F474815
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 680 | 393 | 669 | 153 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2909399089|2909402512 |
| Length | 178 |
| Sequence | FCGHEDTQVKDSRPHEDGTAIRRRRICASCSQRFTTIERVQLRDLYVVKADGRRVPFERDKLARSIRVALRKRPVDEDRIDRIVNGLVRQLEASGETDIASRDIGKLVMDTLREVDIVAYIRFASVHWDFRETKDFAAILESIPVGPGEERPAAIRVPAADSGAAVASGYGPDGIKRR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2597490356 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 2 | 2751185897 | Sphingomonas panacis DCY99 | Isolate | Unclassified |
| 3 | 2830075706 | Sphingomonas jinjuensis DSM 21457 | Isolate | Rhizosphere |
| 4 | 2846952575 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 5 | 2848858292 | Azospirillum brasilense Az39 | Isolate | Unclassified |
| 6 | 2885429604 | Sphingomonas sp. WZY 27 | Isolate | Rhizosphere |
| 7 | 2909399089 | Nguyenibacter vanlangensis LMG 31431 | Isolate | Unclassified |
| 8 | 2946787523 | Sphingomonas faeni W4I17 | Isolate | Rhizosphere |
| 9 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 10 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 11 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 12 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 13 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 14 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 15 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 16 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 17 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 18 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 19 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 20 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 21 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 22 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 23 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 24 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 25 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 26 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 27 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 28 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 29 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 30 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 31 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 32 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 38 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 58 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 64 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 65 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 69 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 71 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 72 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 73 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 75 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 76 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 77 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 78 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 79 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 80 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 81 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 82 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 83 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 85 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 86 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 87 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 88 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 89 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 90 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 92 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 94 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 116 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 119 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 121 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 122 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 123 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 124 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 125 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 126 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 127 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 128 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 132 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 135 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 137 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 139 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 142 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 206 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 207 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 208 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 209 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 210 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 211 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 212 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 213 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 214 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 215 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 216 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 217 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 218 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 219 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 220 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 221 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 222 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 223 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 224 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 225 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 226 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 227 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 228 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 229 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 230 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 231 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 232 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 233 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 234 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 235 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 236 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 237 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 238 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 239 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 240 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 241 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 242 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 243 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 244 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 245 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 246 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 247 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 248 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 249 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 250 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 251 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 252 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 253 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 254 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 255 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 256 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 257 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 258 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 259 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 260 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 261 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 262 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 325 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 326 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 327 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 328 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 329 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 330 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 331 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 332 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 333 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 334 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 335 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 336 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 337 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 338 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 339 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 340 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 341 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 342 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 343 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 344 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 345 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 347 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 361 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 362 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 363 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 364 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 365 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 367 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 370 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 373 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 374 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 375 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 376 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 377 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 378 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 379 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 380 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 381 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 382 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 383 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 384 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 385 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 386 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 387 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 388 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 389 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 390 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 391 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 392 | 641228493 | Gluconacetobacter diazotrophicus PA1 5 | Isolate | Unclassified |
| 393 | 643348555 | Gluconacetobacter diazotrophicus PA1 5 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.94 |
| Metatranscriptomes | 0.59 |
| Isolates | 1.47 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.35 |
| Nodule | 0 |
| Rhizoplane | 2.06 |
| Rhizosphere | 76.18 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.41 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1046316 | 3300001904 | Bacteria | 669 |
| 2 | JGI24736J21556_1063067 | 3300001904 | Bacteria | 574 |
| 3 | JGI24741J21665_1002675 | 3300001915 | Bacteria | 4540 |
| 4 | JGI24740J21852_10003789 | 3300001979 | Bacteria | 6583 |
| 5 | JGI24739J22299_10042349 | 3300001989 | Bacteria | 1510 |
| 6 | JGI24737J22298_10015131 | 3300001990 | Bacteria | 2498 |
| 7 | JGI24735J21928_10140226 | 3300002067 | Bacteria | 697 |
| 8 | JGI24738J21930_10041033 | 3300002075 | Bacteria | 940 |
| 9 | JGI24744J21845_10071195 | 3300002077 | Bacteria | 635 |
| 10 | JGI24751J29686_10072127 | 3300002459 | Bacteria | 713 |
| 11 | JGI25152J39213_1028504 | 3300002773 | Bacteria | 887 |
| 12 | JGI25150J39212_1000177 | 3300002774 | Bacteria | 35741 |
| 13 | JGI25151J46595_10100177 | 3300003187 | Bacteria | 782 |
| 14 | JGI25406J46586_10177799 | 3300003203 | Bacteria | 620 |
| 15 | JGI25153J46596_10000064 | 3300003215 | Bacteria | 125642 |
| 16 | JGI25153J46596_10001772 | 3300003215 | Bacteria | 12814 |
| 17 | rootH1_10165260 | 3300003316 | Bacteria | 1017 |
| 18 | rootL2_10072004 | 3300003322 | Bacteria | 1048 |
| 19 | rootH1_10305472 | 3300003323 | Bacteria | 1998 |
| 20 | Ga0055525_1000119 | 3300003759 | Bacteria | 120272 |
| 21 | Ga0055542_1000142 | 3300003762 | Bacteria | 89813 |
| 22 | Ga0055529_1000167 | 3300003763 | Bacteria | 90966 |
| 23 | Ga0055537_1002015 | 3300003773 | Bacteria | 7220 |
| 24 | Ga0055536_1027551 | 3300003781 | Bacteria | 1567 |
| 25 | Ga0055540_1000762 | 3300003792 | Bacteria | 21885 |
| 26 | Ga0070658_10000762 | 3300005327 | Bacteria | 27659 |
| 27 | Ga0070658_10179180 | 3300005327 | Bacteria | 1783 |
| 28 | Ga0070658_11357621 | 3300005327 | Bacteria | 617 |
| 29 | Ga0070676_10074490 | 3300005328 | Bacteria | 2045 |
| 30 | Ga0070683_100766819 | 3300005329 | Bacteria | 924 |
| 31 | Ga0070670_100042394 | 3300005331 | Bacteria | 3912 |
| 32 | Ga0070677_10104838 | 3300005333 | Bacteria | 1253 |
| 33 | Ga0068869_101530177 | 3300005334 | Bacteria | 593 |
| 34 | Ga0070666_10620249 | 3300005335 | Bacteria | 790 |
| 35 | Ga0070660_100270280 | 3300005339 | Bacteria | 1389 |
| 36 | Ga0070661_100002228 | 3300005344 | Bacteria | 13301 |
| 37 | Ga0070661_100178534 | 3300005344 | Bacteria | 1615 |
| 38 | Ga0070668_100070577 | 3300005347 | Bacteria | 2720 |
| 39 | Ga0070668_100627169 | 3300005347 | Bacteria | 943 |
| 40 | Ga0070675_100059315 | 3300005354 | Bacteria | 3157 |
| 41 | Ga0070675_100325133 | 3300005354 | Bacteria | 1359 |
| 42 | Ga0070671_100302136 | 3300005355 | Bacteria | 1363 |
| 43 | Ga0070674_100001273 | 3300005356 | Bacteria | 13274 |
| 44 | Ga0070674_100013503 | 3300005356 | Bacteria | 5052 |
| 45 | Ga0070674_100791959 | 3300005356 | Bacteria | 818 |
| 46 | Ga0070673_100473932 | 3300005364 | Bacteria | 1129 |
| 47 | Ga0070659_100260867 | 3300005366 | Bacteria | 1438 |
| 48 | Ga0070659_100296458 | 3300005366 | Bacteria | 1347 |
| 49 | Ga0070667_100020682 | 3300005367 | Bacteria | 5464 |
| 50 | Ga0070667_100021285 | 3300005367 | Bacteria | 5387 |
| 51 | Ga0070709_10110109 | 3300005434 | Bacteria | 1850 |
| 52 | Ga0070714_100000478 | 3300005435 | Bacteria | 28985 |
| 53 | Ga0070714_100674890 | 3300005435 | Bacteria | 996 |
| 54 | Ga0070714_100832976 | 3300005435 | Bacteria | 894 |
| 55 | Ga0070713_100132319 | 3300005436 | Bacteria | 2201 |
| 56 | Ga0070713_100170820 | 3300005436 | Bacteria | 1948 |
| 57 | Ga0070713_100521309 | 3300005436 | Bacteria | 1123 |
| 58 | Ga0070713_101195611 | 3300005436 | Bacteria | 736 |
| 59 | Ga0070710_10086418 | 3300005437 | Bacteria | 1842 |
| 60 | Ga0070710_10258928 | 3300005437 | Bacteria | 1121 |
| 61 | Ga0070711_100300663 | 3300005439 | Bacteria | 1276 |
| 62 | Ga0070711_100372260 | 3300005439 | Bacteria | 1153 |
| 63 | Ga0070708_100003894 | 3300005445 | Bacteria | 11714 |
| 64 | Ga0070663_100025213 | 3300005455 | Bacteria | 4013 |
| 65 | Ga0070678_100000825 | 3300005456 | Bacteria | 15714 |
| 66 | Ga0070678_100283939 | 3300005456 | Bacteria | 1401 |
| 67 | Ga0070678_101328854 | 3300005456 | Bacteria | 670 |
| 68 | Ga0070662_100021805 | 3300005457 | Bacteria | 4378 |
| 69 | Ga0070681_10138885 | 3300005458 | Bacteria | 2360 |
| 70 | Ga0070681_11202614 | 3300005458 | Bacteria | 680 |
| 71 | Ga0070685_10435061 | 3300005466 | Bacteria | 916 |
| 72 | Ga0070706_100070961 | 3300005467 | Bacteria | 3221 |
| 73 | Ga0070707_100107642 | 3300005468 | Bacteria | 2704 |
| 74 | Ga0070698_100002550 | 3300005471 | Bacteria | 20068 |
| 75 | Ga0070699_100104442 | 3300005518 | Bacteria | 2485 |
| 76 | Ga0070679_100117813 | 3300005530 | Bacteria | 2640 |
| 77 | Ga0070679_100252856 | 3300005530 | Bacteria | 1718 |
| 78 | Ga0068853_100382407 | 3300005539 | Bacteria | 1315 |
| 79 | Ga0068853_100471648 | 3300005539 | Bacteria | 1182 |
| 80 | Ga0068853_101333544 | 3300005539 | Bacteria | 694 |
| 81 | Ga0070672_100145663 | 3300005543 | Bacteria | 1957 |
| 82 | Ga0070696_101673121 | 3300005546 | Bacteria | 548 |
| 83 | Ga0070665_100127251 | 3300005548 | Bacteria | 2550 |
| 84 | Ga0070665_100144679 | 3300005548 | Bacteria | 2381 |
| 85 | Ga0070665_100207851 | 3300005548 | Bacteria | 1958 |
| 86 | Ga0070665_100869105 | 3300005548 | Bacteria | 915 |
| 87 | Ga0068855_100183648 | 3300005563 | Bacteria | 2364 |
| 88 | Ga0068855_101242216 | 3300005563 | Bacteria | 773 |
| 89 | Ga0068855_101351070 | 3300005563 | Bacteria | 736 |
| 90 | Ga0070664_100125786 | 3300005564 | Bacteria | 2249 |
| 91 | Ga0068857_100280377 | 3300005577 | Bacteria | 1533 |
| 92 | Ga0068857_100396414 | 3300005577 | Bacteria | 1284 |
| 93 | Ga0068857_101004796 | 3300005577 | Bacteria | 803 |
| 94 | Ga0068857_102129002 | 3300005577 | Bacteria | 550 |
| 95 | Ga0068857_102190824 | 3300005577 | Bacteria | 542 |
| 96 | Ga0068854_100319177 | 3300005578 | Bacteria | 1262 |
| 97 | Ga0068854_100744305 | 3300005578 | Bacteria | 850 |
| 98 | Ga0068856_100562267 | 3300005614 | Bacteria | 1162 |
| 99 | Ga0070702_100910951 | 3300005615 | Bacteria | 689 |
| 100 | Ga0068859_100000085 | 3300005617 | Bacteria | 85748 |
| 101 | Ga0068859_101494467 | 3300005617 | Bacteria | 745 |
| 102 | Ga0068866_10761395 | 3300005718 | Bacteria | 670 |
| 103 | Ga0068851_10001870 | 3300005834 | Bacteria | 9248 |
| 104 | Ga0068851_10133527 | 3300005834 | Bacteria | 1344 |
| 105 | Ga0068858_100000122 | 3300005842 | Bacteria | 80502 |
| 106 | Ga0068858_100000166 | 3300005842 | Bacteria | 70016 |
| 107 | Ga0068858_100184765 | 3300005842 | Bacteria | 1969 |
| 108 | Ga0068860_100049220 | 3300005843 | Bacteria | 4015 |
| 109 | Ga0081455_10000933 | 3300005937 | Bacteria | 37402 |
| 110 | Ga0081455_10002813 | 3300005937 | Bacteria | 20492 |
| 111 | Ga0081455_10035376 | 3300005937 | Bacteria | 4465 |
| 112 | Ga0081538_10111882 | 3300005981 | Bacteria | 1338 |
| 113 | Ga0081540_1132378 | 3300005983 | Bacteria | 1016 |
| 114 | Ga0081539_10012874 | 3300005985 | Bacteria | 6374 |
| 115 | Ga0081539_10016575 | 3300005985 | Bacteria | 5246 |
| 116 | Ga0081539_10333994 | 3300005985 | Bacteria | 641 |
| 117 | Ga0070717_10108594 | 3300006028 | Bacteria | 2364 |
| 118 | Ga0070717_10306885 | 3300006028 | Bacteria | 1411 |
| 119 | Ga0075365_10072925 | 3300006038 | Bacteria | 2313 |
| 120 | Ga0075365_10356948 | 3300006038 | Bacteria | 1030 |
| 121 | Ga0075365_10514117 | 3300006038 | Bacteria | 846 |
| 122 | Ga0070712_100091509 | 3300006175 | Bacteria | 2229 |
| 123 | Ga0075362_10021792 | 3300006177 | Bacteria | 2694 |
| 124 | Ga0075362_10027924 | 3300006177 | Bacteria | 2419 |
| 125 | Ga0075367_10083752 | 3300006178 | Bacteria | 1932 |
| 126 | Ga0075369_10079337 | 3300006186 | Bacteria | 1454 |
| 127 | Ga0075369_10529269 | 3300006186 | Bacteria | 561 |
| 128 | Ga0075366_10026426 | 3300006195 | Bacteria | 3400 |
| 129 | Ga0097621_100237342 | 3300006237 | Bacteria | 1593 |
| 130 | Ga0068871_100043958 | 3300006358 | Bacteria | 3591 |
| 131 | Ga0068871_101595291 | 3300006358 | Bacteria | 618 |
| 132 | Ga0097620_100000085 | 3300006931 | Bacteria | 85748 |
| 133 | Ga0097620_101494475 | 3300006931 | Bacteria | 745 |
| 134 | Ga0099794_10617623 | 3300007265 | Bacteria | 574 |
| 135 | Ga0105240_10036237 | 3300009093 | Bacteria | 6347 |
| 136 | Ga0105245_10000623 | 3300009098 | Bacteria | 32150 |
| 137 | Ga0105247_10003709 | 3300009101 | Bacteria | 9917 |
| 138 | Ga0105247_10567932 | 3300009101 | Bacteria | 836 |
| 139 | Ga0114129_11042589 | 3300009147 | Bacteria | 1027 |
| 140 | Ga0105243_10000788 | 3300009148 | Bacteria | 30391 |
| 141 | Ga0105243_10007245 | 3300009148 | Bacteria | 8525 |
| 142 | Ga0105243_10058660 | 3300009148 | Bacteria | 3068 |
| 143 | Ga0105242_10048387 | 3300009176 | Bacteria | 3456 |
| 144 | Ga0105242_11574450 | 3300009176 | Bacteria | 690 |
| 145 | Ga0105242_11756561 | 3300009176 | Bacteria | 658 |
| 146 | Ga0105248_10019502 | 3300009177 | Bacteria | 7506 |
| 147 | Ga0105248_10028391 | 3300009177 | Bacteria | 6234 |
| 148 | Ga0105248_10031813 | 3300009177 | Bacteria | 5896 |
| 149 | Ga0105248_11172460 | 3300009177 | Bacteria | 868 |
| 150 | Ga0105248_12838216 | 3300009177 | Bacteria | 552 |
| 151 | Ga0105237_10008752 | 3300009545 | Bacteria | 10923 |
| 152 | Ga0105237_10071672 | 3300009545 | Bacteria | 3459 |
| 153 | Ga0105237_11634267 | 3300009545 | Bacteria | 651 |
| 154 | Ga0105238_10236127 | 3300009551 | Bacteria | 1805 |
| 155 | Ga0105249_10001806 | 3300009553 | Bacteria | 18608 |
| 156 | Ga0105249_10039113 | 3300009553 | Bacteria | 4306 |
| 157 | Ga0105239_10000060 | 3300010375 | Bacteria | 155195 |
| 158 | Ga0105239_10712179 | 3300010375 | Bacteria | 1148 |
| 159 | Ga0105239_11110537 | 3300010375 | Bacteria | 910 |
| 160 | Ga0105239_12585170 | 3300010375 | Bacteria | 592 |
| 161 | Ga0105246_10188788 | 3300011119 | Bacteria | 1593 |
| 162 | Ga0157373_10046534 | 3300013100 | Bacteria | 3096 |
| 163 | Ga0157371_10000723 | 3300013102 | Bacteria | 38704 |
| 164 | Ga0157370_10131531 | 3300013104 | Bacteria | 2334 |
| 165 | Ga0157370_10371719 | 3300013104 | Bacteria | 1317 |
| 166 | Ga0157369_10208094 | 3300013105 | Bacteria | 2051 |
| 167 | Ga0157369_10479292 | 3300013105 | Bacteria | 1288 |
| 168 | Ga0157369_12053384 | 3300013105 | Bacteria | 580 |
| 169 | Ga0157374_10200350 | 3300013296 | Bacteria | 1955 |
| 170 | Ga0157374_12943906 | 3300013296 | Bacteria | 503 |
| 171 | Ga0157378_10018568 | 3300013297 | Bacteria | 6112 |
| 172 | Ga0163162_10017302 | 3300013306 | Bacteria | 7054 |
| 173 | Ga0163162_10128733 | 3300013306 | Bacteria | 2639 |
| 174 | Ga0163162_10228292 | 3300013306 | Bacteria | 1992 |
| 175 | Ga0163162_10305166 | 3300013306 | Bacteria | 1724 |
| 176 | Ga0163162_10512062 | 3300013306 | Bacteria | 1330 |
| 177 | Ga0163162_11400432 | 3300013306 | Bacteria | 795 |
| 178 | Ga0157375_10413475 | 3300013308 | Bacteria | 1515 |
| 179 | Ga0157375_10945763 | 3300013308 | Bacteria | 1004 |
| 180 | Ga0163163_10370444 | 3300014325 | Bacteria | 1489 |
| 181 | Ga0163163_11084778 | 3300014325 | Bacteria | 864 |
| 182 | Ga0182008_10025204 | 3300014497 | Bacteria | 3022 |
| 183 | Ga0182008_10265204 | 3300014497 | Bacteria | 889 |
| 184 | Ga0157379_10743872 | 3300014968 | Bacteria | 923 |
| 185 | Ga0157376_10236103 | 3300014969 | Bacteria | 1701 |
| 186 | Ga0157376_10780256 | 3300014969 | Bacteria | 967 |
| 187 | Ga0183363_1010 | 3300015690 | Bacteria | 108191 |
| 188 | Ga0163161_10279041 | 3300017792 | Bacteria | 1310 |
| 189 | Ga0163161_10984966 | 3300017792 | Bacteria | 719 |
| 190 | Ga0197907_10784425 | 3300020069 | Bacteria | 524 |
| 191 | Ga0206356_11374598 | 3300020070 | Bacteria | 694 |
| 192 | Ga0206354_11056629 | 3300020081 | Bacteria | 743 |
| 193 | Ga0213872_10027728 | 3300021361 | Bacteria | 2599 |
| 194 | Ga0213874_10054300 | 3300021377 | Bacteria | 1238 |
| 195 | Ga0213874_10182690 | 3300021377 | Bacteria | 747 |
| 196 | Ga0213876_10064836 | 3300021384 | Bacteria | 1928 |
| 197 | Ga0213875_10010530 | 3300021388 | Bacteria | 4625 |
| 198 | Ga0224712_10370181 | 3300022467 | Unclassified | 679 |
| 199 | Ga0209674_108561 | 3300025226 | Bacteria | 1203 |
| 200 | Ga0209563_100024 | 3300025230 | Bacteria | 601155 |
| 201 | Ga0209437_104206 | 3300025233 | Bacteria | 2550 |
| 202 | Ga0207425_1000019 | 3300025245 | Bacteria | 399942 |
| 203 | Ga0209677_106631 | 3300025253 | Bacteria | 2687 |
| 204 | Ga0209148_1000008 | 3300025254 | Bacteria | 1504371 |
| 205 | Ga0209129_1001013 | 3300025258 | Bacteria | 16723 |
| 206 | Ga0209233_1000107 | 3300025261 | Bacteria | 267399 |
| 207 | Ga0209565_1000166 | 3300025263 | Bacteria | 85898 |
| 208 | Ga0209455_1000002 | 3300025272 | Bacteria | 1505459 |
| 209 | Ga0209673_1014928 | 3300025273 | Bacteria | 2980 |
| 210 | Ga0209676_1009397 | 3300025292 | Bacteria | 4222 |
| 211 | Ga0209676_1021032 | 3300025292 | Bacteria | 2200 |
| 212 | Ga0209025_1000304 | 3300025294 | Bacteria | 109508 |
| 213 | Ga0209564_1001084 | 3300025295 | Bacteria | 32523 |
| 214 | Ga0209758_1000007 | 3300025297 | Bacteria | 1270410 |
| 215 | Ga0209758_1000019 | 3300025297 | Bacteria | 743682 |
| 216 | Ga0209050_1000001 | 3300025298 | Bacteria | 3563507 |
| 217 | Ga0209050_1019174 | 3300025298 | Bacteria | 2614 |
| 218 | Ga0209050_1028612 | 3300025298 | Bacteria | 1804 |
| 219 | Ga0207426_1004545 | 3300025302 | Bacteria | 6711 |
| 220 | Ga0209051_1000309 | 3300025303 | Bacteria | 76449 |
| 221 | Ga0209257_1001776 | 3300025304 | Bacteria | 23847 |
| 222 | Ga0209257_1001845 | 3300025304 | Bacteria | 23059 |
| 223 | Ga0207697_10006203 | 3300025315 | Bacteria | 5439 |
| 224 | Ga0207697_10196420 | 3300025315 | Bacteria | 887 |
| 225 | Ga0207656_10006071 | 3300025321 | Bacteria | 4323 |
| 226 | Ga0207682_10205093 | 3300025893 | Bacteria | 908 |
| 227 | Ga0207692_10076414 | 3300025898 | Bacteria | 1779 |
| 228 | Ga0207642_10665090 | 3300025899 | Bacteria | 654 |
| 229 | Ga0207710_10004115 | 3300025900 | Bacteria | 6389 |
| 230 | Ga0207710_10286067 | 3300025900 | Bacteria | 830 |
| 231 | Ga0207688_10170310 | 3300025901 | Bacteria | 1294 |
| 232 | Ga0207688_10354957 | 3300025901 | Bacteria | 904 |
| 233 | Ga0207680_10870489 | 3300025903 | Bacteria | 646 |
| 234 | Ga0207647_10018473 | 3300025904 | Bacteria | 4712 |
| 235 | Ga0207647_10080138 | 3300025904 | Bacteria | 1959 |
| 236 | Ga0207699_10060841 | 3300025906 | Bacteria | 2270 |
| 237 | Ga0207699_10461018 | 3300025906 | Bacteria | 913 |
| 238 | Ga0207699_10795613 | 3300025906 | Bacteria | 695 |
| 239 | Ga0207645_10094421 | 3300025907 | Bacteria | 1925 |
| 240 | Ga0207645_10674606 | 3300025907 | Bacteria | 702 |
| 241 | Ga0207705_10000913 | 3300025909 | Bacteria | 24188 |
| 242 | Ga0207705_10148369 | 3300025909 | Bacteria | 1756 |
| 243 | Ga0207705_11241965 | 3300025909 | Bacteria | 570 |
| 244 | Ga0207684_10070898 | 3300025910 | Bacteria | 2961 |
| 245 | Ga0207654_10000892 | 3300025911 | Bacteria | 16547 |
| 246 | Ga0207654_10379413 | 3300025911 | Bacteria | 979 |
| 247 | Ga0207654_11046368 | 3300025911 | Bacteria | 594 |
| 248 | Ga0207707_10576723 | 3300025912 | Bacteria | 954 |
| 249 | Ga0207695_10011004 | 3300025913 | Bacteria | 10992 |
| 250 | Ga0207695_10044491 | 3300025913 | Bacteria | 4721 |
| 251 | Ga0207695_10052176 | 3300025913 | Bacteria | 4287 |
| 252 | Ga0207671_10002033 | 3300025914 | Bacteria | 22218 |
| 253 | Ga0207671_10005082 | 3300025914 | Bacteria | 12285 |
| 254 | Ga0207693_10218841 | 3300025915 | Bacteria | 1496 |
| 255 | Ga0207663_10019835 | 3300025916 | Bacteria | 3796 |
| 256 | Ga0207663_10766946 | 3300025916 | Bacteria | 767 |
| 257 | Ga0207657_10001738 | 3300025919 | Bacteria | 23468 |
| 258 | Ga0207649_10000549 | 3300025920 | Bacteria | 25943 |
| 259 | Ga0207649_10036622 | 3300025920 | Bacteria | 2957 |
| 260 | Ga0207652_10051658 | 3300025921 | Bacteria | 3525 |
| 261 | Ga0207646_10063693 | 3300025922 | Bacteria | 3291 |
| 262 | Ga0207646_10723120 | 3300025922 | Bacteria | 889 |
| 263 | Ga0207694_10027041 | 3300025924 | Bacteria | 4368 |
| 264 | Ga0207694_10064476 | 3300025924 | Bacteria | 2855 |
| 265 | Ga0207694_10978735 | 3300025924 | Bacteria | 716 |
| 266 | Ga0207694_10997254 | 3300025924 | Bacteria | 709 |
| 267 | Ga0207650_10036667 | 3300025925 | Bacteria | 3568 |
| 268 | Ga0207659_10122486 | 3300025926 | Bacteria | 1995 |
| 269 | Ga0207659_10525561 | 3300025926 | Bacteria | 1004 |
| 270 | Ga0207687_10007708 | 3300025927 | Bacteria | 7066 |
| 271 | Ga0207700_10011551 | 3300025928 | Bacteria | 5638 |
| 272 | Ga0207700_10039287 | 3300025928 | Bacteria | 3444 |
| 273 | Ga0207700_10242609 | 3300025928 | Bacteria | 1536 |
| 274 | Ga0207664_10001839 | 3300025929 | Bacteria | 13993 |
| 275 | Ga0207664_10120460 | 3300025929 | Bacteria | 2195 |
| 276 | Ga0207690_10000599 | 3300025932 | Bacteria | 23383 |
| 277 | Ga0207690_10112060 | 3300025932 | Bacteria | 1967 |
| 278 | Ga0207690_10979497 | 3300025932 | Bacteria | 703 |
| 279 | Ga0207706_10047501 | 3300025933 | Bacteria | 3797 |
| 280 | Ga0207706_10494164 | 3300025933 | Bacteria | 1056 |
| 281 | Ga0207686_10074291 | 3300025934 | Bacteria | 2196 |
| 282 | Ga0207709_10000005 | 3300025935 | Bacteria | 806813 |
| 283 | Ga0207709_10032521 | 3300025935 | Bacteria | 3055 |
| 284 | Ga0207670_11283511 | 3300025936 | Bacteria | 621 |
| 285 | Ga0207669_10000511 | 3300025937 | Bacteria | 16940 |
| 286 | Ga0207669_10017719 | 3300025937 | Bacteria | 3661 |
| 287 | Ga0207669_10434778 | 3300025937 | Bacteria | 1036 |
| 288 | Ga0207691_10134025 | 3300025940 | Bacteria | 2186 |
| 289 | Ga0207711_10016955 | 3300025941 | Bacteria | 6050 |
| 290 | Ga0207711_10156055 | 3300025941 | Bacteria | 2063 |
| 291 | Ga0207689_10608502 | 3300025942 | Bacteria | 919 |
| 292 | Ga0207689_10626306 | 3300025942 | Bacteria | 906 |
| 293 | Ga0207679_10065964 | 3300025945 | Bacteria | 2711 |
| 294 | Ga0207667_10002847 | 3300025949 | Bacteria | 21475 |
| 295 | Ga0207667_10264954 | 3300025949 | Bacteria | 1757 |
| 296 | Ga0207667_11130126 | 3300025949 | Bacteria | 766 |
| 297 | Ga0207651_10600101 | 3300025960 | Bacteria | 962 |
| 298 | Ga0207651_11073230 | 3300025960 | Bacteria | 721 |
| 299 | Ga0207712_10007444 | 3300025961 | Bacteria | 6913 |
| 300 | Ga0207712_10121812 | 3300025961 | Bacteria | 1974 |
| 301 | Ga0207668_10301731 | 3300025972 | Bacteria | 1322 |
| 302 | Ga0207668_10401620 | 3300025972 | Bacteria | 1159 |
| 303 | Ga0207640_10011920 | 3300025981 | Bacteria | 4937 |
| 304 | Ga0207640_10372913 | 3300025981 | Bacteria | 1154 |
| 305 | Ga0207640_10621884 | 3300025981 | Bacteria | 917 |
| 306 | Ga0207658_10016459 | 3300025986 | Bacteria | 5085 |
| 307 | Ga0207658_10073398 | 3300025986 | Bacteria | 2597 |
| 308 | Ga0207658_10711923 | 3300025986 | Bacteria | 908 |
| 309 | Ga0207677_10198724 | 3300026023 | Bacteria | 1592 |
| 310 | Ga0207677_10722005 | 3300026023 | Bacteria | 886 |
| 311 | Ga0207703_10000159 | 3300026035 | Bacteria | 78106 |
| 312 | Ga0207703_10000711 | 3300026035 | Bacteria | 32868 |
| 313 | Ga0207703_10180831 | 3300026035 | Bacteria | 1861 |
| 314 | Ga0207639_10162434 | 3300026041 | Bacteria | 1884 |
| 315 | Ga0207639_10252575 | 3300026041 | Bacteria | 1538 |
| 316 | Ga0207639_10341494 | 3300026041 | Bacteria | 1335 |
| 317 | Ga0207702_10708402 | 3300026078 | Bacteria | 992 |
| 318 | Ga0207648_10103522 | 3300026089 | Bacteria | 2496 |
| 319 | Ga0207648_10786346 | 3300026089 | Bacteria | 885 |
| 320 | Ga0207676_10000351 | 3300026095 | Bacteria | 39386 |
| 321 | Ga0207674_10061897 | 3300026116 | Bacteria | 3781 |
| 322 | Ga0207674_10114190 | 3300026116 | Bacteria | 2673 |
| 323 | Ga0207674_10207098 | 3300026116 | Bacteria | 1910 |
| 324 | Ga0207674_10740985 | 3300026116 | Bacteria | 948 |
| 325 | Ga0207674_10819969 | 3300026116 | Bacteria | 898 |
| 326 | Ga0207675_100591962 | 3300026118 | Bacteria | 1111 |
| 327 | Ga0207675_100592087 | 3300026118 | Bacteria | 1111 |
| 328 | Ga0207675_100627698 | 3300026118 | Bacteria | 1079 |
| 329 | Ga0207683_10001955 | 3300026121 | Bacteria | 18242 |
| 330 | Ga0207683_10110814 | 3300026121 | Bacteria | 2457 |
| 331 | Ga0207698_10052426 | 3300026142 | Bacteria | 3125 |
| 332 | Ga0207698_10187092 | 3300026142 | Bacteria | 1840 |
| 333 | Ga0268266_10017160 | 3300028379 | Bacteria | 6181 |
| 334 | Ga0268266_10054911 | 3300028379 | Bacteria | 3424 |
| 335 | Ga0268266_10064475 | 3300028379 | Bacteria | 3165 |
| 336 | Ga0268266_10071904 | 3300028379 | Bacteria | 2998 |
| 337 | Ga0268266_10377750 | 3300028379 | Bacteria | 1336 |
| 338 | Ga0268265_11154308 | 3300028380 | Bacteria | 771 |
| 339 | Ga0268264_10170162 | 3300028381 | Bacteria | 1969 |
| 340 | Ga0265334_10012253 | 3300028573 | Bacteria | 3603 |
| 341 | Ga0307517_10001703 | 3300028786 | Bacteria | 36321 |
| 342 | Ga0307517_10009194 | 3300028786 | Bacteria | 14057 |
| 343 | Ga0307517_10134622 | 3300028786 | Bacteria | 1763 |
| 344 | Ga0265332_10079895 | 3300031238 | Bacteria | 1388 |
| 345 | Ga0265332_10167282 | 3300031238 | Bacteria | 918 |
| 346 | Ga0265328_10161627 | 3300031239 | Bacteria | 845 |
| 347 | Ga0265325_10108638 | 3300031241 | Bacteria | 1351 |
| 348 | Ga0265340_10041331 | 3300031247 | Bacteria | 2267 |
| 349 | Ga0307513_10062169 | 3300031456 | Bacteria | 3948 |
| 350 | Ga0307513_10246587 | 3300031456 | Bacteria | 1586 |
| 351 | Ga0307509_10052180 | 3300031507 | Bacteria | 4367 |
| 352 | Ga0307508_10000302 | 3300031616 | Bacteria | 60090 |
| 353 | Ga0265342_10423890 | 3300031712 | Bacteria | 685 |
| 354 | Ga0307413_10097534 | 3300031824 | Bacteria | 1933 |
| 355 | Ga0307412_10115047 | 3300031911 | Bacteria | 1927 |
| 356 | Ga0307412_10207994 | 3300031911 | Bacteria | 1491 |
| 357 | Ga0307409_102106211 | 3300031995 | Bacteria | 594 |
| 358 | Ga0307510_10000081 | 3300033180 | Bacteria | 72540 |
| 359 | Ga0307510_10053187 | 3300033180 | Bacteria | 4260 |
| 360 | Ga0373950_0084004 | 3300034818 | Bacteria | 669 |
| 361 | Ga0373926_0114580 | 3300035083 | Bacteria | 1014 |
| 362 | Ga0373934_0098706 | 3300035086 | Bacteria | 1180 |
| 363 | Ga0373940_0192896 | 3300035088 | Bacteria | 667 |
| 364 | Ga0373923_0177992 | 3300035111 | Bacteria | 976 |
| 365 | Ga0373923_0311234 | 3300035111 | Bacteria | 747 |
| 366 | Ga0373923_0455992 | 3300035111 | Bacteria | 620 |
| 367 | Ga0373932_0022161 | 3300035112 | Bacteria | 1685 |
| 368 | Ga0373936_0024693 | 3300035113 | Bacteria | 2348 |
| 369 | Ga0373936_0045831 | 3300035113 | Bacteria | 1762 |
| 370 | Ga0373936_0073083 | 3300035113 | Bacteria | 1417 |
| 371 | Ga0373936_0181255 | 3300035113 | Bacteria | 924 |
| 372 | Ga0373939_0225886 | 3300035114 | Bacteria | 719 |
| 373 | Ga0373945_0147482 | 3300035116 | Bacteria | 952 |
| 374 | Ga0373953_0015069 | 3300035117 | Bacteria | 2793 |
| 375 | Ga0373954_0060128 | 3300035118 | Bacteria | 1792 |
| 376 | Ga0373954_0077163 | 3300035118 | Bacteria | 1589 |
| 377 | Ga0373956_0044412 | 3300035119 | Bacteria | 1981 |
| 378 | Ga0373956_0409602 | 3300035119 | Bacteria | 647 |
| 379 | Ga0373957_0045097 | 3300035120 | Bacteria | 1670 |
| 380 | Ga0373957_0200554 | 3300035120 | Bacteria | 831 |
| 381 | Ga0373946_0059113 | 3300035171 | Bacteria | 1626 |
| 382 | Ga0373946_0106241 | 3300035171 | Bacteria | 1265 |
| 383 | Ga0373946_0388545 | 3300035171 | Bacteria | 703 |
| 384 | Ga0373955_0038544 | 3300035172 | Bacteria | 2547 |
| 385 | Ga0373955_0047885 | 3300035172 | Bacteria | 2316 |
| 386 | Ga0373955_0102133 | 3300035172 | Bacteria | 1647 |
| 387 | Ga0373931_0092049 | 3300035691 | Bacteria | 1691 |
| 388 | Ga0373931_0385519 | 3300035691 | Bacteria | 884 |
| 389 | Ga0373935_0038660 | 3300035692 | Bacteria | 2988 |
| 390 | Ga0373935_0116150 | 3300035692 | Bacteria | 1782 |
| 391 | Ga0373935_0211191 | 3300035692 | Bacteria | 1345 |
| 392 | Ga0373935_0746383 | 3300035692 | Bacteria | 721 |
| 393 | Ga0373927_0041227 | 3300035695 | Bacteria | 2994 |
| 394 | Ga0373927_0149954 | 3300035695 | Bacteria | 1527 |
| 395 | Ga0373933_0066700 | 3300035724 | Bacteria | 2181 |
| 396 | Ga0373933_0341735 | 3300035724 | Bacteria | 972 |
| 397 | Ga0373947_0025308 | 3300035725 | Bacteria | 3461 |
| 398 | Ga0373947_0179640 | 3300035725 | Bacteria | 1377 |
| 399 | Ga0373937_0000734 | 3300036401 | Bacteria | 28357 |
| 400 | Ga0373937_0021679 | 3300036401 | Bacteria | 5767 |
| 401 | Ga0373937_0322569 | 3300036401 | Bacteria | 1461 |
| 402 | Ga0373937_0579457 | 3300036401 | Bacteria | 1065 |
| 403 | Ga0373937_1700300 | 3300036401 | Bacteria | 578 |
| 404 | Ga0316584_0087156 | 3300036712 | Bacteria | 2337 |
| 405 | Ga0373925_0005630 | 3300037068 | Bacteria | 9319 |
| 406 | Ga0373925_0255139 | 3300037068 | Bacteria | 1407 |
| 407 | Ga0373925_0711561 | 3300037068 | Bacteria | 828 |
| 408 | Ga0373925_0751119 | 3300037068 | Bacteria | 804 |
| 409 | Ga0395899_0055370 | 3300037312 | Bacteria | 2933 |
| 410 | Ga0395899_0102933 | 3300037312 | Bacteria | 2060 |
| 411 | Ga0395899_0281355 | 3300037312 | Bacteria | 1131 |
| 412 | Ga0395900_0021292 | 3300037418 | Bacteria | 6628 |
| 413 | Ga0395900_0038468 | 3300037418 | Bacteria | 4931 |
| 414 | Ga0395900_0920444 | 3300037418 | Bacteria | 797 |
| 415 | Ga0395898_0005008 | 3300037466 | Bacteria | 14377 |
| 416 | Ga0395898_0389718 | 3300037466 | Bacteria | 1328 |
| 417 | Ga0436364_0071585 | 3300037853 | Bacteria | 1709 |
| 418 | Ga0436364_0135989 | 3300037853 | Bacteria | 3342 |
| 419 | Ga0436364_0429284 | 3300037853 | Bacteria | 656 |
| 420 | Ga0436364_0748963 | 3300037853 | Bacteria | 1854 |
| 421 | Ga0436364_0878606 | 3300037853 | Bacteria | 3666 |
| 422 | Ga0436364_1142638 | 3300037853 | Bacteria | 780 |
| 423 | Ga0436364_1347066 | 3300037853 | Bacteria | 1741 |
| 424 | Ga0436364_1488888 | 3300037853 | Bacteria | 4757 |
| 425 | Ga0395901_0012568 | 3300038443 | Bacteria | 8591 |
| 426 | Ga0395901_0017050 | 3300038443 | Bacteria | 7403 |
| 427 | Ga0395901_0066564 | 3300038443 | Bacteria | 3752 |
| 428 | Ga0395901_0303108 | 3300038443 | Bacteria | 1656 |
| 429 | Ga0395901_0631718 | 3300038443 | Bacteria | 1076 |
| 430 | Ga0436365_0029237 | 3300039437 | Bacteria | 1142 |
| 431 | Ga0436365_0060372 | 3300039437 | Bacteria | 3113 |
| 432 | Ga0436365_0171907 | 3300039437 | Bacteria | 1281 |
| 433 | Ga0436365_0772100 | 3300039437 | Bacteria | 786 |
| 434 | Ga0436365_1221776 | 3300039437 | Bacteria | 573 |
| 435 | Ga0436360_0691683 | 3300039438 | Bacteria | 2607 |
| 436 | Ga0436360_0903033 | 3300039438 | Bacteria | 1378 |
| 437 | Ga0436360_1011171 | 3300039438 | Bacteria | 3089 |
| 438 | Ga0436361_0251203 | 3300039447 | Bacteria | 6352 |
| 439 | Ga0436363_0420453 | 3300039450 | Bacteria | 883 |
| 440 | Ga0436363_0631560 | 3300039450 | Bacteria | 2559 |
| 441 | Ga0436363_1046130 | 3300039450 | Bacteria | 2538 |
| 442 | Ga0436363_1048080 | 3300039450 | Bacteria | 553 |
| 443 | Ga0436363_1618324 | 3300039450 | Bacteria | 1032 |
| 444 | Ga0436363_1706959 | 3300039450 | Bacteria | 751 |
| 445 | Ga0436362_1137136 | 3300039453 | Bacteria | 680 |
| 446 | Ga0436362_1232813 | 3300039453 | Bacteria | 1314 |
| 447 | Ga0451800_1056121 | 3300041459 | Bacteria | 550 |
| 448 | Ga0439454_045497 | 3300042011 | Bacteria | 729 |
| 449 | Ga0450902_061338 | 3300042137 | Bacteria | 651 |
| 450 | Ga0439458_0022277 | 3300042157 | Bacteria | 1471 |
| 451 | Ga0466963_0091650 | 3300044694 | Bacteria | 2070 |
| 452 | Ga0466963_0310092 | 3300044694 | Bacteria | 1110 |
| 453 | Ga0466964_0083842 | 3300044706 | Bacteria | 1373 |
| 454 | Ga0453684_0212646 | 3300044712 | Bacteria | 2247 |
| 455 | Ga0451576_0000770 | 3300045051 | Bacteria | 63137 |
| 456 | Ga0466958_0843359 | 3300045836 | Bacteria | 598 |
| 457 | Ga0466967_0032894 | 3300045976 | Bacteria | 4384 |
| 458 | Ga0466967_1162654 | 3300045976 | Bacteria | 769 |
| 459 | Ga0495617_042129 | 3300046452 | Bacteria | 1526 |
| 460 | Ga0495592_0012195 | 3300046454 | Bacteria | 6523 |
| 461 | Ga0495603_0829359 | 3300046455 | Bacteria | 527 |
| 462 | Ga0495629_0051588 | 3300046459 | Bacteria | 2879 |
| 463 | Ga0495629_0357267 | 3300046459 | Bacteria | 996 |
| 464 | Ga0495629_0693028 | 3300046459 | Bacteria | 677 |
| 465 | Ga0495638_0000048 | 3300046460 | Bacteria | 209787 |
| 466 | Ga0495638_0147585 | 3300046460 | Bacteria | 1367 |
| 467 | Ga0495638_0360479 | 3300046460 | Bacteria | 765 |
| 468 | Ga0495651_0112340 | 3300046462 | Bacteria | 2013 |
| 469 | Ga0495653_0233527 | 3300046463 | Bacteria | 1230 |
| 470 | Ga0495650_0001045 | 3300046471 | Bacteria | 30841 |
| 471 | Ga0495580_0897668 | 3300046472 | Bacteria | 570 |
| 472 | Ga0495664_0001900 | 3300046477 | Bacteria | 11113 |
| 473 | Ga0495585_0072321 | 3300046492 | Bacteria | 1879 |
| 474 | Ga0495585_0339949 | 3300046492 | Bacteria | 731 |
| 475 | Ga0495594_0200986 | 3300046499 | Bacteria | 1136 |
| 476 | Ga0495596_0025486 | 3300046500 | Bacteria | 2390 |
| 477 | Ga0495607_0320309 | 3300046501 | Bacteria | 724 |
| 478 | Ga0495583_0005970 | 3300046506 | Bacteria | 8079 |
| 479 | Ga0495583_0007771 | 3300046506 | Bacteria | 6667 |
| 480 | Ga0495583_0022082 | 3300046506 | Bacteria | 3257 |
| 481 | Ga0495583_0204017 | 3300046506 | Bacteria | 802 |
| 482 | Ga0495606_0001395 | 3300046507 | Bacteria | 32635 |
| 483 | Ga0495606_0122793 | 3300046507 | Bacteria | 1552 |
| 484 | Ga0495608_0007407 | 3300046511 | Bacteria | 7751 |
| 485 | Ga0495608_0032915 | 3300046511 | Bacteria | 3505 |
| 486 | Ga0495608_0193013 | 3300046511 | Bacteria | 1285 |
| 487 | Ga0495628_0056372 | 3300046516 | Bacteria | 3093 |
| 488 | Ga0495630_0243788 | 3300046517 | Bacteria | 1373 |
| 489 | Ga0495630_0633773 | 3300046517 | Bacteria | 819 |
| 490 | Ga0495631_0133994 | 3300046518 | Bacteria | 1064 |
| 491 | Ga0495632_0265548 | 3300046519 | Bacteria | 767 |
| 492 | Ga0495637_0043585 | 3300046520 | Bacteria | 1914 |
| 493 | Ga0495643_0001127 | 3300046522 | Bacteria | 26381 |
| 494 | Ga0495643_0011061 | 3300046522 | Bacteria | 5516 |
| 495 | Ga0495643_0043761 | 3300046522 | Bacteria | 2435 |
| 496 | Ga0495643_0052045 | 3300046522 | Bacteria | 2200 |
| 497 | Ga0495648_0001672 | 3300046524 | Bacteria | 21514 |
| 498 | Ga0495648_0102895 | 3300046524 | Bacteria | 1572 |
| 499 | Ga0495663_0000928 | 3300046525 | Bacteria | 9799 |
| 500 | Ga0495642_0028796 | 3300046528 | Bacteria | 2214 |
| 501 | Ga0495652_0156645 | 3300046529 | Bacteria | 1773 |
| 502 | Ga0495652_0391127 | 3300046529 | Bacteria | 987 |
| 503 | Ga0495665_0188602 | 3300046531 | Bacteria | 1070 |
| 504 | Ga0495640_0025113 | 3300046533 | Bacteria | 4328 |
| 505 | Ga0495640_0221511 | 3300046533 | Bacteria | 1193 |
| 506 | Ga0495587_0014199 | 3300046536 | Bacteria | 4998 |
| 507 | Ga0495587_0097008 | 3300046536 | Bacteria | 1700 |
| 508 | Ga0495587_0461402 | 3300046536 | Bacteria | 703 |
| 509 | Ga0495609_0159391 | 3300046538 | Bacteria | 957 |
| 510 | Ga0495597_0147750 | 3300046542 | Bacteria | 966 |
| 511 | Ga0495597_0280788 | 3300046542 | Bacteria | 649 |
| 512 | Ga0495645_0002599 | 3300046543 | Bacteria | 12274 |
| 513 | Ga0495645_0187470 | 3300046543 | Bacteria | 1412 |
| 514 | Ga0495622_0001350 | 3300046557 | Bacteria | 12541 |
| 515 | Ga0495633_0006697 | 3300046558 | Bacteria | 6783 |
| 516 | Ga0495633_0037394 | 3300046558 | Bacteria | 2322 |
| 517 | Ga0495667_0003743 | 3300046559 | Bacteria | 10229 |
| 518 | Ga0495667_0046991 | 3300046559 | Bacteria | 2853 |
| 519 | Ga0495667_0055286 | 3300046559 | Bacteria | 2611 |
| 520 | Ga0495668_0000059 | 3300046616 | Bacteria | 194951 |
| 521 | Ga0495668_0118883 | 3300046616 | Bacteria | 1445 |
| 522 | Ga0495634_0334472 | 3300046642 | Bacteria | 910 |
| 523 | Ga0495611_0014418 | 3300046648 | Bacteria | 3375 |
| 524 | Ga0495611_0036980 | 3300046648 | Bacteria | 2168 |
| 525 | Ga0495625_0000031 | 3300046660 | Bacteria | 238193 |
| 526 | Ga0495625_0000571 | 3300046660 | Bacteria | 53797 |
| 527 | Ga0495625_0009235 | 3300046660 | Bacteria | 8277 |
| 528 | Ga0495625_0017069 | 3300046660 | Bacteria | 5689 |
| 529 | Ga0495625_0224450 | 3300046660 | Bacteria | 1229 |
| 530 | Ga0495625_0362036 | 3300046660 | Bacteria | 914 |
| 531 | Ga0495661_0201061 | 3300046665 | Bacteria | 1043 |
| 532 | Ga0495657_0261248 | 3300046675 | Bacteria | 1040 |
| 533 | Ga0495657_0329966 | 3300046675 | Bacteria | 905 |
| 534 | Ga0495599_0013458 | 3300046678 | Bacteria | 5055 |
| 535 | Ga0495599_0186360 | 3300046678 | Bacteria | 1277 |
| 536 | Ga0495623_0137357 | 3300046679 | Bacteria | 1457 |
| 537 | Ga0495647_0244812 | 3300046681 | Bacteria | 797 |
| 538 | Ga0495669_0000058 | 3300046684 | Bacteria | 76033 |
| 539 | Ga0495613_0100358 | 3300046689 | Bacteria | 2091 |
| 540 | Ga0495670_0157498 | 3300046691 | Bacteria | 1192 |
| 541 | Ga0495670_0176621 | 3300046691 | Bacteria | 1126 |
| 542 | Ga0495671_0004554 | 3300046692 | Bacteria | 8260 |
| 543 | Ga0495649_0020517 | 3300046694 | Bacteria | 3707 |
| 544 | Ga0495600_0001229 | 3300046809 | Bacteria | 14050 |
| 545 | Ga0495600_0039523 | 3300046809 | Bacteria | 3072 |
| 546 | Ga0495600_0116837 | 3300046809 | Bacteria | 1736 |
| 547 | Ga0495604_0170157 | 3300047317 | Bacteria | 1533 |
| 548 | Ga0495674_0099385 | 3300047319 | Bacteria | 2477 |
| 549 | Ga0495674_0146504 | 3300047319 | Bacteria | 1982 |
| 550 | Ga0495683_0002532 | 3300047323 | Bacteria | 10973 |
| 551 | Ga0495683_0030288 | 3300047323 | Bacteria | 2761 |
| 552 | Ga0495687_000083 | 3300047443 | Bacteria | 145688 |
| 553 | Ga0495687_000152 | 3300047443 | Bacteria | 105602 |
| 554 | Ga0495675_0024698 | 3300047444 | Bacteria | 3832 |
| 555 | Ga0495675_0162816 | 3300047444 | Bacteria | 1373 |
| 556 | Ga0495677_0021314 | 3300047445 | Bacteria | 2348 |
| 557 | Ga0495677_0045158 | 3300047445 | Bacteria | 1616 |
| 558 | Ga0495673_0166121 | 3300047469 | Bacteria | 844 |
| 559 | Ga0495681_0008587 | 3300047470 | Bacteria | 6384 |
| 560 | Ga0495681_0109876 | 3300047470 | Bacteria | 1195 |
| 561 | Ga0495684_0069256 | 3300047471 | Bacteria | 2683 |
| 562 | Ga0495684_0090018 | 3300047471 | Bacteria | 2325 |
| 563 | Ga0495686_0000209 | 3300047472 | Bacteria | 108972 |
| 564 | Ga0495602_0001050 | 3300048088 | Bacteria | 26998 |
| 565 | Ga0496101_0162955 | 3300048904 | Bacteria | 1711 |
| 566 | Ga0496101_1113465 | 3300048904 | Bacteria | 620 |
| 567 | Ga0496102_0006473 | 3300048905 | Bacteria | 9985 |
| 568 | Ga0496103_0000099 | 3300048906 | Bacteria | 94046 |
| 569 | Ga0496104_0184966 | 3300048907 | Bacteria | 1994 |
| 570 | Ga0496105_0000502 | 3300048908 | Bacteria | 25826 |
| 571 | Ga0496109_0579009 | 3300048912 | Bacteria | 1058 |
| 572 | Ga0496111_0036294 | 3300048914 | Bacteria | 3524 |
| 573 | Ga0496112_0690480 | 3300048915 | Bacteria | 949 |
| 574 | Ga0496114_0011239 | 3300048917 | Bacteria | 7148 |
| 575 | Ga0496114_1463371 | 3300048917 | Bacteria | 571 |
| 576 | Ga0496115_0000066 | 3300048918 | Bacteria | 95550 |
| 577 | Ga0496115_0002045 | 3300048918 | Bacteria | 14436 |
| 578 | Ga0496116_0039634 | 3300048919 | Bacteria | 3255 |
| 579 | Ga0496117_0000744 | 3300048920 | Bacteria | 51303 |
| 580 | Ga0496117_0142705 | 3300048920 | Bacteria | 1431 |
| 581 | Ga0496117_0418781 | 3300048920 | Bacteria | 670 |
| 582 | Ga0496117_0558117 | 3300048920 | Bacteria | 544 |
| 583 | Ga0496118_0000852 | 3300048921 | Bacteria | 48454 |
| 584 | Ga0496118_0070946 | 3300048921 | Bacteria | 2511 |
| 585 | Ga0496119_0029867 | 3300048922 | Bacteria | 3685 |
| 586 | Ga0496120_0051158 | 3300048923 | Bacteria | 2361 |
| 587 | Ga0496121_0000123 | 3300048924 | Bacteria | 172448 |
| 588 | Ga0496121_0000417 | 3300048924 | Bacteria | 84424 |
| 589 | Ga0496121_0007062 | 3300048924 | Bacteria | 13635 |
| 590 | Ga0496121_0060505 | 3300048924 | Bacteria | 3114 |
| 591 | Ga0496121_0478933 | 3300048924 | Bacteria | 795 |
| 592 | Ga0496122_0009816 | 3300048925 | Bacteria | 9995 |
| 593 | Ga0496122_0338018 | 3300048925 | Bacteria | 792 |
| 594 | Ga0496123_0011327 | 3300048926 | Bacteria | 7746 |
| 595 | Ga0496123_0228533 | 3300048926 | Bacteria | 933 |
| 596 | Ga0496124_0000291 | 3300048927 | Bacteria | 94493 |
| 597 | Ga0496125_0000687 | 3300048928 | Bacteria | 56251 |
| 598 | Ga0496126_0001921 | 3300048929 | Bacteria | 29797 |
| 599 | Ga0496126_0138939 | 3300048929 | Bacteria | 2093 |
| 600 | Ga0495682_0039516 | 3300049460 | Bacteria | 1732 |
| 601 | Ga0501292_109237 | 3300049515 | Bacteria | 555 |
| 602 | Ga0501032_0438965 | 3300049569 | Bacteria | 837 |
| 603 | Ga0501033_0043118 | 3300049570 | Bacteria | 3361 |
| 604 | Ga0501033_0452007 | 3300049570 | Bacteria | 892 |
| 605 | Ga0501034_0042776 | 3300049571 | Bacteria | 4586 |
| 606 | Ga0501034_0132716 | 3300049571 | Bacteria | 2473 |
| 607 | Ga0501034_0322550 | 3300049571 | Bacteria | 1477 |
| 608 | Ga0501037_0313980 | 3300049573 | Bacteria | 1086 |
| 609 | Ga0501038_0466378 | 3300049574 | Bacteria | 969 |
| 610 | Ga0501042_0278549 | 3300049578 | Bacteria | 1208 |
| 611 | Ga0501042_0925303 | 3300049578 | Bacteria | 635 |
| 612 | Ga0501043_0082420 | 3300049579 | Bacteria | 2528 |
| 613 | Ga0501043_1046822 | 3300049579 | Bacteria | 579 |
| 614 | Ga0501046_0926205 | 3300049580 | Bacteria | 607 |
| 615 | Ga0501047_0082116 | 3300049581 | Bacteria | 3098 |
| 616 | Ga0501048_0943195 | 3300049582 | Bacteria | 621 |
| 617 | Ga0501070_1265764 | 3300049586 | Bacteria | 564 |
| 618 | Ga0501080_1621927 | 3300049742 | Bacteria | 547 |
| 619 | Ga0501044_0152344 | 3300049823 | Bacteria | 2294 |
| 620 | Ga0501044_0159668 | 3300049823 | Bacteria | 2232 |
| 621 | Ga0501044_0373772 | 3300049823 | Bacteria | 1341 |
| 622 | Ga0501044_0820588 | 3300049823 | Bacteria | 808 |
| 623 | Ga0501044_1437406 | 3300049823 | Bacteria | 555 |
| 624 | nmdc:mga03683_15265_c1 | 3300050489 | Bacteria | 2863 |
| 625 | nmdc:mga03683_28819_c1 | 3300050489 | Bacteria | 1892 |
| 626 | nmdc:mga03683_42029_c1 | 3300050489 | Bacteria | 1879 |
| 627 | nmdc:mga03n38_228227_c1 | 3300050490 | Bacteria | 975 |
| 628 | nmdc:mga00v17_207561_c1 | 3300050491 | Bacteria | 1267 |
| 629 | nmdc:mga0yw44_176765_c1 | 3300050492 | Bacteria | 1404 |
| 630 | nmdc:mga0yw44_350874_c1 | 3300050492 | Bacteria | 993 |
| 631 | nmdc:mga0yw44_647851_c1 | 3300050492 | Bacteria | 718 |
| 632 | nmdc:mga06z11_125914_c1 | 3300050494 | Bacteria | 1434 |
| 633 | nmdc:mga06z11_71934_c1 | 3300050494 | Bacteria | 1832 |
| 634 | nmdc:mga09592_1221778_c1 | 3300050508 | Bacteria | 620 |
| 635 | nmdc:mga0sz30_54774_c1 | 3300050516 | Bacteria | 1697 |
| 636 | Ga0495601_0001228 | 3300053077 | Bacteria | 14075 |
| 637 | Ga0495612_0002265 | 3300053078 | Bacteria | 7919 |
| 638 | Ga0500610_0000029 | 3300053079 | Bacteria | 52531 |
| 639 | Ga0495595_0633130 | 3300053084 | Bacteria | 547 |
| 640 | Ga0495619_0042398 | 3300053085 | Bacteria | 2980 |
| 641 | Ga0495619_0061883 | 3300053085 | Bacteria | 2491 |
| 642 | Ga0500643_000850 | 3300053087 | Bacteria | 19500 |
| 643 | Ga0500643_142645 | 3300053087 | Bacteria | 643 |
| 644 | Ga0500644_0439248 | 3300053088 | Bacteria | 571 |
| 645 | Ga0500647_0033566 | 3300053091 | Bacteria | 2448 |
| 646 | Ga0500583_0019875 | 3300053092 | Bacteria | 2762 |
| 647 | Ga0500583_0553297 | 3300053092 | Bacteria | 534 |
| 648 | Ga0500566_0367408 | 3300053094 | Bacteria | 654 |
| 649 | Ga0500641_0002425 | 3300053096 | Bacteria | 6617 |
| 650 | Ga0500641_0038567 | 3300053096 | Bacteria | 1921 |
| 651 | Ga0500594_0006984 | 3300053118 | Bacteria | 2547 |
| 652 | Ga0500595_009699 | 3300053119 | Bacteria | 3875 |
| 653 | Ga0500642_0002483 | 3300053130 | Bacteria | 5424 |
| 654 | Ga0500642_0027140 | 3300053130 | Bacteria | 2347 |
| 655 | Ga0500652_002754 | 3300053131 | Bacteria | 5306 |
| 656 | Ga0500658_0006334 | 3300053134 | Bacteria | 4392 |
| 657 | Ga0500559_0003405 | 3300053136 | Bacteria | 7831 |
| 658 | Ga0500559_0040520 | 3300053136 | Bacteria | 2028 |
| 659 | Ga0500559_0147291 | 3300053136 | Bacteria | 1104 |
| 660 | Ga0500559_0221578 | 3300053136 | Bacteria | 892 |
| 661 | Ga0500568_0058068 | 3300053139 | Bacteria | 1504 |
| 662 | Ga0500568_0115510 | 3300053139 | Bacteria | 1002 |
| 663 | Ga0500573_0000010 | 3300053140 | Bacteria | 210704 |
| 664 | Ga0500616_0002245 | 3300053153 | Bacteria | 16516 |
| 665 | Ga0500619_006273 | 3300053154 | Bacteria | 2728 |
| 666 | Ga0500636_0020266 | 3300053177 | Bacteria | 3936 |
| 667 | Ga0500645_000019 | 3300053730 | Bacteria | 135445 |
| 668 | Ga0500596_009933 | 3300053735 | Bacteria | 1477 |
| 669 | Ga0501082_0870826 | 3300060353 | Bacteria | 788 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053136 | Ga0500559_0003405 | Ga0500559_0003405_6576_7052 | 135 |
| 2 | 3300048925 | Ga0496122_0338018 | Ga0496122_0338018_110_586 | 136 |
| 3 | 3300036712 | Ga0316584_0087156 | Ga0316584_0087156_1059_1553 | 141 |
| 4 | 3300014497 | Ga0182008_10265204 | Ga0182008_102652042 | 143 |
| 5 | 3300025986 | Ga0207658_10711923 | Ga0207658_107119232 | 143 |
| 6 | 3300046520 | Ga0495637_0043585 | Ga0495637_0043585_843_1277 | 144 |
| 7 | iso_pu_bacteria | 2597490356 | 2599104998 | 148 |
| 8 | iso_pu_bacteria | 2830075706 | 2830076236 | 148 |
| 9 | iso_pu_bacteria | 2846952575 | 2846954281 | 148 |
| 10 | iso_pu_bacteria | 2848858292 | 2848859484 | 148 |
| 11 | iso_pu_bacteria | 2885429604 | 2885432398 | 148 |
| 12 | iso_pu_bacteria | 2946787523 | 2946790119 | 148 |
| 13 | 3300049571 | Ga0501034_0042776 | Ga0501034_0042776_147_599 | 149 |
| 14 | 3300049573 | Ga0501037_0313980 | Ga0501037_0313980_292_744 | 149 |
| 15 | 3300049823 | Ga0501044_0152344 | Ga0501044_0152344_639_1091 | 149 |
| 16 | iso_pu_bacteria | 2751185897 | 2753765831 | 149 |
| 17 | iso_pu_bacteria | 2909399089 | 2909402512 | 149 |
| 18 | iso_pu_bacteria | 641228493 | 641335699 | 149 |
| 19 | iso_pu_bacteria | 643348555 | 643393054 | 149 |
| 20 | 3300005329 | Ga0070683_100766819 | Ga0070683_1007668191 | 150 |
| 21 | 3300005354 | Ga0070675_100325133 | Ga0070675_1003251332 | 150 |
| 22 | 3300005434 | Ga0070709_10110109 | Ga0070709_101101092 | 150 |
| 23 | 3300005435 | Ga0070714_100000478 | Ga0070714_10000047830 | 150 |
| 24 | 3300005435 | Ga0070714_100674890 | Ga0070714_1006748901 | 150 |
| 25 | 3300005435 | Ga0070714_100832976 | Ga0070714_1008329762 | 150 |
| 26 | 3300005436 | Ga0070713_100132319 | Ga0070713_1001323192 | 150 |
| 27 | 3300005436 | Ga0070713_100521309 | Ga0070713_1005213091 | 150 |
| 28 | 3300005436 | Ga0070713_101195611 | Ga0070713_1011956112 | 150 |
| 29 | 3300005437 | Ga0070710_10086418 | Ga0070710_100864182 | 150 |
| 30 | 3300005437 | Ga0070710_10258928 | Ga0070710_102589282 | 150 |
| 31 | 3300005439 | Ga0070711_100300663 | Ga0070711_1003006632 | 150 |
| 32 | 3300005439 | Ga0070711_100372260 | Ga0070711_1003722602 | 150 |
| 33 | 3300005458 | Ga0070681_11202614 | Ga0070681_112026141 | 150 |
| 34 | 3300005530 | Ga0070679_100117813 | Ga0070679_1001178132 | 150 |
| 35 | 3300005546 | Ga0070696_101673121 | Ga0070696_1016731211 | 150 |
| 36 | 3300005548 | Ga0070665_100207851 | Ga0070665_1002078512 | 150 |
| 37 | 3300005563 | Ga0068855_101242216 | Ga0068855_1012422162 | 150 |
| 38 | 3300005563 | Ga0068855_101351070 | Ga0068855_1013510701 | 150 |
| 39 | 3300005578 | Ga0068854_100744305 | Ga0068854_1007443052 | 150 |
| 40 | 3300005614 | Ga0068856_100562267 | Ga0068856_1005622672 | 150 |
| 41 | 3300005834 | Ga0068851_10133527 | Ga0068851_101335272 | 150 |
| 42 | 3300005842 | Ga0068858_100184765 | Ga0068858_1001847652 | 150 |
| 43 | 3300006028 | Ga0070717_10108594 | Ga0070717_101085942 | 150 |
| 44 | 3300006175 | Ga0070712_100091509 | Ga0070712_1000915092 | 150 |
| 45 | 3300009101 | Ga0105247_10567932 | Ga0105247_105679322 | 150 |
| 46 | 3300009176 | Ga0105242_11756561 | Ga0105242_117565611 | 150 |
| 47 | 3300009177 | Ga0105248_10028391 | Ga0105248_100283913 | 150 |
| 48 | 3300010375 | Ga0105239_11110537 | Ga0105239_111105371 | 150 |
| 49 | 3300013105 | Ga0157369_10208094 | Ga0157369_102080942 | 150 |
| 50 | 3300013105 | Ga0157369_12053384 | Ga0157369_120533841 | 150 |
| 51 | 3300013296 | Ga0157374_10200350 | Ga0157374_102003502 | 150 |
| 52 | 3300013296 | Ga0157374_12943906 | Ga0157374_129439061 | 150 |
| 53 | 3300014325 | Ga0163163_10370444 | Ga0163163_103704442 | 150 |
| 54 | 3300014325 | Ga0163163_11084778 | Ga0163163_110847782 | 150 |
| 55 | 3300014497 | Ga0182008_10025204 | Ga0182008_100252044 | 150 |
| 56 | 3300014968 | Ga0157379_10743872 | Ga0157379_107438722 | 150 |
| 57 | 3300020069 | Ga0197907_10784425 | Ga0197907_107844251 | 150 |
| 58 | 3300020081 | Ga0206354_11056629 | Ga0206354_110566292 | 150 |
| 59 | 3300021377 | Ga0213874_10054300 | Ga0213874_100543002 | 150 |
| 60 | 3300021377 | Ga0213874_10182690 | Ga0213874_101826902 | 150 |
| 61 | 3300021388 | Ga0213875_10010530 | Ga0213875_100105305 | 150 |
| 62 | 3300022467 | Ga0224712_10370181 | Ga0224712_103701812 | 150 |
| 63 | 3300025898 | Ga0207692_10076414 | Ga0207692_100764142 | 150 |
| 64 | 3300025900 | Ga0207710_10286067 | Ga0207710_102860672 | 150 |
| 65 | 3300025903 | Ga0207680_10870489 | Ga0207680_108704892 | 150 |
| 66 | 3300025906 | Ga0207699_10060841 | Ga0207699_100608412 | 150 |
| 67 | 3300025906 | Ga0207699_10461018 | Ga0207699_104610182 | 150 |
| 68 | 3300025911 | Ga0207654_11046368 | Ga0207654_110463681 | 150 |
| 69 | 3300025912 | Ga0207707_10576723 | Ga0207707_105767231 | 150 |
| 70 | 3300025915 | Ga0207693_10218841 | Ga0207693_102188412 | 150 |
| 71 | 3300025916 | Ga0207663_10019835 | Ga0207663_100198352 | 150 |
| 72 | 3300025916 | Ga0207663_10766946 | Ga0207663_107669462 | 150 |
| 73 | 3300025921 | Ga0207652_10051658 | Ga0207652_100516584 | 150 |
| 74 | 3300025926 | Ga0207659_10525561 | Ga0207659_105255612 | 150 |
| 75 | 3300025928 | Ga0207700_10039287 | Ga0207700_100392874 | 150 |
| 76 | 3300025928 | Ga0207700_10242609 | Ga0207700_102426092 | 150 |
| 77 | 3300025929 | Ga0207664_10001839 | Ga0207664_100018396 | 150 |
| 78 | 3300025929 | Ga0207664_10120460 | Ga0207664_101204603 | 150 |
| 79 | 3300025937 | Ga0207669_10434778 | Ga0207669_104347782 | 150 |
| 80 | 3300025941 | Ga0207711_10156055 | Ga0207711_101560552 | 150 |
| 81 | 3300025949 | Ga0207667_11130126 | Ga0207667_111301262 | 150 |
| 82 | 3300025981 | Ga0207640_10621884 | Ga0207640_106218842 | 150 |
| 83 | 3300026035 | Ga0207703_10180831 | Ga0207703_101808312 | 150 |
| 84 | 3300026078 | Ga0207702_10708402 | Ga0207702_107084022 | 150 |
| 85 | 3300028379 | Ga0268266_10054911 | Ga0268266_100549113 | 150 |
| 86 | 3300028379 | Ga0268266_10377750 | Ga0268266_103777502 | 150 |
| 87 | 3300035083 | Ga0373926_0114580 | Ga0373926_0114580_522_977 | 150 |
| 88 | 3300035086 | Ga0373934_0098706 | Ga0373934_0098706_284_739 | 150 |
| 89 | 3300035111 | Ga0373923_0177992 | Ga0373923_0177992_288_743 | 150 |
| 90 | 3300035111 | Ga0373923_0311234 | Ga0373923_0311234_184_639 | 150 |
| 91 | 3300035113 | Ga0373936_0024693 | Ga0373936_0024693_566_1021 | 150 |
| 92 | 3300035113 | Ga0373936_0045831 | Ga0373936_0045831_744_1199 | 150 |
| 93 | 3300035113 | Ga0373936_0073083 | Ga0373936_0073083_132_587 | 150 |
| 94 | 3300035116 | Ga0373945_0147482 | Ga0373945_0147482_129_584 | 150 |
| 95 | 3300035117 | Ga0373953_0015069 | Ga0373953_0015069_1803_2258 | 150 |
| 96 | 3300035118 | Ga0373954_0060128 | Ga0373954_0060128_365_820 | 150 |
| 97 | 3300035118 | Ga0373954_0077163 | Ga0373954_0077163_833_1288 | 150 |
| 98 | 3300035119 | Ga0373956_0044412 | Ga0373956_0044412_361_816 | 150 |
| 99 | 3300035119 | Ga0373956_0409602 | Ga0373956_0409602_88_543 | 150 |
| 100 | 3300035120 | Ga0373957_0045097 | Ga0373957_0045097_880_1335 | 150 |
| 101 | 3300035120 | Ga0373957_0200554 | Ga0373957_0200554_117_572 | 150 |
| 102 | 3300035171 | Ga0373946_0059113 | Ga0373946_0059113_783_1238 | 150 |
| 103 | 3300035171 | Ga0373946_0106241 | Ga0373946_0106241_34_489 | 150 |
| 104 | 3300035171 | Ga0373946_0388545 | Ga0373946_0388545_91_546 | 150 |
| 105 | 3300035172 | Ga0373955_0038544 | Ga0373955_0038544_642_1097 | 150 |
| 106 | 3300035172 | Ga0373955_0047885 | Ga0373955_0047885_510_965 | 150 |
| 107 | 3300035172 | Ga0373955_0102133 | Ga0373955_0102133_738_1193 | 150 |
| 108 | 3300035692 | Ga0373935_0038660 | Ga0373935_0038660_1875_2330 | 150 |
| 109 | 3300035692 | Ga0373935_0116150 | Ga0373935_0116150_498_953 | 150 |
| 110 | 3300035692 | Ga0373935_0211191 | Ga0373935_0211191_526_981 | 150 |
| 111 | 3300035695 | Ga0373927_0041227 | Ga0373927_0041227_1203_1658 | 150 |
| 112 | 3300035695 | Ga0373927_0149954 | Ga0373927_0149954_390_845 | 150 |
| 113 | 3300035724 | Ga0373933_0066700 | Ga0373933_0066700_851_1306 | 150 |
| 114 | 3300035725 | Ga0373947_0025308 | Ga0373947_0025308_719_1174 | 150 |
| 115 | 3300035725 | Ga0373947_0179640 | Ga0373947_0179640_759_1214 | 150 |
| 116 | 3300036401 | Ga0373937_0000734 | Ga0373937_0000734_24800_25255 | 150 |
| 117 | 3300036401 | Ga0373937_0021679 | Ga0373937_0021679_2883_3338 | 150 |
| 118 | 3300036401 | Ga0373937_0322569 | Ga0373937_0322569_661_1116 | 150 |
| 119 | 3300036401 | Ga0373937_0579457 | Ga0373937_0579457_342_797 | 150 |
| 120 | 3300036401 | Ga0373937_1700300 | Ga0373937_1700300_80_535 | 150 |
| 121 | 3300037068 | Ga0373925_0005630 | Ga0373925_0005630_353_808 | 150 |
| 122 | 3300037068 | Ga0373925_0255139 | Ga0373925_0255139_815_1270 | 150 |
| 123 | 3300037068 | Ga0373925_0711561 | Ga0373925_0711561_196_651 | 150 |
| 124 | 3300037312 | Ga0395899_0055370 | Ga0395899_0055370_42_500 | 150 |
| 125 | 3300037418 | Ga0395900_0021292 | Ga0395900_0021292_316_774 | 150 |
| 126 | 3300037418 | Ga0395900_0920444 | Ga0395900_0920444_216_674 | 150 |
| 127 | 3300037466 | Ga0395898_0389718 | Ga0395898_0389718_555_1013 | 150 |
| 128 | 3300037853 | Ga0436364_0071585 | Ga0436364_0071585_1188_1643 | 150 |
| 129 | 3300037853 | Ga0436364_0135989 | Ga0436364_0135989_1412_1867 | 150 |
| 130 | 3300037853 | Ga0436364_0748963 | Ga0436364_0748963_708_1163 | 150 |
| 131 | 3300037853 | Ga0436364_0878606 | Ga0436364_0878606_1353_1808 | 150 |
| 132 | 3300037853 | Ga0436364_1347066 | Ga0436364_1347066_697_1152 | 150 |
| 133 | 3300037853 | Ga0436364_1488888 | Ga0436364_1488888_2619_3074 | 150 |
| 134 | 3300038443 | Ga0395901_0012568 | Ga0395901_0012568_7818_8276 | 150 |
| 135 | 3300039437 | Ga0436365_0171907 | Ga0436365_0171907_37_492 | 150 |
| 136 | 3300039437 | Ga0436365_0772100 | Ga0436365_0772100_115_570 | 150 |
| 137 | 3300039438 | Ga0436360_1011171 | Ga0436360_1011171_329_784 | 150 |
| 138 | 3300039450 | Ga0436363_0420453 | Ga0436363_0420453_248_703 | 150 |
| 139 | 3300039450 | Ga0436363_0631560 | Ga0436363_0631560_105_560 | 150 |
| 140 | 3300039450 | Ga0436363_1618324 | Ga0436363_1618324_155_610 | 150 |
| 141 | 3300039450 | Ga0436363_1706959 | Ga0436363_1706959_69_524 | 150 |
| 142 | 3300039453 | Ga0436362_1137136 | Ga0436362_1137136_195_650 | 150 |
| 143 | 3300039453 | Ga0436362_1232813 | Ga0436362_1232813_245_700 | 150 |
| 144 | 3300044694 | Ga0466963_0310092 | Ga0466963_0310092_165_620 | 150 |
| 145 | 3300044712 | Ga0453684_0212646 | Ga0453684_0212646_587_1042 | 150 |
| 146 | 3300045836 | Ga0466958_0843359 | Ga0466958_0843359_112_567 | 150 |
| 147 | 3300045976 | Ga0466967_1162654 | Ga0466967_1162654_202_657 | 150 |
| 148 | 3300046454 | Ga0495592_0012195 | Ga0495592_0012195_1648_2103 | 150 |
| 149 | 3300046455 | Ga0495603_0829359 | Ga0495603_0829359_25_480 | 150 |
| 150 | 3300046459 | Ga0495629_0357267 | Ga0495629_0357267_351_806 | 150 |
| 151 | 3300046459 | Ga0495629_0693028 | Ga0495629_0693028_33_488 | 150 |
| 152 | 3300046462 | Ga0495651_0112340 | Ga0495651_0112340_972_1427 | 150 |
| 153 | 3300046463 | Ga0495653_0233527 | Ga0495653_0233527_408_863 | 150 |
| 154 | 3300046472 | Ga0495580_0897668 | Ga0495580_0897668_48_503 | 150 |
| 155 | 3300046477 | Ga0495664_0001900 | Ga0495664_0001900_9491_9946 | 150 |
| 156 | 3300046499 | Ga0495594_0200986 | Ga0495594_0200986_151_606 | 150 |
| 157 | 3300046511 | Ga0495608_0007407 | Ga0495608_0007407_4903_5358 | 150 |
| 158 | 3300046511 | Ga0495608_0032915 | Ga0495608_0032915_2831_3286 | 150 |
| 159 | 3300046511 | Ga0495608_0193013 | Ga0495608_0193013_347_802 | 150 |
| 160 | 3300046516 | Ga0495628_0056372 | Ga0495628_0056372_1251_1706 | 150 |
| 161 | 3300046517 | Ga0495630_0243788 | Ga0495630_0243788_621_1076 | 150 |
| 162 | 3300046517 | Ga0495630_0633773 | Ga0495630_0633773_74_529 | 150 |
| 163 | 3300046529 | Ga0495652_0156645 | Ga0495652_0156645_183_638 | 150 |
| 164 | 3300046531 | Ga0495665_0188602 | Ga0495665_0188602_246_701 | 150 |
| 165 | 3300046533 | Ga0495640_0025113 | Ga0495640_0025113_338_793 | 150 |
| 166 | 3300046533 | Ga0495640_0221511 | Ga0495640_0221511_438_893 | 150 |
| 167 | 3300046536 | Ga0495587_0014199 | Ga0495587_0014199_1806_2261 | 150 |
| 168 | 3300046536 | Ga0495587_0461402 | Ga0495587_0461402_62_517 | 150 |
| 169 | 3300046543 | Ga0495645_0002599 | Ga0495645_0002599_5884_6339 | 150 |
| 170 | 3300046543 | Ga0495645_0187470 | Ga0495645_0187470_832_1287 | 150 |
| 171 | 3300046559 | Ga0495667_0003743 | Ga0495667_0003743_2503_2958 | 150 |
| 172 | 3300046559 | Ga0495667_0046991 | Ga0495667_0046991_1517_1972 | 150 |
| 173 | 3300046559 | Ga0495667_0055286 | Ga0495667_0055286_2142_2597 | 150 |
| 174 | 3300046642 | Ga0495634_0334472 | Ga0495634_0334472_350_805 | 150 |
| 175 | 3300046675 | Ga0495657_0261248 | Ga0495657_0261248_217_672 | 150 |
| 176 | 3300046675 | Ga0495657_0329966 | Ga0495657_0329966_255_710 | 150 |
| 177 | 3300046678 | Ga0495599_0013458 | Ga0495599_0013458_3882_4337 | 150 |
| 178 | 3300046678 | Ga0495599_0186360 | Ga0495599_0186360_759_1214 | 150 |
| 179 | 3300046679 | Ga0495623_0137357 | Ga0495623_0137357_776_1231 | 150 |
| 180 | 3300046681 | Ga0495647_0244812 | Ga0495647_0244812_82_537 | 150 |
| 181 | 3300046809 | Ga0495600_0039523 | Ga0495600_0039523_49_504 | 150 |
| 182 | 3300046809 | Ga0495600_0116837 | Ga0495600_0116837_729_1184 | 150 |
| 183 | 3300047317 | Ga0495604_0170157 | Ga0495604_0170157_462_917 | 150 |
| 184 | 3300047319 | Ga0495674_0099385 | Ga0495674_0099385_1948_2403 | 150 |
| 185 | 3300047319 | Ga0495674_0146504 | Ga0495674_0146504_251_706 | 150 |
| 186 | 3300047444 | Ga0495675_0024698 | Ga0495675_0024698_40_495 | 150 |
| 187 | 3300047444 | Ga0495675_0162816 | Ga0495675_0162816_651_1106 | 150 |
| 188 | 3300047471 | Ga0495684_0069256 | Ga0495684_0069256_1249_1704 | 150 |
| 189 | 3300047471 | Ga0495684_0090018 | Ga0495684_0090018_1858_2313 | 150 |
| 190 | 3300048088 | Ga0495602_0001050 | Ga0495602_0001050_11767_12222 | 150 |
| 191 | 3300048904 | Ga0496101_1113465 | Ga0496101_1113465_86_541 | 150 |
| 192 | 3300048915 | Ga0496112_0690480 | Ga0496112_0690480_246_701 | 150 |
| 193 | 3300049570 | Ga0501033_0043118 | Ga0501033_0043118_1748_2203 | 150 |
| 194 | 3300049823 | Ga0501044_0820588 | Ga0501044_0820588_266_721 | 150 |
| 195 | 3300053077 | Ga0495601_0001228 | Ga0495601_0001228_7946_8401 | 150 |
| 196 | 3300053078 | Ga0495612_0002265 | Ga0495612_0002265_5864_6319 | 150 |
| 197 | 3300053084 | Ga0495595_0633130 | Ga0495595_0633130_16_471 | 150 |
| 198 | 3300053085 | Ga0495619_0042398 | Ga0495619_0042398_879_1334 | 150 |
| 199 | 3300053085 | Ga0495619_0061883 | Ga0495619_0061883_486_941 | 150 |
| 200 | 3300053140 | Ga0500573_0000010 | Ga0500573_0000010_18150_18602 | 150 |
| 201 | 3300053131 | Ga0500652_002754 | Ga0500652_002754_901_1359 | 151 |
| 202 | 3300002459 | JGI24751J29686_10072127 | JGI24751J29686_100721271 | 152 |
| 203 | 3300003316 | rootH1_10165260 | rootH1_101652602 | 152 |
| 204 | 3300003323 | rootH1_10305472 | rootH1_103054722 | 152 |
| 205 | 3300005331 | Ga0070670_100042394 | Ga0070670_1000423943 | 152 |
| 206 | 3300005367 | Ga0070667_100021285 | Ga0070667_1000212854 | 152 |
| 207 | 3300005617 | Ga0068859_100000085 | Ga0068859_10000008531 | 152 |
| 208 | 3300006931 | Ga0097620_100000085 | Ga0097620_10000008531 | 152 |
| 209 | 3300009093 | Ga0105240_10036237 | Ga0105240_100362371 | 152 |
| 210 | 3300009101 | Ga0105247_10003709 | Ga0105247_100037094 | 152 |
| 211 | 3300009148 | Ga0105243_10058660 | Ga0105243_100586602 | 152 |
| 212 | 3300009177 | Ga0105248_10019502 | Ga0105248_100195028 | 152 |
| 213 | 3300009545 | Ga0105237_10008752 | Ga0105237_100087529 | 152 |
| 214 | 3300009545 | Ga0105237_11634267 | Ga0105237_116342672 | 152 |
| 215 | 3300009553 | Ga0105249_10001806 | Ga0105249_1000180613 | 152 |
| 216 | 3300010375 | Ga0105239_10000060 | Ga0105239_10000060112 | 152 |
| 217 | 3300013105 | Ga0157369_10479292 | Ga0157369_104792921 | 152 |
| 218 | 3300013306 | Ga0163162_10128733 | Ga0163162_101287332 | 152 |
| 219 | 3300025900 | Ga0207710_10004115 | Ga0207710_100041154 | 152 |
| 220 | 3300025913 | Ga0207695_10044491 | Ga0207695_100444912 | 152 |
| 221 | 3300025913 | Ga0207695_10052176 | Ga0207695_100521764 | 152 |
| 222 | 3300025914 | Ga0207671_10002033 | Ga0207671_1000203317 | 152 |
| 223 | 3300025925 | Ga0207650_10036667 | Ga0207650_100366672 | 152 |
| 224 | 3300025961 | Ga0207712_10007444 | Ga0207712_100074444 | 152 |
| 225 | 3300025986 | Ga0207658_10016459 | Ga0207658_100164593 | 152 |
| 226 | 3300026116 | Ga0207674_10740985 | Ga0207674_107409852 | 152 |
| 227 | 3300028379 | Ga0268266_10064475 | Ga0268266_100644751 | 152 |
| 228 | 3300037853 | Ga0436364_0429284 | Ga0436364_0429284_55_516 | 152 |
| 229 | 3300039450 | Ga0436363_1046130 | Ga0436363_1046130_268_732 | 152 |
| 230 | 3300039450 | Ga0436363_1048080 | Ga0436363_1048080_16_480 | 152 |
| 231 | 3300046542 | Ga0495597_0280788 | Ga0495597_0280788_114_575 | 152 |
| 232 | 3300046692 | Ga0495671_0004554 | Ga0495671_0004554_4035_4496 | 152 |
| 233 | 3300048920 | Ga0496117_0142705 | Ga0496117_0142705_256_717 | 152 |
| 234 | 3300048920 | Ga0496117_0418781 | Ga0496117_0418781_33_494 | 152 |
| 235 | 3300048921 | Ga0496118_0070946 | Ga0496118_0070946_491_952 | 152 |
| 236 | 3300048924 | Ga0496121_0007062 | Ga0496121_0007062_794_1255 | 152 |
| 237 | 3300048924 | Ga0496121_0060505 | Ga0496121_0060505_1905_2366 | 152 |
| 238 | 3300048929 | Ga0496126_0138939 | Ga0496126_0138939_653_1114 | 152 |
| 239 | 3300049574 | Ga0501038_0466378 | Ga0501038_0466378_335_796 | 152 |
| 240 | 3300049579 | Ga0501043_1046822 | Ga0501043_1046822_31_492 | 152 |
| 241 | 3300049823 | Ga0501044_0159668 | Ga0501044_0159668_1373_1897 | 152 |
| 242 | 3300053118 | Ga0500594_0006984 | Ga0500594_0006984_1668_2129 | 152 |
| 243 | 3300002773 | JGI25152J39213_1028504 | JGI25152J39213_10285042 | 153 |
| 244 | 3300002774 | JGI25150J39212_1000177 | JGI25150J39212_100017717 | 153 |
| 245 | 3300003187 | JGI25151J46595_10100177 | JGI25151J46595_101001771 | 153 |
| 246 | 3300003203 | JGI25406J46586_10177799 | JGI25406J46586_101777991 | 153 |
| 247 | 3300003215 | JGI25153J46596_10000064 | JGI25153J46596_10000064137 | 153 |
| 248 | 3300003773 | Ga0055537_1002015 | Ga0055537_10020156 | 153 |
| 249 | 3300003781 | Ga0055536_1027551 | Ga0055536_10275512 | 153 |
| 250 | 3300003792 | Ga0055540_1000762 | Ga0055540_10007628 | 153 |
| 251 | 3300005327 | Ga0070658_10179180 | Ga0070658_101791802 | 153 |
| 252 | 3300005327 | Ga0070658_11357621 | Ga0070658_113576211 | 153 |
| 253 | 3300005334 | Ga0068869_101530177 | Ga0068869_1015301771 | 153 |
| 254 | 3300005335 | Ga0070666_10620249 | Ga0070666_106202491 | 153 |
| 255 | 3300005347 | Ga0070668_100627169 | Ga0070668_1006271691 | 153 |
| 256 | 3300005356 | Ga0070674_100791959 | Ga0070674_1007919591 | 153 |
| 257 | 3300005436 | Ga0070713_100170820 | Ga0070713_1001708203 | 153 |
| 258 | 3300005445 | Ga0070708_100003894 | Ga0070708_10000389412 | 153 |
| 259 | 3300005456 | Ga0070678_101328854 | Ga0070678_1013288541 | 153 |
| 260 | 3300005458 | Ga0070681_10138885 | Ga0070681_101388852 | 153 |
| 261 | 3300005466 | Ga0070685_10435061 | Ga0070685_104350612 | 153 |
| 262 | 3300005467 | Ga0070706_100070961 | Ga0070706_1000709613 | 153 |
| 263 | 3300005468 | Ga0070707_100107642 | Ga0070707_1001076422 | 153 |
| 264 | 3300005471 | Ga0070698_100002550 | Ga0070698_10000255010 | 153 |
| 265 | 3300005518 | Ga0070699_100104442 | Ga0070699_1001044422 | 153 |
| 266 | 3300005530 | Ga0070679_100252856 | Ga0070679_1002528562 | 153 |
| 267 | 3300005539 | Ga0068853_100382407 | Ga0068853_1003824073 | 153 |
| 268 | 3300005539 | Ga0068853_101333544 | Ga0068853_1013335442 | 153 |
| 269 | 3300005548 | Ga0070665_100144679 | Ga0070665_1001446793 | 153 |
| 270 | 3300005548 | Ga0070665_100869105 | Ga0070665_1008691052 | 153 |
| 271 | 3300005577 | Ga0068857_100280377 | Ga0068857_1002803772 | 153 |
| 272 | 3300005577 | Ga0068857_100396414 | Ga0068857_1003964142 | 153 |
| 273 | 3300005577 | Ga0068857_101004796 | Ga0068857_1010047962 | 153 |
| 274 | 3300005578 | Ga0068854_100319177 | Ga0068854_1003191772 | 153 |
| 275 | 3300005615 | Ga0070702_100910951 | Ga0070702_1009109511 | 153 |
| 276 | 3300005617 | Ga0068859_101494467 | Ga0068859_1014944672 | 153 |
| 277 | 3300005718 | Ga0068866_10761395 | Ga0068866_107613951 | 153 |
| 278 | 3300005842 | Ga0068858_100000122 | Ga0068858_10000012233 | 153 |
| 279 | 3300005842 | Ga0068858_100000166 | Ga0068858_10000016622 | 153 |
| 280 | 3300005843 | Ga0068860_100049220 | Ga0068860_1000492205 | 153 |
| 281 | 3300005937 | Ga0081455_10000933 | Ga0081455_100009337 | 153 |
| 282 | 3300005937 | Ga0081455_10002813 | Ga0081455_100028139 | 153 |
| 283 | 3300005937 | Ga0081455_10035376 | Ga0081455_100353764 | 153 |
| 284 | 3300005981 | Ga0081538_10111882 | Ga0081538_101118822 | 153 |
| 285 | 3300005983 | Ga0081540_1132378 | Ga0081540_11323782 | 153 |
| 286 | 3300005985 | Ga0081539_10012874 | Ga0081539_100128742 | 153 |
| 287 | 3300005985 | Ga0081539_10016575 | Ga0081539_100165752 | 153 |
| 288 | 3300005985 | Ga0081539_10333994 | Ga0081539_103339941 | 153 |
| 289 | 3300006028 | Ga0070717_10306885 | Ga0070717_103068852 | 153 |
| 290 | 3300006038 | Ga0075365_10072925 | Ga0075365_100729252 | 153 |
| 291 | 3300006038 | Ga0075365_10356948 | Ga0075365_103569482 | 153 |
| 292 | 3300006038 | Ga0075365_10514117 | Ga0075365_105141172 | 153 |
| 293 | 3300006177 | Ga0075362_10021792 | Ga0075362_100217922 | 153 |
| 294 | 3300006177 | Ga0075362_10027924 | Ga0075362_100279242 | 153 |
| 295 | 3300006178 | Ga0075367_10083752 | Ga0075367_100837522 | 153 |
| 296 | 3300006186 | Ga0075369_10079337 | Ga0075369_100793372 | 153 |
| 297 | 3300006186 | Ga0075369_10529269 | Ga0075369_105292691 | 153 |
| 298 | 3300006195 | Ga0075366_10026426 | Ga0075366_100264262 | 153 |
| 299 | 3300006358 | Ga0068871_101595291 | Ga0068871_1015952912 | 153 |
| 300 | 3300006931 | Ga0097620_101494475 | Ga0097620_1014944752 | 153 |
| 301 | 3300007265 | Ga0099794_10617623 | Ga0099794_106176231 | 153 |
| 302 | 3300009098 | Ga0105245_10000623 | Ga0105245_100006237 | 153 |
| 303 | 3300009147 | Ga0114129_11042589 | Ga0114129_110425892 | 153 |
| 304 | 3300009148 | Ga0105243_10007245 | Ga0105243_100072457 | 153 |
| 305 | 3300009176 | Ga0105242_11574450 | Ga0105242_115744502 | 153 |
| 306 | 3300009177 | Ga0105248_10031813 | Ga0105248_100318135 | 153 |
| 307 | 3300009177 | Ga0105248_11172460 | Ga0105248_111724602 | 153 |
| 308 | 3300009553 | Ga0105249_10039113 | Ga0105249_100391134 | 153 |
| 309 | 3300010375 | Ga0105239_10712179 | Ga0105239_107121792 | 153 |
| 310 | 3300011119 | Ga0105246_10188788 | Ga0105246_101887882 | 153 |
| 311 | 3300013104 | Ga0157370_10131531 | Ga0157370_101315313 | 153 |
| 312 | 3300013297 | Ga0157378_10018568 | Ga0157378_100185684 | 153 |
| 313 | 3300013306 | Ga0163162_10017302 | Ga0163162_100173024 | 153 |
| 314 | 3300013306 | Ga0163162_10228292 | Ga0163162_102282923 | 153 |
| 315 | 3300013306 | Ga0163162_10305166 | Ga0163162_103051663 | 153 |
| 316 | 3300013306 | Ga0163162_10512062 | Ga0163162_105120622 | 153 |
| 317 | 3300013306 | Ga0163162_11400432 | Ga0163162_114004321 | 153 |
| 318 | 3300013308 | Ga0157375_10413475 | Ga0157375_104134753 | 153 |
| 319 | 3300014969 | Ga0157376_10236103 | Ga0157376_102361032 | 153 |
| 320 | 3300015690 | Ga0183363_1010 | Ga0183363_101094 | 153 |
| 321 | 3300017792 | Ga0163161_10984966 | Ga0163161_109849662 | 153 |
| 322 | 3300021361 | Ga0213872_10027728 | Ga0213872_100277282 | 153 |
| 323 | 3300021384 | Ga0213876_10064836 | Ga0213876_100648362 | 153 |
| 324 | 3300025233 | Ga0209437_104206 | Ga0209437_1042063 | 153 |
| 325 | 3300025245 | Ga0207425_1000019 | Ga0207425_1000019342 | 153 |
| 326 | 3300025258 | Ga0209129_1001013 | Ga0209129_100101312 | 153 |
| 327 | 3300025261 | Ga0209233_1000107 | Ga0209233_100010769 | 153 |
| 328 | 3300025263 | Ga0209565_1000166 | Ga0209565_100016677 | 153 |
| 329 | 3300025273 | Ga0209673_1014928 | Ga0209673_10149286 | 153 |
| 330 | 3300025292 | Ga0209676_1009397 | Ga0209676_10093972 | 153 |
| 331 | 3300025292 | Ga0209676_1021032 | Ga0209676_10210322 | 153 |
| 332 | 3300025294 | Ga0209025_1000304 | Ga0209025_100030461 | 153 |
| 333 | 3300025295 | Ga0209564_1001084 | Ga0209564_100108415 | 153 |
| 334 | 3300025295 | Ga0209564_1001084 | Ga0209564_10010846 | 153 |
| 335 | 3300025297 | Ga0209758_1000019 | Ga0209758_1000019245 | 153 |
| 336 | 3300025298 | Ga0209050_1000001 | Ga0209050_10000011310 | 153 |
| 337 | 3300025298 | Ga0209050_1019174 | Ga0209050_10191742 | 153 |
| 338 | 3300025298 | Ga0209050_1028612 | Ga0209050_10286121 | 153 |
| 339 | 3300025302 | Ga0207426_1004545 | Ga0207426_10045452 | 153 |
| 340 | 3300025303 | Ga0209051_1000309 | Ga0209051_100030921 | 153 |
| 341 | 3300025304 | Ga0209257_1001776 | Ga0209257_100177622 | 153 |
| 342 | 3300025304 | Ga0209257_1001845 | Ga0209257_100184523 | 153 |
| 343 | 3300025315 | Ga0207697_10006203 | Ga0207697_100062036 | 153 |
| 344 | 3300025315 | Ga0207697_10196420 | Ga0207697_101964202 | 153 |
| 345 | 3300025899 | Ga0207642_10665090 | Ga0207642_106650901 | 153 |
| 346 | 3300025901 | Ga0207688_10354957 | Ga0207688_103549571 | 153 |
| 347 | 3300025906 | Ga0207699_10795613 | Ga0207699_107956131 | 153 |
| 348 | 3300025907 | Ga0207645_10674606 | Ga0207645_106746061 | 153 |
| 349 | 3300025909 | Ga0207705_10148369 | Ga0207705_101483693 | 153 |
| 350 | 3300025909 | Ga0207705_11241965 | Ga0207705_112419651 | 153 |
| 351 | 3300025910 | Ga0207684_10070898 | Ga0207684_100708984 | 153 |
| 352 | 3300025911 | Ga0207654_10379413 | Ga0207654_103794132 | 153 |
| 353 | 3300025922 | Ga0207646_10063693 | Ga0207646_100636934 | 153 |
| 354 | 3300025922 | Ga0207646_10723120 | Ga0207646_107231202 | 153 |
| 355 | 3300025924 | Ga0207694_10027041 | Ga0207694_100270415 | 153 |
| 356 | 3300025924 | Ga0207694_10978735 | Ga0207694_109787351 | 153 |
| 357 | 3300025924 | Ga0207694_10997254 | Ga0207694_109972541 | 153 |
| 358 | 3300025927 | Ga0207687_10007708 | Ga0207687_100077087 | 153 |
| 359 | 3300025928 | Ga0207700_10011551 | Ga0207700_100115514 | 153 |
| 360 | 3300025933 | Ga0207706_10494164 | Ga0207706_104941642 | 153 |
| 361 | 3300025934 | Ga0207686_10074291 | Ga0207686_100742911 | 153 |
| 362 | 3300025935 | Ga0207709_10032521 | Ga0207709_100325212 | 153 |
| 363 | 3300025936 | Ga0207670_11283511 | Ga0207670_112835111 | 153 |
| 364 | 3300025941 | Ga0207711_10016955 | Ga0207711_100169556 | 153 |
| 365 | 3300025942 | Ga0207689_10608502 | Ga0207689_106085021 | 153 |
| 366 | 3300025942 | Ga0207689_10626306 | Ga0207689_106263062 | 153 |
| 367 | 3300025960 | Ga0207651_11073230 | Ga0207651_110732302 | 153 |
| 368 | 3300025961 | Ga0207712_10121812 | Ga0207712_101218122 | 153 |
| 369 | 3300025972 | Ga0207668_10401620 | Ga0207668_104016202 | 153 |
| 370 | 3300025981 | Ga0207640_10372913 | Ga0207640_103729131 | 153 |
| 371 | 3300026023 | Ga0207677_10198724 | Ga0207677_101987242 | 153 |
| 372 | 3300026023 | Ga0207677_10722005 | Ga0207677_107220052 | 153 |
| 373 | 3300026035 | Ga0207703_10000159 | Ga0207703_1000015945 | 153 |
| 374 | 3300026035 | Ga0207703_10000711 | Ga0207703_1000071120 | 153 |
| 375 | 3300026041 | Ga0207639_10162434 | Ga0207639_101624343 | 153 |
| 376 | 3300026041 | Ga0207639_10341494 | Ga0207639_103414942 | 153 |
| 377 | 3300026089 | Ga0207648_10786346 | Ga0207648_107863462 | 153 |
| 378 | 3300026095 | Ga0207676_10000351 | Ga0207676_1000035123 | 153 |
| 379 | 3300026116 | Ga0207674_10114190 | Ga0207674_101141904 | 153 |
| 380 | 3300026116 | Ga0207674_10207098 | Ga0207674_102070982 | 153 |
| 381 | 3300026118 | Ga0207675_100591962 | Ga0207675_1005919622 | 153 |
| 382 | 3300026118 | Ga0207675_100592087 | Ga0207675_1005920871 | 153 |
| 383 | 3300028379 | Ga0268266_10017160 | Ga0268266_100171602 | 153 |
| 384 | 3300028379 | Ga0268266_10071904 | Ga0268266_100719042 | 153 |
| 385 | 3300028380 | Ga0268265_11154308 | Ga0268265_111543081 | 153 |
| 386 | 3300028381 | Ga0268264_10170162 | Ga0268264_101701622 | 153 |
| 387 | 3300028573 | Ga0265334_10012253 | Ga0265334_100122533 | 153 |
| 388 | 3300028786 | Ga0307517_10001703 | Ga0307517_1000170338 | 153 |
| 389 | 3300028786 | Ga0307517_10134622 | Ga0307517_101346224 | 153 |
| 390 | 3300031238 | Ga0265332_10079895 | Ga0265332_100798952 | 153 |
| 391 | 3300031238 | Ga0265332_10167282 | Ga0265332_101672822 | 153 |
| 392 | 3300031239 | Ga0265328_10161627 | Ga0265328_101616271 | 153 |
| 393 | 3300031241 | Ga0265325_10108638 | Ga0265325_101086382 | 153 |
| 394 | 3300031247 | Ga0265340_10041331 | Ga0265340_100413312 | 153 |
| 395 | 3300031456 | Ga0307513_10246587 | Ga0307513_102465873 | 153 |
| 396 | 3300031507 | Ga0307509_10052180 | Ga0307509_100521806 | 153 |
| 397 | 3300031616 | Ga0307508_10000302 | Ga0307508_1000030239 | 153 |
| 398 | 3300031712 | Ga0265342_10423890 | Ga0265342_104238902 | 153 |
| 399 | 3300031824 | Ga0307413_10097534 | Ga0307413_100975342 | 153 |
| 400 | 3300031911 | Ga0307412_10115047 | Ga0307412_101150472 | 153 |
| 401 | 3300031911 | Ga0307412_10207994 | Ga0307412_102079942 | 153 |
| 402 | 3300031995 | Ga0307409_102106211 | Ga0307409_1021062111 | 153 |
| 403 | 3300033180 | Ga0307510_10000081 | Ga0307510_100000815 | 153 |
| 404 | 3300034818 | Ga0373950_0084004 | Ga0373950_0084004_152_616 | 153 |
| 405 | 3300035088 | Ga0373940_0192896 | Ga0373940_0192896_38_502 | 153 |
| 406 | 3300035111 | Ga0373923_0455992 | Ga0373923_0455992_127_594 | 153 |
| 407 | 3300035112 | Ga0373932_0022161 | Ga0373932_0022161_869_1333 | 153 |
| 408 | 3300035113 | Ga0373936_0181255 | Ga0373936_0181255_331_795 | 153 |
| 409 | 3300035114 | Ga0373939_0225886 | Ga0373939_0225886_92_556 | 153 |
| 410 | 3300035691 | Ga0373931_0092049 | Ga0373931_0092049_180_647 | 153 |
| 411 | 3300035691 | Ga0373931_0385519 | Ga0373931_0385519_252_716 | 153 |
| 412 | 3300035692 | Ga0373935_0746383 | Ga0373935_0746383_60_524 | 153 |
| 413 | 3300035724 | Ga0373933_0341735 | Ga0373933_0341735_284_748 | 153 |
| 414 | 3300037068 | Ga0373925_0751119 | Ga0373925_0751119_74_538 | 153 |
| 415 | 3300037312 | Ga0395899_0281355 | Ga0395899_0281355_544_1008 | 153 |
| 416 | 3300037418 | Ga0395900_0038468 | Ga0395900_0038468_1439_1903 | 153 |
| 417 | 3300037466 | Ga0395898_0005008 | Ga0395898_0005008_10918_11382 | 153 |
| 418 | 3300037853 | Ga0436364_1142638 | Ga0436364_1142638_164_628 | 153 |
| 419 | 3300038443 | Ga0395901_0017050 | Ga0395901_0017050_4892_5356 | 153 |
| 420 | 3300038443 | Ga0395901_0066564 | Ga0395901_0066564_512_976 | 153 |
| 421 | 3300038443 | Ga0395901_0631718 | Ga0395901_0631718_224_691 | 153 |
| 422 | 3300039437 | Ga0436365_0029237 | Ga0436365_0029237_473_937 | 153 |
| 423 | 3300039437 | Ga0436365_0060372 | Ga0436365_0060372_1641_2102 | 153 |
| 424 | 3300039437 | Ga0436365_1221776 | Ga0436365_1221776_43_504 | 153 |
| 425 | 3300039438 | Ga0436360_0691683 | Ga0436360_0691683_336_806 | 153 |
| 426 | 3300039438 | Ga0436360_0903033 | Ga0436360_0903033_307_771 | 153 |
| 427 | 3300039447 | Ga0436361_0251203 | Ga0436361_0251203_3232_3696 | 153 |
| 428 | 3300041459 | Ga0451800_1056121 | Ga0451800_1056121_10_477 | 153 |
| 429 | 3300042011 | Ga0439454_045497 | Ga0439454_045497_229_693 | 153 |
| 430 | 3300042137 | Ga0450902_061338 | Ga0450902_061338_99_563 | 153 |
| 431 | 3300042157 | Ga0439458_0022277 | Ga0439458_0022277_347_811 | 153 |
| 432 | 3300044694 | Ga0466963_0091650 | Ga0466963_0091650_1075_1542 | 153 |
| 433 | 3300044706 | Ga0466964_0083842 | Ga0466964_0083842_590_1057 | 153 |
| 434 | 3300045051 | Ga0451576_0000770 | Ga0451576_0000770_23913_24386 | 153 |
| 435 | 3300045976 | Ga0466967_0032894 | Ga0466967_0032894_2491_2958 | 153 |
| 436 | 3300046460 | Ga0495638_0000048 | Ga0495638_0000048_80821_81282 | 153 |
| 437 | 3300046460 | Ga0495638_0360479 | Ga0495638_0360479_181_651 | 153 |
| 438 | 3300046506 | Ga0495583_0022082 | Ga0495583_0022082_2163_2633 | 153 |
| 439 | 3300046519 | Ga0495632_0265548 | Ga0495632_0265548_282_746 | 153 |
| 440 | 3300046524 | Ga0495648_0102895 | Ga0495648_0102895_687_1148 | 153 |
| 441 | 3300046529 | Ga0495652_0391127 | Ga0495652_0391127_471_932 | 153 |
| 442 | 3300046542 | Ga0495597_0147750 | Ga0495597_0147750_359_823 | 153 |
| 443 | 3300046616 | Ga0495668_0118883 | Ga0495668_0118883_612_1082 | 153 |
| 444 | 3300046660 | Ga0495625_0000031 | Ga0495625_0000031_235205_235666 | 153 |
| 445 | 3300046660 | Ga0495625_0224450 | Ga0495625_0224450_133_603 | 153 |
| 446 | 3300046691 | Ga0495670_0157498 | Ga0495670_0157498_539_1000 | 153 |
| 447 | 3300048917 | Ga0496114_1463371 | Ga0496114_1463371_31_495 | 153 |
| 448 | 3300048918 | Ga0496115_0002045 | Ga0496115_0002045_13339_13803 | 153 |
| 449 | 3300048920 | Ga0496117_0558117 | Ga0496117_0558117_47_508 | 153 |
| 450 | 3300048924 | Ga0496121_0000123 | Ga0496121_0000123_160513_160989 | 153 |
| 451 | 3300048924 | Ga0496121_0478933 | Ga0496121_0478933_103_564 | 153 |
| 452 | 3300048926 | Ga0496123_0228533 | Ga0496123_0228533_197_658 | 153 |
| 453 | 3300049515 | Ga0501292_109237 | Ga0501292_109237_18_482 | 153 |
| 454 | 3300049569 | Ga0501032_0438965 | Ga0501032_0438965_355_822 | 153 |
| 455 | 3300049570 | Ga0501033_0452007 | Ga0501033_0452007_65_529 | 153 |
| 456 | 3300049571 | Ga0501034_0132716 | Ga0501034_0132716_684_1151 | 153 |
| 457 | 3300049571 | Ga0501034_0322550 | Ga0501034_0322550_615_1082 | 153 |
| 458 | 3300049578 | Ga0501042_0278549 | Ga0501042_0278549_335_799 | 153 |
| 459 | 3300049578 | Ga0501042_0925303 | Ga0501042_0925303_24_488 | 153 |
| 460 | 3300049579 | Ga0501043_0082420 | Ga0501043_0082420_191_655 | 153 |
| 461 | 3300049580 | Ga0501046_0926205 | Ga0501046_0926205_103_567 | 153 |
| 462 | 3300049581 | Ga0501047_0082116 | Ga0501047_0082116_79_543 | 153 |
| 463 | 3300049582 | Ga0501048_0943195 | Ga0501048_0943195_120_584 | 153 |
| 464 | 3300049586 | Ga0501070_1265764 | Ga0501070_1265764_19_483 | 153 |
| 465 | 3300049742 | Ga0501080_1621927 | Ga0501080_1621927_59_523 | 153 |
| 466 | 3300049823 | Ga0501044_0373772 | Ga0501044_0373772_223_687 | 153 |
| 467 | 3300049823 | Ga0501044_1437406 | Ga0501044_1437406_59_520 | 153 |
| 468 | 3300050489 | nmdc:mga03683_15265_c1 | nmdc:mga03683_15265_c1_177_641 | 153 |
| 469 | 3300050489 | nmdc:mga03683_28819_c1 | nmdc:mga03683_28819_c1_108_572 | 153 |
| 470 | 3300050489 | nmdc:mga03683_42029_c1 | nmdc:mga03683_42029_c1_1382_1849 | 153 |
| 471 | 3300050490 | nmdc:mga03n38_228227_c1 | nmdc:mga03n38_228227_c1_251_715 | 153 |
| 472 | 3300050491 | nmdc:mga00v17_207561_c1 | nmdc:mga00v17_207561_c1_539_1003 | 153 |
| 473 | 3300050492 | nmdc:mga0yw44_176765_c1 | nmdc:mga0yw44_176765_c1_424_891 | 153 |
| 474 | 3300050492 | nmdc:mga0yw44_350874_c1 | nmdc:mga0yw44_350874_c1_158_625 | 153 |
| 475 | 3300050492 | nmdc:mga0yw44_647851_c1 | nmdc:mga0yw44_647851_c1_11_475 | 153 |
| 476 | 3300050494 | nmdc:mga06z11_125914_c1 | nmdc:mga06z11_125914_c1_716_1183 | 153 |
| 477 | 3300050494 | nmdc:mga06z11_71934_c1 | nmdc:mga06z11_71934_c1_56_520 | 153 |
| 478 | 3300050508 | nmdc:mga09592_1221778_c1 | nmdc:mga09592_1221778_c1_110_574 | 153 |
| 479 | 3300050516 | nmdc:mga0sz30_54774_c1 | nmdc:mga0sz30_54774_c1_643_1107 | 153 |
| 480 | 3300053087 | Ga0500643_000850 | Ga0500643_000850_18405_18875 | 153 |
| 481 | 3300053088 | Ga0500644_0439248 | Ga0500644_0439248_11_475 | 153 |
| 482 | 3300053092 | Ga0500583_0553297 | Ga0500583_0553297_56_523 | 153 |
| 483 | 3300053094 | Ga0500566_0367408 | Ga0500566_0367408_27_494 | 153 |
| 484 | 3300053096 | Ga0500641_0002425 | Ga0500641_0002425_118_585 | 153 |
| 485 | 3300053096 | Ga0500641_0038567 | Ga0500641_0038567_1015_1476 | 153 |
| 486 | 3300053130 | Ga0500642_0027140 | Ga0500642_0027140_58_522 | 153 |
| 487 | 3300053134 | Ga0500658_0006334 | Ga0500658_0006334_1036_1497 | 153 |
| 488 | 3300053136 | Ga0500559_0040520 | Ga0500559_0040520_725_1186 | 153 |
| 489 | 3300053136 | Ga0500559_0147291 | Ga0500559_0147291_143_616 | 153 |
| 490 | 3300053136 | Ga0500559_0221578 | Ga0500559_0221578_178_639 | 153 |
| 491 | 3300053139 | Ga0500568_0058068 | Ga0500568_0058068_774_1235 | 153 |
| 492 | 3300053139 | Ga0500568_0115510 | Ga0500568_0115510_138_602 | 153 |
| 493 | 3300053153 | Ga0500616_0002245 | Ga0500616_0002245_14976_15443 | 153 |
| 494 | 3300060353 | Ga0501082_0870826 | Ga0501082_0870826_77_544 | 153 |
| 495 | 3300001904 | JGI24736J21556_1046316 | JGI24736J21556_10463161 | 154 |
| 496 | 3300001904 | JGI24736J21556_1063067 | JGI24736J21556_10630671 | 154 |
| 497 | 3300001915 | JGI24741J21665_1002675 | JGI24741J21665_10026756 | 154 |
| 498 | 3300001979 | JGI24740J21852_10003789 | JGI24740J21852_100037891 | 154 |
| 499 | 3300001989 | JGI24739J22299_10042349 | JGI24739J22299_100423492 | 154 |
| 500 | 3300001990 | JGI24737J22298_10015131 | JGI24737J22298_100151313 | 154 |
| 501 | 3300002067 | JGI24735J21928_10140226 | JGI24735J21928_101402262 | 154 |
| 502 | 3300002075 | JGI24738J21930_10041033 | JGI24738J21930_100410332 | 154 |
| 503 | 3300002077 | JGI24744J21845_10071195 | JGI24744J21845_100711951 | 154 |
| 504 | 3300003215 | JGI25153J46596_10001772 | JGI25153J46596_100017729 | 154 |
| 505 | 3300003322 | rootL2_10072004 | rootL2_100720043 | 154 |
| 506 | 3300003759 | Ga0055525_1000119 | Ga0055525_100011924 | 154 |
| 507 | 3300003762 | Ga0055542_1000142 | Ga0055542_100014224 | 154 |
| 508 | 3300003763 | Ga0055529_1000167 | Ga0055529_100016724 | 154 |
| 509 | 3300005327 | Ga0070658_10000762 | Ga0070658_1000076218 | 154 |
| 510 | 3300005328 | Ga0070676_10074490 | Ga0070676_100744904 | 154 |
| 511 | 3300005333 | Ga0070677_10104838 | Ga0070677_101048381 | 154 |
| 512 | 3300005339 | Ga0070660_100270280 | Ga0070660_1002702803 | 154 |
| 513 | 3300005344 | Ga0070661_100002228 | Ga0070661_10000222812 | 154 |
| 514 | 3300005344 | Ga0070661_100178534 | Ga0070661_1001785341 | 154 |
| 515 | 3300005347 | Ga0070668_100070577 | Ga0070668_1000705774 | 154 |
| 516 | 3300005354 | Ga0070675_100059315 | Ga0070675_1000593153 | 154 |
| 517 | 3300005355 | Ga0070671_100302136 | Ga0070671_1003021361 | 154 |
| 518 | 3300005356 | Ga0070674_100001273 | Ga0070674_10000127311 | 154 |
| 519 | 3300005356 | Ga0070674_100013503 | Ga0070674_1000135036 | 154 |
| 520 | 3300005364 | Ga0070673_100473932 | Ga0070673_1004739322 | 154 |
| 521 | 3300005366 | Ga0070659_100260867 | Ga0070659_1002608672 | 154 |
| 522 | 3300005366 | Ga0070659_100296458 | Ga0070659_1002964582 | 154 |
| 523 | 3300005367 | Ga0070667_100020682 | Ga0070667_1000206824 | 154 |
| 524 | 3300005455 | Ga0070663_100025213 | Ga0070663_1000252134 | 154 |
| 525 | 3300005456 | Ga0070678_100000825 | Ga0070678_10000082511 | 154 |
| 526 | 3300005456 | Ga0070678_100283939 | Ga0070678_1002839392 | 154 |
| 527 | 3300005457 | Ga0070662_100021805 | Ga0070662_1000218054 | 154 |
| 528 | 3300005539 | Ga0068853_100471648 | Ga0068853_1004716483 | 154 |
| 529 | 3300005543 | Ga0070672_100145663 | Ga0070672_1001456634 | 154 |
| 530 | 3300005548 | Ga0070665_100127251 | Ga0070665_1001272513 | 154 |
| 531 | 3300005563 | Ga0068855_100183648 | Ga0068855_1001836484 | 154 |
| 532 | 3300005564 | Ga0070664_100125786 | Ga0070664_1001257864 | 154 |
| 533 | 3300005577 | Ga0068857_102129002 | Ga0068857_1021290021 | 154 |
| 534 | 3300005577 | Ga0068857_102190824 | Ga0068857_1021908241 | 154 |
| 535 | 3300005834 | Ga0068851_10001870 | Ga0068851_1000187011 | 154 |
| 536 | 3300006237 | Ga0097621_100237342 | Ga0097621_1002373422 | 154 |
| 537 | 3300006358 | Ga0068871_100043958 | Ga0068871_1000439584 | 154 |
| 538 | 3300009148 | Ga0105243_10000788 | Ga0105243_1000078833 | 154 |
| 539 | 3300009176 | Ga0105242_10048387 | Ga0105242_100483873 | 154 |
| 540 | 3300009177 | Ga0105248_12838216 | Ga0105248_128382161 | 154 |
| 541 | 3300009545 | Ga0105237_10071672 | Ga0105237_100716723 | 154 |
| 542 | 3300009551 | Ga0105238_10236127 | Ga0105238_102361271 | 154 |
| 543 | 3300010375 | Ga0105239_12585170 | Ga0105239_125851701 | 154 |
| 544 | 3300013100 | Ga0157373_10046534 | Ga0157373_100465344 | 154 |
| 545 | 3300013102 | Ga0157371_10000723 | Ga0157371_1000072324 | 154 |
| 546 | 3300013104 | Ga0157370_10371719 | Ga0157370_103717191 | 154 |
| 547 | 3300013308 | Ga0157375_10945763 | Ga0157375_109457631 | 154 |
| 548 | 3300014969 | Ga0157376_10780256 | Ga0157376_107802562 | 154 |
| 549 | 3300017792 | Ga0163161_10279041 | Ga0163161_102790411 | 154 |
| 550 | 3300020070 | Ga0206356_11374598 | Ga0206356_113745981 | 154 |
| 551 | 3300025226 | Ga0209674_108561 | Ga0209674_1085612 | 154 |
| 552 | 3300025230 | Ga0209563_100024 | Ga0209563_100024454 | 154 |
| 553 | 3300025253 | Ga0209677_106631 | Ga0209677_1066314 | 154 |
| 554 | 3300025254 | Ga0209148_1000008 | Ga0209148_1000008412 | 154 |
| 555 | 3300025272 | Ga0209455_1000002 | Ga0209455_10000021010 | 154 |
| 556 | 3300025297 | Ga0209758_1000007 | Ga0209758_10000071004 | 154 |
| 557 | 3300025321 | Ga0207656_10006071 | Ga0207656_100060711 | 154 |
| 558 | 3300025893 | Ga0207682_10205093 | Ga0207682_102050933 | 154 |
| 559 | 3300025901 | Ga0207688_10170310 | Ga0207688_101703103 | 154 |
| 560 | 3300025904 | Ga0207647_10018473 | Ga0207647_100184738 | 154 |
| 561 | 3300025904 | Ga0207647_10080138 | Ga0207647_100801383 | 154 |
| 562 | 3300025907 | Ga0207645_10094421 | Ga0207645_100944214 | 154 |
| 563 | 3300025909 | Ga0207705_10000913 | Ga0207705_1000091312 | 154 |
| 564 | 3300025911 | Ga0207654_10000892 | Ga0207654_100008923 | 154 |
| 565 | 3300025913 | Ga0207695_10011004 | Ga0207695_100110044 | 154 |
| 566 | 3300025914 | Ga0207671_10005082 | Ga0207671_100050824 | 154 |
| 567 | 3300025919 | Ga0207657_10001738 | Ga0207657_1000173824 | 154 |
| 568 | 3300025920 | Ga0207649_10000549 | Ga0207649_1000054923 | 154 |
| 569 | 3300025920 | Ga0207649_10036622 | Ga0207649_100366224 | 154 |
| 570 | 3300025924 | Ga0207694_10064476 | Ga0207694_100644763 | 154 |
| 571 | 3300025926 | Ga0207659_10122486 | Ga0207659_101224863 | 154 |
| 572 | 3300025932 | Ga0207690_10000599 | Ga0207690_1000059923 | 154 |
| 573 | 3300025932 | Ga0207690_10112060 | Ga0207690_101120603 | 154 |
| 574 | 3300025932 | Ga0207690_10979497 | Ga0207690_109794971 | 154 |
| 575 | 3300025933 | Ga0207706_10047501 | Ga0207706_100475013 | 154 |
| 576 | 3300025935 | Ga0207709_10000005 | Ga0207709_10000005675 | 154 |
| 577 | 3300025937 | Ga0207669_10000511 | Ga0207669_100005118 | 154 |
| 578 | 3300025937 | Ga0207669_10017719 | Ga0207669_100177194 | 154 |
| 579 | 3300025940 | Ga0207691_10134025 | Ga0207691_101340252 | 154 |
| 580 | 3300025945 | Ga0207679_10065964 | Ga0207679_100659644 | 154 |
| 581 | 3300025949 | Ga0207667_10002847 | Ga0207667_1000284725 | 154 |
| 582 | 3300025949 | Ga0207667_10264954 | Ga0207667_102649543 | 154 |
| 583 | 3300025960 | Ga0207651_10600101 | Ga0207651_106001012 | 154 |
| 584 | 3300025972 | Ga0207668_10301731 | Ga0207668_103017312 | 154 |
| 585 | 3300025981 | Ga0207640_10011920 | Ga0207640_100119207 | 154 |
| 586 | 3300025986 | Ga0207658_10073398 | Ga0207658_100733982 | 154 |
| 587 | 3300026041 | Ga0207639_10252575 | Ga0207639_102525751 | 154 |
| 588 | 3300026089 | Ga0207648_10103522 | Ga0207648_101035223 | 154 |
| 589 | 3300026116 | Ga0207674_10061897 | Ga0207674_100618971 | 154 |
| 590 | 3300026116 | Ga0207674_10819969 | Ga0207674_108199693 | 154 |
| 591 | 3300026118 | Ga0207675_100627698 | Ga0207675_1006276983 | 154 |
| 592 | 3300026121 | Ga0207683_10001955 | Ga0207683_1000195511 | 154 |
| 593 | 3300026121 | Ga0207683_10110814 | Ga0207683_101108144 | 154 |
| 594 | 3300026142 | Ga0207698_10052426 | Ga0207698_100524261 | 154 |
| 595 | 3300026142 | Ga0207698_10187092 | Ga0207698_101870921 | 154 |
| 596 | 3300028786 | Ga0307517_10009194 | Ga0307517_1000919413 | 154 |
| 597 | 3300031456 | Ga0307513_10062169 | Ga0307513_100621695 | 154 |
| 598 | 3300033180 | Ga0307510_10053187 | Ga0307510_100531874 | 154 |
| 599 | 3300037312 | Ga0395899_0102933 | Ga0395899_0102933_1104_1568 | 154 |
| 600 | 3300038443 | Ga0395901_0303108 | Ga0395901_0303108_563_1027 | 154 |
| 601 | 3300046452 | Ga0495617_042129 | Ga0495617_042129_841_1305 | 154 |
| 602 | 3300046459 | Ga0495629_0051588 | Ga0495629_0051588_1579_2043 | 154 |
| 603 | 3300046460 | Ga0495638_0147585 | Ga0495638_0147585_802_1266 | 154 |
| 604 | 3300046471 | Ga0495650_0001045 | Ga0495650_0001045_2191_2655 | 154 |
| 605 | 3300046492 | Ga0495585_0072321 | Ga0495585_0072321_85_549 | 154 |
| 606 | 3300046492 | Ga0495585_0339949 | Ga0495585_0339949_218_682 | 154 |
| 607 | 3300046500 | Ga0495596_0025486 | Ga0495596_0025486_86_550 | 154 |
| 608 | 3300046501 | Ga0495607_0320309 | Ga0495607_0320309_239_703 | 154 |
| 609 | 3300046506 | Ga0495583_0005970 | Ga0495583_0005970_2404_2868 | 154 |
| 610 | 3300046506 | Ga0495583_0007771 | Ga0495583_0007771_5936_6400 | 154 |
| 611 | 3300046506 | Ga0495583_0204017 | Ga0495583_0204017_46_510 | 154 |
| 612 | 3300046507 | Ga0495606_0001395 | Ga0495606_0001395_12686_13150 | 154 |
| 613 | 3300046507 | Ga0495606_0122793 | Ga0495606_0122793_326_790 | 154 |
| 614 | 3300046518 | Ga0495631_0133994 | Ga0495631_0133994_566_1030 | 154 |
| 615 | 3300046522 | Ga0495643_0001127 | Ga0495643_0001127_2028_2492 | 154 |
| 616 | 3300046522 | Ga0495643_0011061 | Ga0495643_0011061_2937_3401 | 154 |
| 617 | 3300046522 | Ga0495643_0043761 | Ga0495643_0043761_1674_2138 | 154 |
| 618 | 3300046522 | Ga0495643_0052045 | Ga0495643_0052045_122_586 | 154 |
| 619 | 3300046524 | Ga0495648_0001672 | Ga0495648_0001672_14197_14661 | 154 |
| 620 | 3300046525 | Ga0495663_0000928 | Ga0495663_0000928_178_642 | 154 |
| 621 | 3300046528 | Ga0495642_0028796 | Ga0495642_0028796_1718_2182 | 154 |
| 622 | 3300046536 | Ga0495587_0097008 | Ga0495587_0097008_898_1362 | 154 |
| 623 | 3300046538 | Ga0495609_0159391 | Ga0495609_0159391_361_825 | 154 |
| 624 | 3300046557 | Ga0495622_0001350 | Ga0495622_0001350_8170_8634 | 154 |
| 625 | 3300046558 | Ga0495633_0006697 | Ga0495633_0006697_4525_4989 | 154 |
| 626 | 3300046558 | Ga0495633_0037394 | Ga0495633_0037394_14_478 | 154 |
| 627 | 3300046616 | Ga0495668_0000059 | Ga0495668_0000059_58748_59212 | 154 |
| 628 | 3300046648 | Ga0495611_0014418 | Ga0495611_0014418_1889_2353 | 154 |
| 629 | 3300046648 | Ga0495611_0036980 | Ga0495611_0036980_218_682 | 154 |
| 630 | 3300046660 | Ga0495625_0000571 | Ga0495625_0000571_47701_48165 | 154 |
| 631 | 3300046660 | Ga0495625_0009235 | Ga0495625_0009235_344_808 | 154 |
| 632 | 3300046660 | Ga0495625_0017069 | Ga0495625_0017069_2133_2597 | 154 |
| 633 | 3300046660 | Ga0495625_0362036 | Ga0495625_0362036_397_861 | 154 |
| 634 | 3300046665 | Ga0495661_0201061 | Ga0495661_0201061_48_512 | 154 |
| 635 | 3300046684 | Ga0495669_0000058 | Ga0495669_0000058_73269_73733 | 154 |
| 636 | 3300046689 | Ga0495613_0100358 | Ga0495613_0100358_961_1425 | 154 |
| 637 | 3300046691 | Ga0495670_0176621 | Ga0495670_0176621_317_781 | 154 |
| 638 | 3300046694 | Ga0495649_0020517 | Ga0495649_0020517_1051_1515 | 154 |
| 639 | 3300046809 | Ga0495600_0001229 | Ga0495600_0001229_11593_12057 | 154 |
| 640 | 3300047323 | Ga0495683_0002532 | Ga0495683_0002532_10278_10742 | 154 |
| 641 | 3300047323 | Ga0495683_0030288 | Ga0495683_0030288_1761_2225 | 154 |
| 642 | 3300047443 | Ga0495687_000083 | Ga0495687_000083_64673_65137 | 154 |
| 643 | 3300047443 | Ga0495687_000152 | Ga0495687_000152_3000_3464 | 154 |
| 644 | 3300047445 | Ga0495677_0021314 | Ga0495677_0021314_1672_2136 | 154 |
| 645 | 3300047445 | Ga0495677_0045158 | Ga0495677_0045158_253_717 | 154 |
| 646 | 3300047469 | Ga0495673_0166121 | Ga0495673_0166121_109_573 | 154 |
| 647 | 3300047470 | Ga0495681_0008587 | Ga0495681_0008587_3962_4426 | 154 |
| 648 | 3300047470 | Ga0495681_0109876 | Ga0495681_0109876_39_503 | 154 |
| 649 | 3300047472 | Ga0495686_0000209 | Ga0495686_0000209_77945_78421 | 154 |
| 650 | 3300048904 | Ga0496101_0162955 | Ga0496101_0162955_1235_1699 | 154 |
| 651 | 3300048905 | Ga0496102_0006473 | Ga0496102_0006473_2076_2540 | 154 |
| 652 | 3300048906 | Ga0496103_0000099 | Ga0496103_0000099_91370_91834 | 154 |
| 653 | 3300048907 | Ga0496104_0184966 | Ga0496104_0184966_1235_1699 | 154 |
| 654 | 3300048908 | Ga0496105_0000502 | Ga0496105_0000502_2108_2572 | 154 |
| 655 | 3300048912 | Ga0496109_0579009 | Ga0496109_0579009_424_888 | 154 |
| 656 | 3300048914 | Ga0496111_0036294 | Ga0496111_0036294_1153_1617 | 154 |
| 657 | 3300048917 | Ga0496114_0011239 | Ga0496114_0011239_4828_5292 | 154 |
| 658 | 3300048918 | Ga0496115_0000066 | Ga0496115_0000066_2168_2632 | 154 |
| 659 | 3300048919 | Ga0496116_0039634 | Ga0496116_0039634_852_1316 | 154 |
| 660 | 3300048920 | Ga0496117_0000744 | Ga0496117_0000744_48972_49436 | 154 |
| 661 | 3300048921 | Ga0496118_0000852 | Ga0496118_0000852_2052_2516 | 154 |
| 662 | 3300048922 | Ga0496119_0029867 | Ga0496119_0029867_3168_3632 | 154 |
| 663 | 3300048923 | Ga0496120_0051158 | Ga0496120_0051158_1868_2332 | 154 |
| 664 | 3300048924 | Ga0496121_0000417 | Ga0496121_0000417_1975_2439 | 154 |
| 665 | 3300048925 | Ga0496122_0009816 | Ga0496122_0009816_1878_2342 | 154 |
| 666 | 3300048926 | Ga0496123_0011327 | Ga0496123_0011327_5376_5840 | 154 |
| 667 | 3300048927 | Ga0496124_0000291 | Ga0496124_0000291_1966_2430 | 154 |
| 668 | 3300048928 | Ga0496125_0000687 | Ga0496125_0000687_53887_54351 | 154 |
| 669 | 3300048929 | Ga0496126_0001921 | Ga0496126_0001921_2123_2587 | 154 |
| 670 | 3300049460 | Ga0495682_0039516 | Ga0495682_0039516_1153_1617 | 154 |
| 671 | 3300053079 | Ga0500610_0000029 | Ga0500610_0000029_47685_48149 | 154 |
| 672 | 3300053087 | Ga0500643_142645 | Ga0500643_142645_24_488 | 154 |
| 673 | 3300053091 | Ga0500647_0033566 | Ga0500647_0033566_961_1425 | 154 |
| 674 | 3300053092 | Ga0500583_0019875 | Ga0500583_0019875_333_797 | 154 |
| 675 | 3300053119 | Ga0500595_009699 | Ga0500595_009699_2279_2743 | 154 |
| 676 | 3300053130 | Ga0500642_0002483 | Ga0500642_0002483_382_846 | 154 |
| 677 | 3300053154 | Ga0500619_006273 | Ga0500619_006273_2145_2609 | 154 |
| 678 | 3300053177 | Ga0500636_0020266 | Ga0500636_0020266_1186_1650 | 154 |
| 679 | 3300053730 | Ga0500645_000019 | Ga0500645_000019_80046_80510 | 154 |
| 680 | 3300053735 | Ga0500596_009933 | Ga0500596_009933_219_683 | 154 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1v59-assembly1.cif.gz_A | crystal structure of yeast lipoamide dehydrogenase complexed with nad+ | 0.8575 | 11 | 41 |
| 2xls-assembly1.cif.gz_A | joint-functions of protein residues and nadp(h) in oxygen-activation by flavin-containing monooxygenase: asn78lys mutant | 0.8538 | 11 | 41 |
| 2xlp-assembly2.cif.gz_B | joint-functions of protein residues and nadp(h) in oxygen-activation by flavin-containing monooxygenase: asn78ser mutant | 0.8498 | 11 | 41 |
| 2vq7-assembly2.cif.gz_C | bacterial flavin-containing monooxygenase in complex with nadp: native data | 0.8465 | 11 | 41 |
| 3er0-assembly1.cif.gz_A | crystal structure of the full length eif5a from saccharomyces cerevisiae | 0.8132 | 11 | 43 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0A8D0_49_137_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9708 | 50 | 136 | 1.10.10.10 |
| af_Q2FXP3_49_137_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9656 | 49 | 137 | 1.10.10.10 |
| af_Q2FXP3_49_137_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9552 | 49 | 137 | 1.10.10.10 |
| af_P0A8D0_49_137_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9391 | 50 | 136 | 1.10.10.10 |
| af_P9WQM1_268_326_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9282 | 11 | 44 | 2.40.50.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-U5NAA6-F1-model_v4 | Transcriptional repressor NrdR | 0.981 | 51 | 147 |
GO:0003677
GO:0005524 GO:0008270 GO:0045892 |
| AF-A0A1G8CD96-F1-model_v4 | Transcriptional repressor NrdR | 0.9735 | 49 | 149 |
GO:0003677
GO:0005524 GO:0008270 GO:0045892 |
| AF-K1ZQN8-F1-model_v4 | Transcriptional repressor NrdR | 0.9671 | 52 | 147 |
GO:0003677
GO:0005524 GO:0008270 GO:0045892 |
| AF-A0A135PDK6-F1-model_v4 | deleted | 0.9662 | 48 | 149 |
|
| AF-A0A3M1DEJ3-F1-model_v4 | Transcriptional repressor NrdR | 0.9623 | 45 | 149 |
GO:0005524
GO:0008270 GO:0045892 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar