnC family 0.9906 1 152 GO:0005829
GO:0043200
GO:0043565
AF-A0A1I3F254-F1-model_v4 Transcriptional regulator, AsnC family 0.9902 3 153 GO:0005829
GO:0043200
GO:0043565
AF-A0A6N8XAX8-F1-model_v4 Lrp/AsnC family transcriptional regulator 0.9898 1 153 GO:0005829
GO:0043200
GO:0043565
AF-A0A0A1PGE5-F1-model_v4 Leucine-responsive regulatory protein 0.9896 4 152 GO:0005829
GO:0043200
GO:0043565

Feature Viewer

pLDDT pTM Quality
92.68 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map