F474815

General Info

Members Datasets Scaffolds Average Seq Length
680 393 669 153

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2909399089|2909402512
Length 178
Sequence FCGHEDTQVKDSRPHEDGTAIRRRRICASCSQRFTTIERVQLRDLYVVKADGRRVPFERDKLARSIRVALRKRPVDEDRIDRIVNGLVRQLEASGETDIASRDIGKLVMDTLREVDIVAYIRFASVHWDFRETKDFAAILESIPVGPGEERPAAIRVPAADSGAAVASGYGPDGIKRR

Samples

Sample ID Description Type Environment
1 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
2 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
3 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
4 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
5 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
6 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
7 2909399089 Nguyenibacter vanlangensis LMG 31431 Isolate Unclassified
8 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
9 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
10 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
11 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
12 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
13 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
14 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
15 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
16 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
17 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
18 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
19 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
20 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
21 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
22 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
23 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
24 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
25 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
26 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
27 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
28 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
29 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
30 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
31 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
32 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
33 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
34 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
35 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
36 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
37 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
38 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
39 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
40 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
41 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
42 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
43 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
44 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
45 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
46 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
47 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
48 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
49 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
50 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
51 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
52 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
53 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
54 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
55 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
56 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
57 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
58 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
59 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
60 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
61 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
62 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
63 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
64 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
65 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
66 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
67 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
68 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
69 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
70 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
71 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
72 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
73 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
74 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
75 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
76 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
77 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
78 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
79 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
80 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
81 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
82 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
83 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
84 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
85 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
86 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
87 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
88 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
89 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
90 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
92 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
96 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
97 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
106 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
107 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
108 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
109 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
110 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
111 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
112 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
113 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
114 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
115 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
119 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
120 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
124 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
125 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
126 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
127 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
131 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
132 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
135 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
136 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
137 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
139 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
141 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
142 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
143 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
145 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
206 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
207 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
208 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
209 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
210 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
211 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
212 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
213 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
214 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
215 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
216 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
217 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
218 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
219 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
220 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
221 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
222 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
223 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
224 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
225 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
226 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
227 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
228 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
229 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
230 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
231 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
232 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
233 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
234 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
235 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
236 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
237 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
238 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
239 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
240 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
241 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
242 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
243 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
244 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
245 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
246 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
247 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
248 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
249 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
250 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
251 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
252 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
253 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
254 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
255 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
256 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
257 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
258 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
259 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
260 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
261 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
262 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
263 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
264 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
265 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
266 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
267 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
268 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
269 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
270 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
271 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
272 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
273 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
274 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
275 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
276 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
277 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
278 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
279 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
280 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
281 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
282 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
283 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
284 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
285 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
286 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
287 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
288 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
289 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
290 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
291 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
292 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
293 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
294 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
295 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
296 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
297 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
298 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
299 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
300 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
301 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
302 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
303 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
304 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
305 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
306 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
307 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
308 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
309 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
310 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
311 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
312 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
313 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
314 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
315 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
316 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
317 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
318 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
319 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
320 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
321 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
322 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
323 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
324 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
325 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
326 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
327 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
328 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
329 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
330 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
331 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
332 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
333 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
334 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
335 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
336 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
337 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
338 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
339 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
340 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
341 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
342 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
343 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
344 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
345 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
346 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
347 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
348 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
349 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
350 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
351 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
352 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
353 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
354 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
355 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
356 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
357 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
358 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
359 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
360 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
361 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
362 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
363 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
364 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
365 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
366 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
367 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
368 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
369 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
370 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
371 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
372 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
373 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
374 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
375 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
376 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
377 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
378 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
379 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
380 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
381 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
382 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
383 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
384 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
385 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
386 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
387 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
388 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
389 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
390 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
391 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
392 641228493 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
393 643348555 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.94
Metatranscriptomes 0.59
Isolates 1.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.35
Nodule 0
Rhizoplane 2.06
Rhizosphere 76.18
Stem 0
Stem Tuber 0
Unclassified 9.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1046316 3300001904 Bacteria 669
2 JGI24736J21556_1063067 3300001904 Bacteria 574
3 JGI24741J21665_1002675 3300001915 Bacteria 4540
4 JGI24740J21852_10003789 3300001979 Bacteria 6583
5 JGI24739J22299_10042349 3300001989 Bacteria 1510
6 JGI24737J22298_10015131 3300001990 Bacteria 2498
7 JGI24735J21928_10140226 3300002067 Bacteria 697
8 JGI24738J21930_10041033 3300002075 Bacteria 940
9 JGI24744J21845_10071195 3300002077 Bacteria 635
10 JGI24751J29686_10072127 3300002459 Bacteria 713
11 JGI25152J39213_1028504 3300002773 Bacteria 887
12 JGI25150J39212_1000177 3300002774 Bacteria 35741
13 JGI25151J46595_10100177 3300003187 Bacteria 782
14 JGI25406J46586_10177799 3300003203 Bacteria 620
15 JGI25153J46596_10000064 3300003215 Bacteria 125642
16 JGI25153J46596_10001772 3300003215 Bacteria 12814
17 rootH1_10165260 3300003316 Bacteria 1017
18 rootL2_10072004 3300003322 Bacteria 1048
19 rootH1_10305472 3300003323 Bacteria 1998
20 Ga0055525_1000119 3300003759 Bacteria 120272
21 Ga0055542_1000142 3300003762 Bacteria 89813
22 Ga0055529_1000167 3300003763 Bacteria 90966
23 Ga0055537_1002015 3300003773 Bacteria 7220
24 Ga0055536_1027551 3300003781 Bacteria 1567
25 Ga0055540_1000762 3300003792 Bacteria 21885
26 Ga0070658_10000762 3300005327 Bacteria 27659
27 Ga0070658_10179180 3300005327 Bacteria 1783
28 Ga0070658_11357621 3300005327 Bacteria 617
29 Ga0070676_10074490 3300005328 Bacteria 2045
30 Ga0070683_100766819 3300005329 Bacteria 924
31 Ga0070670_100042394 3300005331 Bacteria 3912
32 Ga0070677_10104838 3300005333 Bacteria 1253
33 Ga0068869_101530177 3300005334 Bacteria 593
34 Ga0070666_10620249 3300005335 Bacteria 790
35 Ga0070660_100270280 3300005339 Bacteria 1389
36 Ga0070661_100002228 3300005344 Bacteria 13301
37 Ga0070661_100178534 3300005344 Bacteria 1615
38 Ga0070668_100070577 3300005347 Bacteria 2720
39 Ga0070668_100627169 3300005347 Bacteria 943
40 Ga0070675_100059315 3300005354 Bacteria 3157
41 Ga0070675_100325133 3300005354 Bacteria 1359
42 Ga0070671_100302136 3300005355 Bacteria 1363
43 Ga0070674_100001273 3300005356 Bacteria 13274
44 Ga0070674_100013503 3300005356 Bacteria 5052
45 Ga0070674_100791959 3300005356 Bacteria 818
46 Ga0070673_100473932 3300005364 Bacteria 1129
47 Ga0070659_100260867 3300005366 Bacteria 1438
48 Ga0070659_100296458 3300005366 Bacteria 1347
49 Ga0070667_100020682 3300005367 Bacteria 5464
50 Ga0070667_100021285 3300005367 Bacteria 5387
51 Ga0070709_10110109 3300005434 Bacteria 1850
52 Ga0070714_100000478 3300005435 Bacteria 28985
53 Ga0070714_100674890 3300005435 Bacteria 996
54 Ga0070714_100832976 3300005435 Bacteria 894
55 Ga0070713_100132319 3300005436 Bacteria 2201
56 Ga0070713_100170820 3300005436 Bacteria 1948
57 Ga0070713_100521309 3300005436 Bacteria 1123
58 Ga0070713_101195611 3300005436 Bacteria 736
59 Ga0070710_10086418 3300005437 Bacteria 1842
60 Ga0070710_10258928 3300005437 Bacteria 1121
61 Ga0070711_100300663 3300005439 Bacteria 1276
62 Ga0070711_100372260 3300005439 Bacteria 1153
63 Ga0070708_100003894 3300005445 Bacteria 11714
64 Ga0070663_100025213 3300005455 Bacteria 4013
65 Ga0070678_100000825 3300005456 Bacteria 15714
66 Ga0070678_100283939 3300005456 Bacteria 1401
67 Ga0070678_101328854 3300005456 Bacteria 670
68 Ga0070662_100021805 3300005457 Bacteria 4378
69 Ga0070681_10138885 3300005458 Bacteria 2360
70 Ga0070681_11202614 3300005458 Bacteria 680
71 Ga0070685_10435061 3300005466 Bacteria 916
72 Ga0070706_100070961 3300005467 Bacteria 3221
73 Ga0070707_100107642 3300005468 Bacteria 2704
74 Ga0070698_100002550 3300005471 Bacteria 20068
75 Ga0070699_100104442 3300005518 Bacteria 2485
76 Ga0070679_100117813 3300005530 Bacteria 2640
77 Ga0070679_100252856 3300005530 Bacteria 1718
78 Ga0068853_100382407 3300005539 Bacteria 1315
79 Ga0068853_100471648 3300005539 Bacteria 1182
80 Ga0068853_101333544 3300005539 Bacteria 694
81 Ga0070672_100145663 3300005543 Bacteria 1957
82 Ga0070696_101673121 3300005546 Bacteria 548
83 Ga0070665_100127251 3300005548 Bacteria 2550
84 Ga0070665_100144679 3300005548 Bacteria 2381
85 Ga0070665_100207851 3300005548 Bacteria 1958
86 Ga0070665_100869105 3300005548 Bacteria 915
87 Ga0068855_100183648 3300005563 Bacteria 2364
88 Ga0068855_101242216 3300005563 Bacteria 773
89 Ga0068855_101351070 3300005563 Bacteria 736
90 Ga0070664_100125786 3300005564 Bacteria 2249
91 Ga0068857_100280377 3300005577 Bacteria 1533
92 Ga0068857_100396414 3300005577 Bacteria 1284
93 Ga0068857_101004796 3300005577 Bacteria 803
94 Ga0068857_102129002 3300005577 Bacteria 550
95 Ga0068857_102190824 3300005577 Bacteria 542
96 Ga0068854_100319177 3300005578 Bacteria 1262
97 Ga0068854_100744305 3300005578 Bacteria 850
98 Ga0068856_100562267 3300005614 Bacteria 1162
99 Ga0070702_100910951 3300005615 Bacteria 689
100 Ga0068859_100000085 3300005617 Bacteria 85748
101 Ga0068859_101494467 3300005617 Bacteria 745
102 Ga0068866_10761395 3300005718 Bacteria 670
103 Ga0068851_10001870 3300005834 Bacteria 9248
104 Ga0068851_10133527 3300005834 Bacteria 1344
105 Ga0068858_100000122 3300005842 Bacteria 80502
106 Ga0068858_100000166 3300005842 Bacteria 70016
107 Ga0068858_100184765 3300005842 Bacteria 1969
108 Ga0068860_100049220 3300005843 Bacteria 4015
109 Ga0081455_10000933 3300005937 Bacteria 37402
110 Ga0081455_10002813 3300005937 Bacteria 20492
111 Ga0081455_10035376 3300005937 Bacteria 4465
112 Ga0081538_10111882 3300005981 Bacteria 1338
113 Ga0081540_1132378 3300005983 Bacteria 1016
114 Ga0081539_10012874 3300005985 Bacteria 6374
115 Ga0081539_10016575 3300005985 Bacteria 5246
116 Ga0081539_10333994 3300005985 Bacteria 641
117 Ga0070717_10108594 3300006028 Bacteria 2364
118 Ga0070717_10306885 3300006028 Bacteria 1411
119 Ga0075365_10072925 3300006038 Bacteria 2313
120 Ga0075365_10356948 3300006038 Bacteria 1030
121 Ga0075365_10514117 3300006038 Bacteria 846
122 Ga0070712_100091509 3300006175 Bacteria 2229
123 Ga0075362_10021792 3300006177 Bacteria 2694
124 Ga0075362_10027924 3300006177 Bacteria 2419
125 Ga0075367_10083752 3300006178 Bacteria 1932
126 Ga0075369_10079337 3300006186 Bacteria 1454
127 Ga0075369_10529269 3300006186 Bacteria 561
128 Ga0075366_10026426 3300006195 Bacteria 3400
129 Ga0097621_100237342 3300006237 Bacteria 1593
130 Ga0068871_100043958 3300006358 Bacteria 3591
131 Ga0068871_101595291 3300006358 Bacteria 618
132 Ga0097620_100000085 3300006931 Bacteria 85748
133 Ga0097620_101494475 3300006931 Bacteria 745
134 Ga0099794_10617623 3300007265 Bacteria 574
135 Ga0105240_10036237 3300009093 Bacteria 6347
136 Ga0105245_10000623 3300009098 Bacteria 32150
137 Ga0105247_10003709 3300009101 Bacteria 9917
138 Ga0105247_10567932 3300009101 Bacteria 836
139 Ga0114129_11042589 3300009147 Bacteria 1027
140 Ga0105243_10000788 3300009148 Bacteria 30391
141 Ga0105243_10007245 3300009148 Bacteria 8525
142 Ga0105243_10058660 3300009148 Bacteria 3068
143 Ga0105242_10048387 3300009176 Bacteria 3456
144 Ga0105242_11574450 3300009176 Bacteria 690
145 Ga0105242_11756561 3300009176 Bacteria 658
146 Ga0105248_10019502 3300009177 Bacteria 7506
147 Ga0105248_10028391 3300009177 Bacteria 6234
148 Ga0105248_10031813 3300009177 Bacteria 5896
149 Ga0105248_11172460 3300009177 Bacteria 868
150 Ga0105248_12838216 3300009177 Bacteria 552
151 Ga0105237_10008752 3300009545 Bacteria 10923
152 Ga0105237_10071672 3300009545 Bacteria 3459
153 Ga0105237_11634267 3300009545 Bacteria 651
154 Ga0105238_10236127 3300009551 Bacteria 1805
155 Ga0105249_10001806 3300009553 Bacteria 18608
156 Ga0105249_10039113 3300009553 Bacteria 4306
157 Ga0105239_10000060 3300010375 Bacteria 155195
158 Ga0105239_10712179 3300010375 Bacteria 1148
159 Ga0105239_11110537 3300010375 Bacteria 910
160 Ga0105239_12585170 3300010375 Bacteria 592
161 Ga0105246_10188788 3300011119 Bacteria 1593
162 Ga0157373_10046534 3300013100 Bacteria 3096
163 Ga0157371_10000723 3300013102 Bacteria 38704
164 Ga0157370_10131531 3300013104 Bacteria 2334
165 Ga0157370_10371719 3300013104 Bacteria 1317
166 Ga0157369_10208094 3300013105 Bacteria 2051
167 Ga0157369_10479292 3300013105 Bacteria 1288
168 Ga0157369_12053384 3300013105 Bacteria 580
169 Ga0157374_10200350 3300013296 Bacteria 1955
170 Ga0157374_12943906 3300013296 Bacteria 503
171 Ga0157378_10018568 3300013297 Bacteria 6112
172 Ga0163162_10017302 3300013306 Bacteria 7054
173 Ga0163162_10128733 3300013306 Bacteria 2639
174 Ga0163162_10228292 3300013306 Bacteria 1992
175 Ga0163162_10305166 3300013306 Bacteria 1724
176 Ga0163162_10512062 3300013306 Bacteria 1330
177 Ga0163162_11400432 3300013306 Bacteria 795
178 Ga0157375_10413475 3300013308 Bacteria 1515
179 Ga0157375_10945763 3300013308 Bacteria 1004
180 Ga0163163_10370444 3300014325 Bacteria 1489
181 Ga0163163_11084778 3300014325 Bacteria 864
182 Ga0182008_10025204 3300014497 Bacteria 3022
183 Ga0182008_10265204 3300014497 Bacteria 889
184 Ga0157379_10743872 3300014968 Bacteria 923
185 Ga0157376_10236103 3300014969 Bacteria 1701
186 Ga0157376_10780256 3300014969 Bacteria 967
187 Ga0183363_1010 3300015690 Bacteria 108191
188 Ga0163161_10279041 3300017792 Bacteria 1310
189 Ga0163161_10984966 3300017792 Bacteria 719
190 Ga0197907_10784425 3300020069 Bacteria 524
191 Ga0206356_11374598 3300020070 Bacteria 694
192 Ga0206354_11056629 3300020081 Bacteria 743
193 Ga0213872_10027728 3300021361 Bacteria 2599
194 Ga0213874_10054300 3300021377 Bacteria 1238
195 Ga0213874_10182690 3300021377 Bacteria 747
196 Ga0213876_10064836 3300021384 Bacteria 1928
197 Ga0213875_10010530 3300021388 Bacteria 4625
198 Ga0224712_10370181 3300022467 Unclassified 679
199 Ga0209674_108561 3300025226 Bacteria 1203
200 Ga0209563_100024 3300025230 Bacteria 601155
201 Ga0209437_104206 3300025233 Bacteria 2550
202 Ga0207425_1000019 3300025245 Bacteria 399942
203 Ga0209677_106631 3300025253 Bacteria 2687
204 Ga0209148_1000008 3300025254 Bacteria 1504371
205 Ga0209129_1001013 3300025258 Bacteria 16723
206 Ga0209233_1000107 3300025261 Bacteria 267399
207 Ga0209565_1000166 3300025263 Bacteria 85898
208 Ga0209455_1000002 3300025272 Bacteria 1505459
209 Ga0209673_1014928 3300025273 Bacteria 2980
210 Ga0209676_1009397 3300025292 Bacteria 4222
211 Ga0209676_1021032 3300025292 Bacteria 2200
212 Ga0209025_1000304 3300025294 Bacteria 109508
213 Ga0209564_1001084 3300025295 Bacteria 32523
214 Ga0209758_1000007 3300025297 Bacteria 1270410
215 Ga0209758_1000019 3300025297 Bacteria 743682
216 Ga0209050_1000001 3300025298 Bacteria 3563507
217 Ga0209050_1019174 3300025298 Bacteria 2614
218 Ga0209050_1028612 3300025298 Bacteria 1804
219 Ga0207426_1004545 3300025302 Bacteria 6711
220 Ga0209051_1000309 3300025303 Bacteria 76449
221 Ga0209257_1001776 3300025304 Bacteria 23847
222 Ga0209257_1001845 3300025304 Bacteria 23059
223 Ga0207697_10006203 3300025315 Bacteria 5439
224 Ga0207697_10196420 3300025315 Bacteria 887
225 Ga0207656_10006071 3300025321 Bacteria 4323
226 Ga0207682_10205093 3300025893 Bacteria 908
227 Ga0207692_10076414 3300025898 Bacteria 1779
228 Ga0207642_10665090 3300025899 Bacteria 654
229 Ga0207710_10004115 3300025900 Bacteria 6389
230 Ga0207710_10286067 3300025900 Bacteria 830
231 Ga0207688_10170310 3300025901 Bacteria 1294
232 Ga0207688_10354957 3300025901 Bacteria 904
233 Ga0207680_10870489 3300025903 Bacteria 646
234 Ga0207647_10018473 3300025904 Bacteria 4712
235 Ga0207647_10080138 3300025904 Bacteria 1959
236 Ga0207699_10060841 3300025906 Bacteria 2270
237 Ga0207699_10461018 3300025906 Bacteria 913
238 Ga0207699_10795613 3300025906 Bacteria 695
239 Ga0207645_10094421 3300025907 Bacteria 1925
240 Ga0207645_10674606 3300025907 Bacteria 702
241 Ga0207705_10000913 3300025909 Bacteria 24188
242 Ga0207705_10148369 3300025909 Bacteria 1756
243 Ga0207705_11241965 3300025909 Bacteria 570
244 Ga0207684_10070898 3300025910 Bacteria 2961
245 Ga0207654_10000892 3300025911 Bacteria 16547
246 Ga0207654_10379413 3300025911 Bacteria 979
247 Ga0207654_11046368 3300025911 Bacteria 594
248 Ga0207707_10576723 3300025912 Bacteria 954
249 Ga0207695_10011004 3300025913 Bacteria 10992
250 Ga0207695_10044491 3300025913 Bacteria 4721
251 Ga0207695_10052176 3300025913 Bacteria 4287
252 Ga0207671_10002033 3300025914 Bacteria 22218
253 Ga0207671_10005082 3300025914 Bacteria 12285
254 Ga0207693_10218841 3300025915 Bacteria 1496
255 Ga0207663_10019835 3300025916 Bacteria 3796
256 Ga0207663_10766946 3300025916 Bacteria 767
257 Ga0207657_10001738 3300025919 Bacteria 23468
258 Ga0207649_10000549 3300025920 Bacteria 25943
259 Ga0207649_10036622 3300025920 Bacteria 2957
260 Ga0207652_10051658 3300025921 Bacteria 3525
261 Ga0207646_10063693 3300025922 Bacteria 3291
262 Ga0207646_10723120 3300025922 Bacteria 889
263 Ga0207694_10027041 3300025924 Bacteria 4368
264 Ga0207694_10064476 3300025924 Bacteria 2855
265 Ga0207694_10978735 3300025924 Bacteria 716
266 Ga0207694_10997254 3300025924 Bacteria 709
267 Ga0207650_10036667 3300025925 Bacteria 3568
268 Ga0207659_10122486 3300025926 Bacteria 1995
269 Ga0207659_10525561 3300025926 Bacteria 1004
270 Ga0207687_10007708 3300025927 Bacteria 7066
271 Ga0207700_10011551 3300025928 Bacteria 5638
272 Ga0207700_10039287 3300025928 Bacteria 3444
273 Ga0207700_10242609 3300025928 Bacteria 1536
274 Ga0207664_10001839 3300025929 Bacteria 13993
275 Ga0207664_10120460 3300025929 Bacteria 2195
276 Ga0207690_10000599 3300025932 Bacteria 23383
277 Ga0207690_10112060 3300025932 Bacteria 1967
278 Ga0207690_10979497 3300025932 Bacteria 703
279 Ga0207706_10047501 3300025933 Bacteria 3797
280 Ga0207706_10494164 3300025933 Bacteria 1056
281 Ga0207686_10074291 3300025934 Bacteria 2196
282 Ga0207709_10000005 3300025935 Bacteria 806813
283 Ga0207709_10032521 3300025935 Bacteria 3055
284 Ga0207670_11283511 3300025936 Bacteria 621
285 Ga0207669_10000511 3300025937 Bacteria 16940
286 Ga0207669_10017719 3300025937 Bacteria 3661
287 Ga0207669_10434778 3300025937 Bacteria 1036
288 Ga0207691_10134025 3300025940 Bacteria 2186
289 Ga0207711_10016955 3300025941 Bacteria 6050
290 Ga0207711_10156055 3300025941 Bacteria 2063
291 Ga0207689_10608502 3300025942 Bacteria 919
292 Ga0207689_10626306 3300025942 Bacteria 906
293 Ga0207679_10065964 3300025945 Bacteria 2711
294 Ga0207667_10002847 3300025949 Bacteria 21475
295 Ga0207667_10264954 3300025949 Bacteria 1757
296 Ga0207667_11130126 3300025949 Bacteria 766
297 Ga0207651_10600101 3300025960 Bacteria 962
298 Ga0207651_11073230 3300025960 Bacteria 721
299 Ga0207712_10007444 3300025961 Bacteria 6913
300 Ga0207712_10121812 3300025961 Bacteria 1974
301 Ga0207668_10301731 3300025972 Bacteria 1322
302 Ga0207668_10401620 3300025972 Bacteria 1159
303 Ga0207640_10011920 3300025981 Bacteria 4937
304 Ga0207640_10372913 3300025981 Bacteria 1154
305 Ga0207640_10621884 3300025981 Bacteria 917
306 Ga0207658_10016459 3300025986 Bacteria 5085
307 Ga0207658_10073398 3300025986 Bacteria 2597
308 Ga0207658_10711923 3300025986 Bacteria 908
309 Ga0207677_10198724 3300026023 Bacteria 1592
310 Ga0207677_10722005 3300026023 Bacteria 886
311 Ga0207703_10000159 3300026035 Bacteria 78106
312 Ga0207703_10000711 3300026035 Bacteria 32868
313 Ga0207703_10180831 3300026035 Bacteria 1861
314 Ga0207639_10162434 3300026041 Bacteria 1884
315 Ga0207639_10252575 3300026041 Bacteria 1538
316 Ga0207639_10341494 3300026041 Bacteria 1335
317 Ga0207702_10708402 3300026078 Bacteria 992
318 Ga0207648_10103522 3300026089 Bacteria 2496
319 Ga0207648_10786346 3300026089 Bacteria 885
320 Ga0207676_10000351 3300026095 Bacteria 39386
321 Ga0207674_10061897 3300026116 Bacteria 3781
322 Ga0207674_10114190 3300026116 Bacteria 2673
323 Ga0207674_10207098 3300026116 Bacteria 1910
324 Ga0207674_10740985 3300026116 Bacteria 948
325 Ga0207674_10819969 3300026116 Bacteria 898
326 Ga0207675_100591962 3300026118 Bacteria 1111
327 Ga0207675_100592087 3300026118 Bacteria 1111
328 Ga0207675_100627698 3300026118 Bacteria 1079
329 Ga0207683_10001955 3300026121 Bacteria 18242
330 Ga0207683_10110814 3300026121 Bacteria 2457
331 Ga0207698_10052426 3300026142 Bacteria 3125
332 Ga0207698_10187092 3300026142 Bacteria 1840
333 Ga0268266_10017160 3300028379 Bacteria 6181
334 Ga0268266_10054911 3300028379 Bacteria 3424
335 Ga0268266_10064475 3300028379 Bacteria 3165
336 Ga0268266_10071904 3300028379 Bacteria 2998
337 Ga0268266_10377750 3300028379 Bacteria 1336
338 Ga0268265_11154308 3300028380 Bacteria 771
339 Ga0268264_10170162 3300028381 Bacteria 1969
340 Ga0265334_10012253 3300028573 Bacteria 3603
341 Ga0307517_10001703 3300028786 Bacteria 36321
342 Ga0307517_10009194 3300028786 Bacteria 14057
343 Ga0307517_10134622 3300028786 Bacteria 1763
344 Ga0265332_10079895 3300031238 Bacteria 1388
345 Ga0265332_10167282 3300031238 Bacteria 918
346 Ga0265328_10161627 3300031239 Bacteria 845
347 Ga0265325_10108638 3300031241 Bacteria 1351
348 Ga0265340_10041331 3300031247 Bacteria 2267
349 Ga0307513_10062169 3300031456 Bacteria 3948
350 Ga0307513_10246587 3300031456 Bacteria 1586
351 Ga0307509_10052180 3300031507 Bacteria 4367
352 Ga0307508_10000302 3300031616 Bacteria 60090
353 Ga0265342_10423890 3300031712 Bacteria 685
354 Ga0307413_10097534 3300031824 Bacteria 1933
355 Ga0307412_10115047 3300031911 Bacteria 1927
356 Ga0307412_10207994 3300031911 Bacteria 1491
357 Ga0307409_102106211 3300031995 Bacteria 594
358 Ga0307510_10000081 3300033180 Bacteria 72540
359 Ga0307510_10053187 3300033180 Bacteria 4260
360 Ga0373950_0084004 3300034818 Bacteria 669
361 Ga0373926_0114580 3300035083 Bacteria 1014
362 Ga0373934_0098706 3300035086 Bacteria 1180
363 Ga0373940_0192896 3300035088 Bacteria 667
364 Ga0373923_0177992 3300035111 Bacteria 976
365 Ga0373923_0311234 3300035111 Bacteria 747
366 Ga0373923_0455992 3300035111 Bacteria 620
367 Ga0373932_0022161 3300035112 Bacteria 1685
368 Ga0373936_0024693 3300035113 Bacteria 2348
369 Ga0373936_0045831 3300035113 Bacteria 1762
370 Ga0373936_0073083 3300035113 Bacteria 1417
371 Ga0373936_0181255 3300035113 Bacteria 924
372 Ga0373939_0225886 3300035114 Bacteria 719
373 Ga0373945_0147482 3300035116 Bacteria 952
374 Ga0373953_0015069 3300035117 Bacteria 2793
375 Ga0373954_0060128 3300035118 Bacteria 1792
376 Ga0373954_0077163 3300035118 Bacteria 1589
377 Ga0373956_0044412 3300035119 Bacteria 1981
378 Ga0373956_0409602 3300035119 Bacteria 647
379 Ga0373957_0045097 3300035120 Bacteria 1670
380 Ga0373957_0200554 3300035120 Bacteria 831
381 Ga0373946_0059113 3300035171 Bacteria 1626
382 Ga0373946_0106241 3300035171 Bacteria 1265
383 Ga0373946_0388545 3300035171 Bacteria 703
384 Ga0373955_0038544 3300035172 Bacteria 2547
385 Ga0373955_0047885 3300035172 Bacteria 2316
386 Ga0373955_0102133 3300035172 Bacteria 1647
387 Ga0373931_0092049 3300035691 Bacteria 1691
388 Ga0373931_0385519 3300035691 Bacteria 884
389 Ga0373935_0038660 3300035692 Bacteria 2988
390 Ga0373935_0116150 3300035692 Bacteria 1782
391 Ga0373935_0211191 3300035692 Bacteria 1345
392 Ga0373935_0746383 3300035692 Bacteria 721
393 Ga0373927_0041227 3300035695 Bacteria 2994
394 Ga0373927_0149954 3300035695 Bacteria 1527
395 Ga0373933_0066700 3300035724 Bacteria 2181
396 Ga0373933_0341735 3300035724 Bacteria 972
397 Ga0373947_0025308 3300035725 Bacteria 3461
398 Ga0373947_0179640 3300035725 Bacteria 1377
399 Ga0373937_0000734 3300036401 Bacteria 28357
400 Ga0373937_0021679 3300036401 Bacteria 5767
401 Ga0373937_0322569 3300036401 Bacteria 1461
402 Ga0373937_0579457 3300036401 Bacteria 1065
403 Ga0373937_1700300 3300036401 Bacteria 578
404 Ga0316584_0087156 3300036712 Bacteria 2337
405 Ga0373925_0005630 3300037068 Bacteria 9319
406 Ga0373925_0255139 3300037068 Bacteria 1407
407 Ga0373925_0711561 3300037068 Bacteria 828
408 Ga0373925_0751119 3300037068 Bacteria 804
409 Ga0395899_0055370 3300037312 Bacteria 2933
410 Ga0395899_0102933 3300037312 Bacteria 2060
411 Ga0395899_0281355 3300037312 Bacteria 1131
412 Ga0395900_0021292 3300037418 Bacteria 6628
413 Ga0395900_0038468 3300037418 Bacteria 4931
414 Ga0395900_0920444 3300037418 Bacteria 797
415 Ga0395898_0005008 3300037466 Bacteria 14377
416 Ga0395898_0389718 3300037466 Bacteria 1328
417 Ga0436364_0071585 3300037853 Bacteria 1709
418 Ga0436364_0135989 3300037853 Bacteria 3342
419 Ga0436364_0429284 3300037853 Bacteria 656
420 Ga0436364_0748963 3300037853 Bacteria 1854
421 Ga0436364_0878606 3300037853 Bacteria 3666
422 Ga0436364_1142638 3300037853 Bacteria 780
423 Ga0436364_1347066 3300037853 Bacteria 1741
424 Ga0436364_1488888 3300037853 Bacteria 4757
425 Ga0395901_0012568 3300038443 Bacteria 8591
426 Ga0395901_0017050 3300038443 Bacteria 7403
427 Ga0395901_0066564 3300038443 Bacteria 3752
428 Ga0395901_0303108 3300038443 Bacteria 1656
429 Ga0395901_0631718 3300038443 Bacteria 1076
430 Ga0436365_0029237 3300039437 Bacteria 1142
431 Ga0436365_0060372 3300039437 Bacteria 3113
432 Ga0436365_0171907 3300039437 Bacteria 1281
433 Ga0436365_0772100 3300039437 Bacteria 786
434 Ga0436365_1221776 3300039437 Bacteria 573
435 Ga0436360_0691683 3300039438 Bacteria 2607
436 Ga0436360_0903033 3300039438 Bacteria 1378
437 Ga0436360_1011171 3300039438 Bacteria 3089
438 Ga0436361_0251203 3300039447 Bacteria 6352
439 Ga0436363_0420453 3300039450 Bacteria 883
440 Ga0436363_0631560 3300039450 Bacteria 2559
441 Ga0436363_1046130 3300039450 Bacteria 2538
442 Ga0436363_1048080 3300039450 Bacteria 553
443 Ga0436363_1618324 3300039450 Bacteria 1032
444 Ga0436363_1706959 3300039450 Bacteria 751
445 Ga0436362_1137136 3300039453 Bacteria 680
446 Ga0436362_1232813 3300039453 Bacteria 1314
447 Ga0451800_1056121 3300041459 Bacteria 550
448 Ga0439454_045497 3300042011 Bacteria 729
449 Ga0450902_061338 3300042137 Bacteria 651
450 Ga0439458_0022277 3300042157 Bacteria 1471
451 Ga0466963_0091650 3300044694 Bacteria 2070
452 Ga0466963_0310092 3300044694 Bacteria 1110
453 Ga0466964_0083842 3300044706 Bacteria 1373
454 Ga0453684_0212646 3300044712 Bacteria 2247
455 Ga0451576_0000770 3300045051 Bacteria 63137
456 Ga0466958_0843359 3300045836 Bacteria 598
457 Ga0466967_0032894 3300045976 Bacteria 4384
458 Ga0466967_1162654 3300045976 Bacteria 769
459 Ga0495617_042129 3300046452 Bacteria 1526
460 Ga0495592_0012195 3300046454 Bacteria 6523
461 Ga0495603_0829359 3300046455 Bacteria 527
462 Ga0495629_0051588 3300046459 Bacteria 2879
463 Ga0495629_0357267 3300046459 Bacteria 996
464 Ga0495629_0693028 3300046459 Bacteria 677
465 Ga0495638_0000048 3300046460 Bacteria 209787
466 Ga0495638_0147585 3300046460 Bacteria 1367
467 Ga0495638_0360479 3300046460 Bacteria 765
468 Ga0495651_0112340 3300046462 Bacteria 2013
469 Ga0495653_0233527 3300046463 Bacteria 1230
470 Ga0495650_0001045 3300046471 Bacteria 30841
471 Ga0495580_0897668 3300046472 Bacteria 570
472 Ga0495664_0001900 3300046477 Bacteria 11113
473 Ga0495585_0072321 3300046492 Bacteria 1879
474 Ga0495585_0339949 3300046492 Bacteria 731
475 Ga0495594_0200986 3300046499 Bacteria 1136
476 Ga0495596_0025486 3300046500 Bacteria 2390
477 Ga0495607_0320309 3300046501 Bacteria 724
478 Ga0495583_0005970 3300046506 Bacteria 8079
479 Ga0495583_0007771 3300046506 Bacteria 6667
480 Ga0495583_0022082 3300046506 Bacteria 3257
481 Ga0495583_0204017 3300046506 Bacteria 802
482 Ga0495606_0001395 3300046507 Bacteria 32635
483 Ga0495606_0122793 3300046507 Bacteria 1552
484 Ga0495608_0007407 3300046511 Bacteria 7751
485 Ga0495608_0032915 3300046511 Bacteria 3505
486 Ga0495608_0193013 3300046511 Bacteria 1285
487 Ga0495628_0056372 3300046516 Bacteria 3093
488 Ga0495630_0243788 3300046517 Bacteria 1373
489 Ga0495630_0633773 3300046517 Bacteria 819
490 Ga0495631_0133994 3300046518 Bacteria 1064
491 Ga0495632_0265548 3300046519 Bacteria 767
492 Ga0495637_0043585 3300046520 Bacteria 1914
493 Ga0495643_0001127 3300046522 Bacteria 26381
494 Ga0495643_0011061 3300046522 Bacteria 5516
495 Ga0495643_0043761 3300046522 Bacteria 2435
496 Ga0495643_0052045 3300046522 Bacteria 2200
497 Ga0495648_0001672 3300046524 Bacteria 21514
498 Ga0495648_0102895 3300046524 Bacteria 1572
499 Ga0495663_0000928 3300046525 Bacteria 9799
500 Ga0495642_0028796 3300046528 Bacteria 2214
501 Ga0495652_0156645 3300046529 Bacteria 1773
502 Ga0495652_0391127 3300046529 Bacteria 987
503 Ga0495665_0188602 3300046531 Bacteria 1070
504 Ga0495640_0025113 3300046533 Bacteria 4328
505 Ga0495640_0221511 3300046533 Bacteria 1193
506 Ga0495587_0014199 3300046536 Bacteria 4998
507 Ga0495587_0097008 3300046536 Bacteria 1700
508 Ga0495587_0461402 3300046536 Bacteria 703
509 Ga0495609_0159391 3300046538 Bacteria 957
510 Ga0495597_0147750 3300046542 Bacteria 966
511 Ga0495597_0280788 3300046542 Bacteria 649
512 Ga0495645_0002599 3300046543 Bacteria 12274
513 Ga0495645_0187470 3300046543 Bacteria 1412
514 Ga0495622_0001350 3300046557 Bacteria 12541
515 Ga0495633_0006697 3300046558 Bacteria 6783
516 Ga0495633_0037394 3300046558 Bacteria 2322
517 Ga0495667_0003743 3300046559 Bacteria 10229
518 Ga0495667_0046991 3300046559 Bacteria 2853
519 Ga0495667_0055286 3300046559 Bacteria 2611
520 Ga0495668_0000059 3300046616 Bacteria 194951
521 Ga0495668_0118883 3300046616 Bacteria 1445
522 Ga0495634_0334472 3300046642 Bacteria 910
523 Ga0495611_0014418 3300046648 Bacteria 3375
524 Ga0495611_0036980 3300046648 Bacteria 2168
525 Ga0495625_0000031 3300046660 Bacteria 238193
526 Ga0495625_0000571 3300046660 Bacteria 53797
527 Ga0495625_0009235 3300046660 Bacteria 8277
528 Ga0495625_0017069 3300046660 Bacteria 5689
529 Ga0495625_0224450 3300046660 Bacteria 1229
530 Ga0495625_0362036 3300046660 Bacteria 914
531 Ga0495661_0201061 3300046665 Bacteria 1043
532 Ga0495657_0261248 3300046675 Bacteria 1040
533 Ga0495657_0329966 3300046675 Bacteria 905
534 Ga0495599_0013458 3300046678 Bacteria 5055
535 Ga0495599_0186360 3300046678 Bacteria 1277
536 Ga0495623_0137357 3300046679 Bacteria 1457
537 Ga0495647_0244812 3300046681 Bacteria 797
538 Ga0495669_0000058 3300046684 Bacteria 76033
539 Ga0495613_0100358 3300046689 Bacteria 2091
540 Ga0495670_0157498 3300046691 Bacteria 1192
541 Ga0495670_0176621 3300046691 Bacteria 1126
542 Ga0495671_0004554 3300046692 Bacteria 8260
543 Ga0495649_0020517 3300046694 Bacteria 3707
544 Ga0495600_0001229 3300046809 Bacteria 14050
545 Ga0495600_0039523 3300046809 Bacteria 3072
546 Ga0495600_0116837 3300046809 Bacteria 1736
547 Ga0495604_0170157 3300047317 Bacteria 1533
548 Ga0495674_0099385 3300047319 Bacteria 2477
549 Ga0495674_0146504 3300047319 Bacteria 1982
550 Ga0495683_0002532 3300047323 Bacteria 10973
551 Ga0495683_0030288 3300047323 Bacteria 2761
552 Ga0495687_000083 3300047443 Bacteria 145688
553 Ga0495687_000152 3300047443 Bacteria 105602
554 Ga0495675_0024698 3300047444 Bacteria 3832
555 Ga0495675_0162816 3300047444 Bacteria 1373
556 Ga0495677_0021314 3300047445 Bacteria 2348
557 Ga0495677_0045158 3300047445 Bacteria 1616
558 Ga0495673_0166121 3300047469 Bacteria 844
559 Ga0495681_0008587 3300047470 Bacteria 6384
560 Ga0495681_0109876 3300047470 Bacteria 1195
561 Ga0495684_0069256 3300047471 Bacteria 2683
562 Ga0495684_0090018 3300047471 Bacteria 2325
563 Ga0495686_0000209 3300047472 Bacteria 108972
564 Ga0495602_0001050 3300048088 Bacteria 26998
565 Ga0496101_0162955 3300048904 Bacteria 1711
566 Ga0496101_1113465 3300048904 Bacteria 620
567 Ga0496102_0006473 3300048905 Bacteria 9985
568 Ga0496103_0000099 3300048906 Bacteria 94046
569 Ga0496104_0184966 3300048907 Bacteria 1994
570 Ga0496105_0000502 3300048908 Bacteria 25826
571 Ga0496109_0579009 3300048912 Bacteria 1058
572 Ga0496111_0036294 3300048914 Bacteria 3524
573 Ga0496112_0690480 3300048915 Bacteria 949
574 Ga0496114_0011239 3300048917 Bacteria 7148
575 Ga0496114_1463371 3300048917 Bacteria 571
576 Ga0496115_0000066 3300048918 Bacteria 95550
577 Ga0496115_0002045 3300048918 Bacteria 14436
578 Ga0496116_0039634 3300048919 Bacteria 3255
579 Ga0496117_0000744 3300048920 Bacteria 51303
580 Ga0496117_0142705 3300048920 Bacteria 1431
581 Ga0496117_0418781 3300048920 Bacteria 670
582 Ga0496117_0558117 3300048920 Bacteria 544
583 Ga0496118_0000852 3300048921 Bacteria 48454
584 Ga0496118_0070946 3300048921 Bacteria 2511
585 Ga0496119_0029867 3300048922 Bacteria 3685
586 Ga0496120_0051158 3300048923 Bacteria 2361
587 Ga0496121_0000123 3300048924 Bacteria 172448
588 Ga0496121_0000417 3300048924 Bacteria 84424
589 Ga0496121_0007062 3300048924 Bacteria 13635
590 Ga0496121_0060505 3300048924 Bacteria 3114
591 Ga0496121_0478933 3300048924 Bacteria 795
592 Ga0496122_0009816 3300048925 Bacteria 9995
593 Ga0496122_0338018 3300048925 Bacteria 792
594 Ga0496123_0011327 3300048926 Bacteria 7746
595 Ga0496123_0228533 3300048926 Bacteria 933
596 Ga0496124_0000291 3300048927 Bacteria 94493
597 Ga0496125_0000687 3300048928 Bacteria 56251
598 Ga0496126_0001921 3300048929 Bacteria 29797
599 Ga0496126_0138939 3300048929 Bacteria 2093
600 Ga0495682_0039516 3300049460 Bacteria 1732
601 Ga0501292_109237 3300049515 Bacteria 555
602 Ga0501032_0438965 3300049569 Bacteria 837
603 Ga0501033_0043118 3300049570 Bacteria 3361
604 Ga0501033_0452007 3300049570 Bacteria 892
605 Ga0501034_0042776 3300049571 Bacteria 4586
606 Ga0501034_0132716 3300049571 Bacteria 2473
607 Ga0501034_0322550 3300049571 Bacteria 1477
608 Ga0501037_0313980 3300049573 Bacteria 1086
609 Ga0501038_0466378 3300049574 Bacteria 969
610 Ga0501042_0278549 3300049578 Bacteria 1208
611 Ga0501042_0925303 3300049578 Bacteria 635
612 Ga0501043_0082420 3300049579 Bacteria 2528
613 Ga0501043_1046822 3300049579 Bacteria 579
614 Ga0501046_0926205 3300049580 Bacteria 607
615 Ga0501047_0082116 3300049581 Bacteria 3098
616 Ga0501048_0943195 3300049582 Bacteria 621
617 Ga0501070_1265764 3300049586 Bacteria 564
618 Ga0501080_1621927 3300049742 Bacteria 547
619 Ga0501044_0152344 3300049823 Bacteria 2294
620 Ga0501044_0159668 3300049823 Bacteria 2232
621 Ga0501044_0373772 3300049823 Bacteria 1341
622 Ga0501044_0820588 3300049823 Bacteria 808
623 Ga0501044_1437406 3300049823 Bacteria 555
624 nmdc:mga03683_15265_c1 3300050489 Bacteria 2863
625 nmdc:mga03683_28819_c1 3300050489 Bacteria 1892
626 nmdc:mga03683_42029_c1 3300050489 Bacteria 1879
627 nmdc:mga03n38_228227_c1 3300050490 Bacteria 975
628 nmdc:mga00v17_207561_c1 3300050491 Bacteria 1267
629 nmdc:mga0yw44_176765_c1 3300050492 Bacteria 1404
630 nmdc:mga0yw44_350874_c1 3300050492 Bacteria 993
631 nmdc:mga0yw44_647851_c1 3300050492 Bacteria 718
632 nmdc:mga06z11_125914_c1 3300050494 Bacteria 1434
633 nmdc:mga06z11_71934_c1 3300050494 Bacteria 1832
634 nmdc:mga09592_1221778_c1 3300050508 Bacteria 620
635 nmdc:mga0sz30_54774_c1 3300050516 Bacteria 1697
636 Ga0495601_0001228 3300053077 Bacteria 14075
637 Ga0495612_0002265 3300053078 Bacteria 7919
638 Ga0500610_0000029 3300053079 Bacteria 52531
639 Ga0495595_0633130 3300053084 Bacteria 547
640 Ga0495619_0042398 3300053085 Bacteria 2980
641 Ga0495619_0061883 3300053085 Bacteria 2491
642 Ga0500643_000850 3300053087 Bacteria 19500
643 Ga0500643_142645 3300053087 Bacteria 643
644 Ga0500644_0439248 3300053088 Bacteria 571
645 Ga0500647_0033566 3300053091 Bacteria 2448
646 Ga0500583_0019875 3300053092 Bacteria 2762
647 Ga0500583_0553297 3300053092 Bacteria 534
648 Ga0500566_0367408 3300053094 Bacteria 654
649 Ga0500641_0002425 3300053096 Bacteria 6617
650 Ga0500641_0038567 3300053096 Bacteria 1921
651 Ga0500594_0006984 3300053118 Bacteria 2547
652 Ga0500595_009699 3300053119 Bacteria 3875
653 Ga0500642_0002483 3300053130 Bacteria 5424
654 Ga0500642_0027140 3300053130 Bacteria 2347
655 Ga0500652_002754 3300053131 Bacteria 5306
656 Ga0500658_0006334 3300053134 Bacteria 4392
657 Ga0500559_0003405 3300053136 Bacteria 7831
658 Ga0500559_0040520 3300053136 Bacteria 2028
659 Ga0500559_0147291 3300053136 Bacteria 1104
660 Ga0500559_0221578 3300053136 Bacteria 892
661 Ga0500568_0058068 3300053139 Bacteria 1504
662 Ga0500568_0115510 3300053139 Bacteria 1002
663 Ga0500573_0000010 3300053140 Bacteria 210704
664 Ga0500616_0002245 3300053153 Bacteria 16516
665 Ga0500619_006273 3300053154 Bacteria 2728
666 Ga0500636_0020266 3300053177 Bacteria 3936
667 Ga0500645_000019 3300053730 Bacteria 135445
668 Ga0500596_009933 3300053735 Bacteria 1477
669 Ga0501082_0870826 3300060353 Bacteria 788

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053136 Ga0500559_0003405 Ga0500559_0003405_6576_7052 135
2 3300048925 Ga0496122_0338018 Ga0496122_0338018_110_586 136
3 3300036712 Ga0316584_0087156 Ga0316584_0087156_1059_1553 141
4 3300014497 Ga0182008_10265204 Ga0182008_102652042 143
5 3300025986 Ga0207658_10711923 Ga0207658_107119232 143
6 3300046520 Ga0495637_0043585 Ga0495637_0043585_843_1277 144
7 iso_pu_bacteria 2597490356 2599104998 148
8 iso_pu_bacteria 2830075706 2830076236 148
9 iso_pu_bacteria 2846952575 2846954281 148
10 iso_pu_bacteria 2848858292 2848859484 148
11 iso_pu_bacteria 2885429604 2885432398 148
12 iso_pu_bacteria 2946787523 2946790119 148
13 3300049571 Ga0501034_0042776 Ga0501034_0042776_147_599 149
14 3300049573 Ga0501037_0313980 Ga0501037_0313980_292_744 149
15 3300049823 Ga0501044_0152344 Ga0501044_0152344_639_1091 149
16 iso_pu_bacteria 2751185897 2753765831 149
17 iso_pu_bacteria 2909399089 2909402512 149
18 iso_pu_bacteria 641228493 641335699 149
19 iso_pu_bacteria 643348555 643393054 149
20 3300005329 Ga0070683_100766819 Ga0070683_1007668191 150
21 3300005354 Ga0070675_100325133 Ga0070675_1003251332 150
22 3300005434 Ga0070709_10110109 Ga0070709_101101092 150
23 3300005435 Ga0070714_100000478 Ga0070714_10000047830 150
24 3300005435 Ga0070714_100674890 Ga0070714_1006748901 150
25 3300005435 Ga0070714_100832976 Ga0070714_1008329762 150
26 3300005436 Ga0070713_100132319 Ga0070713_1001323192 150
27 3300005436 Ga0070713_100521309 Ga0070713_1005213091 150
28 3300005436 Ga0070713_101195611 Ga0070713_1011956112 150
29 3300005437 Ga0070710_10086418 Ga0070710_100864182 150
30 3300005437 Ga0070710_10258928 Ga0070710_102589282 150
31 3300005439 Ga0070711_100300663 Ga0070711_1003006632 150
32 3300005439 Ga0070711_100372260 Ga0070711_1003722602 150
33 3300005458 Ga0070681_11202614 Ga0070681_112026141 150
34 3300005530 Ga0070679_100117813 Ga0070679_1001178132 150
35 3300005546 Ga0070696_101673121 Ga0070696_1016731211 150
36 3300005548 Ga0070665_100207851 Ga0070665_1002078512 150
37 3300005563 Ga0068855_101242216 Ga0068855_1012422162 150
38 3300005563 Ga0068855_101351070 Ga0068855_1013510701 150
39 3300005578 Ga0068854_100744305 Ga0068854_1007443052 150
40 3300005614 Ga0068856_100562267 Ga0068856_1005622672 150
41 3300005834 Ga0068851_10133527 Ga0068851_101335272 150
42 3300005842 Ga0068858_100184765 Ga0068858_1001847652 150
43 3300006028 Ga0070717_10108594 Ga0070717_101085942 150
44 3300006175 Ga0070712_100091509 Ga0070712_1000915092 150
45 3300009101 Ga0105247_10567932 Ga0105247_105679322 150
46 3300009176 Ga0105242_11756561 Ga0105242_117565611 150
47 3300009177 Ga0105248_10028391 Ga0105248_100283913 150
48 3300010375 Ga0105239_11110537 Ga0105239_111105371 150
49 3300013105 Ga0157369_10208094 Ga0157369_102080942 150
50 3300013105 Ga0157369_12053384 Ga0157369_120533841 150
51 3300013296 Ga0157374_10200350 Ga0157374_102003502 150
52 3300013296 Ga0157374_12943906 Ga0157374_129439061 150
53 3300014325 Ga0163163_10370444 Ga0163163_103704442 150
54 3300014325 Ga0163163_11084778 Ga0163163_110847782 150
55 3300014497 Ga0182008_10025204 Ga0182008_100252044 150
56 3300014968 Ga0157379_10743872 Ga0157379_107438722 150
57 3300020069 Ga0197907_10784425 Ga0197907_107844251 150
58 3300020081 Ga0206354_11056629 Ga0206354_110566292 150
59 3300021377 Ga0213874_10054300 Ga0213874_100543002 150
60 3300021377 Ga0213874_10182690 Ga0213874_101826902 150
61 3300021388 Ga0213875_10010530 Ga0213875_100105305 150
62 3300022467 Ga0224712_10370181 Ga0224712_103701812 150
63 3300025898 Ga0207692_10076414 Ga0207692_100764142 150
64 3300025900 Ga0207710_10286067 Ga0207710_102860672 150
65 3300025903 Ga0207680_10870489 Ga0207680_108704892 150
66 3300025906 Ga0207699_10060841 Ga0207699_100608412 150
67 3300025906 Ga0207699_10461018 Ga0207699_104610182 150
68 3300025911 Ga0207654_11046368 Ga0207654_110463681 150
69 3300025912 Ga0207707_10576723 Ga0207707_105767231 150
70 3300025915 Ga0207693_10218841 Ga0207693_102188412 150
71 3300025916 Ga0207663_10019835 Ga0207663_100198352 150
72 3300025916 Ga0207663_10766946 Ga0207663_107669462 150
73 3300025921 Ga0207652_10051658 Ga0207652_100516584 150
74 3300025926 Ga0207659_10525561 Ga0207659_105255612 150
75 3300025928 Ga0207700_10039287 Ga0207700_100392874 150
76 3300025928 Ga0207700_10242609 Ga0207700_102426092 150
77 3300025929 Ga0207664_10001839 Ga0207664_100018396 150
78 3300025929 Ga0207664_10120460 Ga0207664_101204603 150
79 3300025937 Ga0207669_10434778 Ga0207669_104347782 150
80 3300025941 Ga0207711_10156055 Ga0207711_101560552 150
81 3300025949 Ga0207667_11130126 Ga0207667_111301262 150
82 3300025981 Ga0207640_10621884 Ga0207640_106218842 150
83 3300026035 Ga0207703_10180831 Ga0207703_101808312 150
84 3300026078 Ga0207702_10708402 Ga0207702_107084022 150
85 3300028379 Ga0268266_10054911 Ga0268266_100549113 150
86 3300028379 Ga0268266_10377750 Ga0268266_103777502 150
87 3300035083 Ga0373926_0114580 Ga0373926_0114580_522_977 150
88 3300035086 Ga0373934_0098706 Ga0373934_0098706_284_739 150
89 3300035111 Ga0373923_0177992 Ga0373923_0177992_288_743 150
90 3300035111 Ga0373923_0311234 Ga0373923_0311234_184_639 150
91 3300035113 Ga0373936_0024693 Ga0373936_0024693_566_1021 150
92 3300035113 Ga0373936_0045831 Ga0373936_0045831_744_1199 150
93 3300035113 Ga0373936_0073083 Ga0373936_0073083_132_587 150
94 3300035116 Ga0373945_0147482 Ga0373945_0147482_129_584 150
95 3300035117 Ga0373953_0015069 Ga0373953_0015069_1803_2258 150
96 3300035118 Ga0373954_0060128 Ga0373954_0060128_365_820 150
97 3300035118 Ga0373954_0077163 Ga0373954_0077163_833_1288 150
98 3300035119 Ga0373956_0044412 Ga0373956_0044412_361_816 150
99 3300035119 Ga0373956_0409602 Ga0373956_0409602_88_543 150
100 3300035120 Ga0373957_0045097 Ga0373957_0045097_880_1335 150
101 3300035120 Ga0373957_0200554 Ga0373957_0200554_117_572 150
102 3300035171 Ga0373946_0059113 Ga0373946_0059113_783_1238 150
103 3300035171 Ga0373946_0106241 Ga0373946_0106241_34_489 150
104 3300035171 Ga0373946_0388545 Ga0373946_0388545_91_546 150
105 3300035172 Ga0373955_0038544 Ga0373955_0038544_642_1097 150
106 3300035172 Ga0373955_0047885 Ga0373955_0047885_510_965 150
107 3300035172 Ga0373955_0102133 Ga0373955_0102133_738_1193 150
108 3300035692 Ga0373935_0038660 Ga0373935_0038660_1875_2330 150
109 3300035692 Ga0373935_0116150 Ga0373935_0116150_498_953 150
110 3300035692 Ga0373935_0211191 Ga0373935_0211191_526_981 150
111 3300035695 Ga0373927_0041227 Ga0373927_0041227_1203_1658 150
112 3300035695 Ga0373927_0149954 Ga0373927_0149954_390_845 150
113 3300035724 Ga0373933_0066700 Ga0373933_0066700_851_1306 150
114 3300035725 Ga0373947_0025308 Ga0373947_0025308_719_1174 150
115 3300035725 Ga0373947_0179640 Ga0373947_0179640_759_1214 150
116 3300036401 Ga0373937_0000734 Ga0373937_0000734_24800_25255 150
117 3300036401 Ga0373937_0021679 Ga0373937_0021679_2883_3338 150
118 3300036401 Ga0373937_0322569 Ga0373937_0322569_661_1116 150
119 3300036401 Ga0373937_0579457 Ga0373937_0579457_342_797 150
120 3300036401 Ga0373937_1700300 Ga0373937_1700300_80_535 150
121 3300037068 Ga0373925_0005630 Ga0373925_0005630_353_808 150
122 3300037068 Ga0373925_0255139 Ga0373925_0255139_815_1270 150
123 3300037068 Ga0373925_0711561 Ga0373925_0711561_196_651 150
124 3300037312 Ga0395899_0055370 Ga0395899_0055370_42_500 150
125 3300037418 Ga0395900_0021292 Ga0395900_0021292_316_774 150
126 3300037418 Ga0395900_0920444 Ga0395900_0920444_216_674 150
127 3300037466 Ga0395898_0389718 Ga0395898_0389718_555_1013 150
128 3300037853 Ga0436364_0071585 Ga0436364_0071585_1188_1643 150
129 3300037853 Ga0436364_0135989 Ga0436364_0135989_1412_1867 150
130 3300037853 Ga0436364_0748963 Ga0436364_0748963_708_1163 150
131 3300037853 Ga0436364_0878606 Ga0436364_0878606_1353_1808 150
132 3300037853 Ga0436364_1347066 Ga0436364_1347066_697_1152 150
133 3300037853 Ga0436364_1488888 Ga0436364_1488888_2619_3074 150
134 3300038443 Ga0395901_0012568 Ga0395901_0012568_7818_8276 150
135 3300039437 Ga0436365_0171907 Ga0436365_0171907_37_492 150
136 3300039437 Ga0436365_0772100 Ga0436365_0772100_115_570 150
137 3300039438 Ga0436360_1011171 Ga0436360_1011171_329_784 150
138 3300039450 Ga0436363_0420453 Ga0436363_0420453_248_703 150
139 3300039450 Ga0436363_0631560 Ga0436363_0631560_105_560 150
140 3300039450 Ga0436363_1618324 Ga0436363_1618324_155_610 150
141 3300039450 Ga0436363_1706959 Ga0436363_1706959_69_524 150
142 3300039453 Ga0436362_1137136 Ga0436362_1137136_195_650 150
143 3300039453 Ga0436362_1232813 Ga0436362_1232813_245_700 150
144 3300044694 Ga0466963_0310092 Ga0466963_0310092_165_620 150
145 3300044712 Ga0453684_0212646 Ga0453684_0212646_587_1042 150
146 3300045836 Ga0466958_0843359 Ga0466958_0843359_112_567 150
147 3300045976 Ga0466967_1162654 Ga0466967_1162654_202_657 150
148 3300046454 Ga0495592_0012195 Ga0495592_0012195_1648_2103 150
149 3300046455 Ga0495603_0829359 Ga0495603_0829359_25_480 150
150 3300046459 Ga0495629_0357267 Ga0495629_0357267_351_806 150
151 3300046459 Ga0495629_0693028 Ga0495629_0693028_33_488 150
152 3300046462 Ga0495651_0112340 Ga0495651_0112340_972_1427 150
153 3300046463 Ga0495653_0233527 Ga0495653_0233527_408_863 150
154 3300046472 Ga0495580_0897668 Ga0495580_0897668_48_503 150
155 3300046477 Ga0495664_0001900 Ga0495664_0001900_9491_9946 150
156 3300046499 Ga0495594_0200986 Ga0495594_0200986_151_606 150
157 3300046511 Ga0495608_0007407 Ga0495608_0007407_4903_5358 150
158 3300046511 Ga0495608_0032915 Ga0495608_0032915_2831_3286 150
159 3300046511 Ga0495608_0193013 Ga0495608_0193013_347_802 150
160 3300046516 Ga0495628_0056372 Ga0495628_0056372_1251_1706 150
161 3300046517 Ga0495630_0243788 Ga0495630_0243788_621_1076 150
162 3300046517 Ga0495630_0633773 Ga0495630_0633773_74_529 150
163 3300046529 Ga0495652_0156645 Ga0495652_0156645_183_638 150
164 3300046531 Ga0495665_0188602 Ga0495665_0188602_246_701 150
165 3300046533 Ga0495640_0025113 Ga0495640_0025113_338_793 150
166 3300046533 Ga0495640_0221511 Ga0495640_0221511_438_893 150
167 3300046536 Ga0495587_0014199 Ga0495587_0014199_1806_2261 150
168 3300046536 Ga0495587_0461402 Ga0495587_0461402_62_517 150
169 3300046543 Ga0495645_0002599 Ga0495645_0002599_5884_6339 150
170 3300046543 Ga0495645_0187470 Ga0495645_0187470_832_1287 150
171 3300046559 Ga0495667_0003743 Ga0495667_0003743_2503_2958 150
172 3300046559 Ga0495667_0046991 Ga0495667_0046991_1517_1972 150
173 3300046559 Ga0495667_0055286 Ga0495667_0055286_2142_2597 150
174 3300046642 Ga0495634_0334472 Ga0495634_0334472_350_805 150
175 3300046675 Ga0495657_0261248 Ga0495657_0261248_217_672 150
176 3300046675 Ga0495657_0329966 Ga0495657_0329966_255_710 150
177 3300046678 Ga0495599_0013458 Ga0495599_0013458_3882_4337 150
178 3300046678 Ga0495599_0186360 Ga0495599_0186360_759_1214 150
179 3300046679 Ga0495623_0137357 Ga0495623_0137357_776_1231 150
180 3300046681 Ga0495647_0244812 Ga0495647_0244812_82_537 150
181 3300046809 Ga0495600_0039523 Ga0495600_0039523_49_504 150
182 3300046809 Ga0495600_0116837 Ga0495600_0116837_729_1184 150
183 3300047317 Ga0495604_0170157 Ga0495604_0170157_462_917 150
184 3300047319 Ga0495674_0099385 Ga0495674_0099385_1948_2403 150
185 3300047319 Ga0495674_0146504 Ga0495674_0146504_251_706 150
186 3300047444 Ga0495675_0024698 Ga0495675_0024698_40_495 150
187 3300047444 Ga0495675_0162816 Ga0495675_0162816_651_1106 150
188 3300047471 Ga0495684_0069256 Ga0495684_0069256_1249_1704 150
189 3300047471 Ga0495684_0090018 Ga0495684_0090018_1858_2313 150
190 3300048088 Ga0495602_0001050 Ga0495602_0001050_11767_12222 150
191 3300048904 Ga0496101_1113465 Ga0496101_1113465_86_541 150
192 3300048915 Ga0496112_0690480 Ga0496112_0690480_246_701 150
193 3300049570 Ga0501033_0043118 Ga0501033_0043118_1748_2203 150
194 3300049823 Ga0501044_0820588 Ga0501044_0820588_266_721 150
195 3300053077 Ga0495601_0001228 Ga0495601_0001228_7946_8401 150
196 3300053078 Ga0495612_0002265 Ga0495612_0002265_5864_6319 150
197 3300053084 Ga0495595_0633130 Ga0495595_0633130_16_471 150
198 3300053085 Ga0495619_0042398 Ga0495619_0042398_879_1334 150
199 3300053085 Ga0495619_0061883 Ga0495619_0061883_486_941 150
200 3300053140 Ga0500573_0000010 Ga0500573_0000010_18150_18602 150
201 3300053131 Ga0500652_002754 Ga0500652_002754_901_1359 151
202 3300002459 JGI24751J29686_10072127 JGI24751J29686_100721271 152
203 3300003316 rootH1_10165260 rootH1_101652602 152
204 3300003323 rootH1_10305472 rootH1_103054722 152
205 3300005331 Ga0070670_100042394 Ga0070670_1000423943 152
206 3300005367 Ga0070667_100021285 Ga0070667_1000212854 152
207 3300005617 Ga0068859_100000085 Ga0068859_10000008531 152
208 3300006931 Ga0097620_100000085 Ga0097620_10000008531 152
209 3300009093 Ga0105240_10036237 Ga0105240_100362371 152
210 3300009101 Ga0105247_10003709 Ga0105247_100037094 152
211 3300009148 Ga0105243_10058660 Ga0105243_100586602 152
212 3300009177 Ga0105248_10019502 Ga0105248_100195028 152
213 3300009545 Ga0105237_10008752 Ga0105237_100087529 152
214 3300009545 Ga0105237_11634267 Ga0105237_116342672 152
215 3300009553 Ga0105249_10001806 Ga0105249_1000180613 152
216 3300010375 Ga0105239_10000060 Ga0105239_10000060112 152
217 3300013105 Ga0157369_10479292 Ga0157369_104792921 152
218 3300013306 Ga0163162_10128733 Ga0163162_101287332 152
219 3300025900 Ga0207710_10004115 Ga0207710_100041154 152
220 3300025913 Ga0207695_10044491 Ga0207695_100444912 152
221 3300025913 Ga0207695_10052176 Ga0207695_100521764 152
222 3300025914 Ga0207671_10002033 Ga0207671_1000203317 152
223 3300025925 Ga0207650_10036667 Ga0207650_100366672 152
224 3300025961 Ga0207712_10007444 Ga0207712_100074444 152
225 3300025986 Ga0207658_10016459 Ga0207658_100164593 152
226 3300026116 Ga0207674_10740985 Ga0207674_107409852 152
227 3300028379 Ga0268266_10064475 Ga0268266_100644751 152
228 3300037853 Ga0436364_0429284 Ga0436364_0429284_55_516 152
229 3300039450 Ga0436363_1046130 Ga0436363_1046130_268_732 152
230 3300039450 Ga0436363_1048080 Ga0436363_1048080_16_480 152
231 3300046542 Ga0495597_0280788 Ga0495597_0280788_114_575 152
232 3300046692 Ga0495671_0004554 Ga0495671_0004554_4035_4496 152
233 3300048920 Ga0496117_0142705 Ga0496117_0142705_256_717 152
234 3300048920 Ga0496117_0418781 Ga0496117_0418781_33_494 152
235 3300048921 Ga0496118_0070946 Ga0496118_0070946_491_952 152
236 3300048924 Ga0496121_0007062 Ga0496121_0007062_794_1255 152
237 3300048924 Ga0496121_0060505 Ga0496121_0060505_1905_2366 152
238 3300048929 Ga0496126_0138939 Ga0496126_0138939_653_1114 152
239 3300049574 Ga0501038_0466378 Ga0501038_0466378_335_796 152
240 3300049579 Ga0501043_1046822 Ga0501043_1046822_31_492 152
241 3300049823 Ga0501044_0159668 Ga0501044_0159668_1373_1897 152
242 3300053118 Ga0500594_0006984 Ga0500594_0006984_1668_2129 152
243 3300002773 JGI25152J39213_1028504 JGI25152J39213_10285042 153
244 3300002774 JGI25150J39212_1000177 JGI25150J39212_100017717 153
245 3300003187 JGI25151J46595_10100177 JGI25151J46595_101001771 153
246 3300003203 JGI25406J46586_10177799 JGI25406J46586_101777991 153
247 3300003215 JGI25153J46596_10000064 JGI25153J46596_10000064137 153
248 3300003773 Ga0055537_1002015 Ga0055537_10020156 153
249 3300003781 Ga0055536_1027551 Ga0055536_10275512 153
250 3300003792 Ga0055540_1000762 Ga0055540_10007628 153
251 3300005327 Ga0070658_10179180 Ga0070658_101791802 153
252 3300005327 Ga0070658_11357621 Ga0070658_113576211 153
253 3300005334 Ga0068869_101530177 Ga0068869_1015301771 153
254 3300005335 Ga0070666_10620249 Ga0070666_106202491 153
255 3300005347 Ga0070668_100627169 Ga0070668_1006271691 153
256 3300005356 Ga0070674_100791959 Ga0070674_1007919591 153
257 3300005436 Ga0070713_100170820 Ga0070713_1001708203 153
258 3300005445 Ga0070708_100003894 Ga0070708_10000389412 153
259 3300005456 Ga0070678_101328854 Ga0070678_1013288541 153
260 3300005458 Ga0070681_10138885 Ga0070681_101388852 153
261 3300005466 Ga0070685_10435061 Ga0070685_104350612 153
262 3300005467 Ga0070706_100070961 Ga0070706_1000709613 153
263 3300005468 Ga0070707_100107642 Ga0070707_1001076422 153
264 3300005471 Ga0070698_100002550 Ga0070698_10000255010 153
265 3300005518 Ga0070699_100104442 Ga0070699_1001044422 153
266 3300005530 Ga0070679_100252856 Ga0070679_1002528562 153
267 3300005539 Ga0068853_100382407 Ga0068853_1003824073 153
268 3300005539 Ga0068853_101333544 Ga0068853_1013335442 153
269 3300005548 Ga0070665_100144679 Ga0070665_1001446793 153
270 3300005548 Ga0070665_100869105 Ga0070665_1008691052 153
271 3300005577 Ga0068857_100280377 Ga0068857_1002803772 153
272 3300005577 Ga0068857_100396414 Ga0068857_1003964142 153
273 3300005577 Ga0068857_101004796 Ga0068857_1010047962 153
274 3300005578 Ga0068854_100319177 Ga0068854_1003191772 153
275 3300005615 Ga0070702_100910951 Ga0070702_1009109511 153
276 3300005617 Ga0068859_101494467 Ga0068859_1014944672 153
277 3300005718 Ga0068866_10761395 Ga0068866_107613951 153
278 3300005842 Ga0068858_100000122 Ga0068858_10000012233 153
279 3300005842 Ga0068858_100000166 Ga0068858_10000016622 153
280 3300005843 Ga0068860_100049220 Ga0068860_1000492205 153
281 3300005937 Ga0081455_10000933 Ga0081455_100009337 153
282 3300005937 Ga0081455_10002813 Ga0081455_100028139 153
283 3300005937 Ga0081455_10035376 Ga0081455_100353764 153
284 3300005981 Ga0081538_10111882 Ga0081538_101118822 153
285 3300005983 Ga0081540_1132378 Ga0081540_11323782 153
286 3300005985 Ga0081539_10012874 Ga0081539_100128742 153
287 3300005985 Ga0081539_10016575 Ga0081539_100165752 153
288 3300005985 Ga0081539_10333994 Ga0081539_103339941 153
289 3300006028 Ga0070717_10306885 Ga0070717_103068852 153
290 3300006038 Ga0075365_10072925 Ga0075365_100729252 153
291 3300006038 Ga0075365_10356948 Ga0075365_103569482 153
292 3300006038 Ga0075365_10514117 Ga0075365_105141172 153
293 3300006177 Ga0075362_10021792 Ga0075362_100217922 153
294 3300006177 Ga0075362_10027924 Ga0075362_100279242 153
295 3300006178 Ga0075367_10083752 Ga0075367_100837522 153
296 3300006186 Ga0075369_10079337 Ga0075369_100793372 153
297 3300006186 Ga0075369_10529269 Ga0075369_105292691 153
298 3300006195 Ga0075366_10026426 Ga0075366_100264262 153
299 3300006358 Ga0068871_101595291 Ga0068871_1015952912 153
300 3300006931 Ga0097620_101494475 Ga0097620_1014944752 153
301 3300007265 Ga0099794_10617623 Ga0099794_106176231 153
302 3300009098 Ga0105245_10000623 Ga0105245_100006237 153
303 3300009147 Ga0114129_11042589 Ga0114129_110425892 153
304 3300009148 Ga0105243_10007245 Ga0105243_100072457 153
305 3300009176 Ga0105242_11574450 Ga0105242_115744502 153
306 3300009177 Ga0105248_10031813 Ga0105248_100318135 153
307 3300009177 Ga0105248_11172460 Ga0105248_111724602 153
308 3300009553 Ga0105249_10039113 Ga0105249_100391134 153
309 3300010375 Ga0105239_10712179 Ga0105239_107121792 153
310 3300011119 Ga0105246_10188788 Ga0105246_101887882 153
311 3300013104 Ga0157370_10131531 Ga0157370_101315313 153
312 3300013297 Ga0157378_10018568 Ga0157378_100185684 153
313 3300013306 Ga0163162_10017302 Ga0163162_100173024 153
314 3300013306 Ga0163162_10228292 Ga0163162_102282923 153
315 3300013306 Ga0163162_10305166 Ga0163162_103051663 153
316 3300013306 Ga0163162_10512062 Ga0163162_105120622 153
317 3300013306 Ga0163162_11400432 Ga0163162_114004321 153
318 3300013308 Ga0157375_10413475 Ga0157375_104134753 153
319 3300014969 Ga0157376_10236103 Ga0157376_102361032 153
320 3300015690 Ga0183363_1010 Ga0183363_101094 153
321 3300017792 Ga0163161_10984966 Ga0163161_109849662 153
322 3300021361 Ga0213872_10027728 Ga0213872_100277282 153
323 3300021384 Ga0213876_10064836 Ga0213876_100648362 153
324 3300025233 Ga0209437_104206 Ga0209437_1042063 153
325 3300025245 Ga0207425_1000019 Ga0207425_1000019342 153
326 3300025258 Ga0209129_1001013 Ga0209129_100101312 153
327 3300025261 Ga0209233_1000107 Ga0209233_100010769 153
328 3300025263 Ga0209565_1000166 Ga0209565_100016677 153
329 3300025273 Ga0209673_1014928 Ga0209673_10149286 153
330 3300025292 Ga0209676_1009397 Ga0209676_10093972 153
331 3300025292 Ga0209676_1021032 Ga0209676_10210322 153
332 3300025294 Ga0209025_1000304 Ga0209025_100030461 153
333 3300025295 Ga0209564_1001084 Ga0209564_100108415 153
334 3300025295 Ga0209564_1001084 Ga0209564_10010846 153
335 3300025297 Ga0209758_1000019 Ga0209758_1000019245 153
336 3300025298 Ga0209050_1000001 Ga0209050_10000011310 153
337 3300025298 Ga0209050_1019174 Ga0209050_10191742 153
338 3300025298 Ga0209050_1028612 Ga0209050_10286121 153
339 3300025302 Ga0207426_1004545 Ga0207426_10045452 153
340 3300025303 Ga0209051_1000309 Ga0209051_100030921 153
341 3300025304 Ga0209257_1001776 Ga0209257_100177622 153
342 3300025304 Ga0209257_1001845 Ga0209257_100184523 153
343 3300025315 Ga0207697_10006203 Ga0207697_100062036 153
344 3300025315 Ga0207697_10196420 Ga0207697_101964202 153
345 3300025899 Ga0207642_10665090 Ga0207642_106650901 153
346 3300025901 Ga0207688_10354957 Ga0207688_103549571 153
347 3300025906 Ga0207699_10795613 Ga0207699_107956131 153
348 3300025907 Ga0207645_10674606 Ga0207645_106746061 153
349 3300025909 Ga0207705_10148369 Ga0207705_101483693 153
350 3300025909 Ga0207705_11241965 Ga0207705_112419651 153
351 3300025910 Ga0207684_10070898 Ga0207684_100708984 153
352 3300025911 Ga0207654_10379413 Ga0207654_103794132 153
353 3300025922 Ga0207646_10063693 Ga0207646_100636934 153
354 3300025922 Ga0207646_10723120 Ga0207646_107231202 153
355 3300025924 Ga0207694_10027041 Ga0207694_100270415 153
356 3300025924 Ga0207694_10978735 Ga0207694_109787351 153
357 3300025924 Ga0207694_10997254 Ga0207694_109972541 153
358 3300025927 Ga0207687_10007708 Ga0207687_100077087 153
359 3300025928 Ga0207700_10011551 Ga0207700_100115514 153
360 3300025933 Ga0207706_10494164 Ga0207706_104941642 153
361 3300025934 Ga0207686_10074291 Ga0207686_100742911 153
362 3300025935 Ga0207709_10032521 Ga0207709_100325212 153
363 3300025936 Ga0207670_11283511 Ga0207670_112835111 153
364 3300025941 Ga0207711_10016955 Ga0207711_100169556 153
365 3300025942 Ga0207689_10608502 Ga0207689_106085021 153
366 3300025942 Ga0207689_10626306 Ga0207689_106263062 153
367 3300025960 Ga0207651_11073230 Ga0207651_110732302 153
368 3300025961 Ga0207712_10121812 Ga0207712_101218122 153
369 3300025972 Ga0207668_10401620 Ga0207668_104016202 153
370 3300025981 Ga0207640_10372913 Ga0207640_103729131 153
371 3300026023 Ga0207677_10198724 Ga0207677_101987242 153
372 3300026023 Ga0207677_10722005 Ga0207677_107220052 153
373 3300026035 Ga0207703_10000159 Ga0207703_1000015945 153
374 3300026035 Ga0207703_10000711 Ga0207703_1000071120 153
375 3300026041 Ga0207639_10162434 Ga0207639_101624343 153
376 3300026041 Ga0207639_10341494 Ga0207639_103414942 153
377 3300026089 Ga0207648_10786346 Ga0207648_107863462 153
378 3300026095 Ga0207676_10000351 Ga0207676_1000035123 153
379 3300026116 Ga0207674_10114190 Ga0207674_101141904 153
380 3300026116 Ga0207674_10207098 Ga0207674_102070982 153
381 3300026118 Ga0207675_100591962 Ga0207675_1005919622 153
382 3300026118 Ga0207675_100592087 Ga0207675_1005920871 153
383 3300028379 Ga0268266_10017160 Ga0268266_100171602 153
384 3300028379 Ga0268266_10071904 Ga0268266_100719042 153
385 3300028380 Ga0268265_11154308 Ga0268265_111543081 153
386 3300028381 Ga0268264_10170162 Ga0268264_101701622 153
387 3300028573 Ga0265334_10012253 Ga0265334_100122533 153
388 3300028786 Ga0307517_10001703 Ga0307517_1000170338 153
389 3300028786 Ga0307517_10134622 Ga0307517_101346224 153
390 3300031238 Ga0265332_10079895 Ga0265332_100798952 153
391 3300031238 Ga0265332_10167282 Ga0265332_101672822 153
392 3300031239 Ga0265328_10161627 Ga0265328_101616271 153
393 3300031241 Ga0265325_10108638 Ga0265325_101086382 153
394 3300031247 Ga0265340_10041331 Ga0265340_100413312 153
395 3300031456 Ga0307513_10246587 Ga0307513_102465873 153
396 3300031507 Ga0307509_10052180 Ga0307509_100521806 153
397 3300031616 Ga0307508_10000302 Ga0307508_1000030239 153
398 3300031712 Ga0265342_10423890 Ga0265342_104238902 153
399 3300031824 Ga0307413_10097534 Ga0307413_100975342 153
400 3300031911 Ga0307412_10115047 Ga0307412_101150472 153
401 3300031911 Ga0307412_10207994 Ga0307412_102079942 153
402 3300031995 Ga0307409_102106211 Ga0307409_1021062111 153
403 3300033180 Ga0307510_10000081 Ga0307510_100000815 153
404 3300034818 Ga0373950_0084004 Ga0373950_0084004_152_616 153
405 3300035088 Ga0373940_0192896 Ga0373940_0192896_38_502 153
406 3300035111 Ga0373923_0455992 Ga0373923_0455992_127_594 153
407 3300035112 Ga0373932_0022161 Ga0373932_0022161_869_1333 153
408 3300035113 Ga0373936_0181255 Ga0373936_0181255_331_795 153
409 3300035114 Ga0373939_0225886 Ga0373939_0225886_92_556 153
410 3300035691 Ga0373931_0092049 Ga0373931_0092049_180_647 153
411 3300035691 Ga0373931_0385519 Ga0373931_0385519_252_716 153
412 3300035692 Ga0373935_0746383 Ga0373935_0746383_60_524 153
413 3300035724 Ga0373933_0341735 Ga0373933_0341735_284_748 153
414 3300037068 Ga0373925_0751119 Ga0373925_0751119_74_538 153
415 3300037312 Ga0395899_0281355 Ga0395899_0281355_544_1008 153
416 3300037418 Ga0395900_0038468 Ga0395900_0038468_1439_1903 153
417 3300037466 Ga0395898_0005008 Ga0395898_0005008_10918_11382 153
418 3300037853 Ga0436364_1142638 Ga0436364_1142638_164_628 153
419 3300038443 Ga0395901_0017050 Ga0395901_0017050_4892_5356 153
420 3300038443 Ga0395901_0066564 Ga0395901_0066564_512_976 153
421 3300038443 Ga0395901_0631718 Ga0395901_0631718_224_691 153
422 3300039437 Ga0436365_0029237 Ga0436365_0029237_473_937 153
423 3300039437 Ga0436365_0060372 Ga0436365_0060372_1641_2102 153
424 3300039437 Ga0436365_1221776 Ga0436365_1221776_43_504 153
425 3300039438 Ga0436360_0691683 Ga0436360_0691683_336_806 153
426 3300039438 Ga0436360_0903033 Ga0436360_0903033_307_771 153
427 3300039447 Ga0436361_0251203 Ga0436361_0251203_3232_3696 153
428 3300041459 Ga0451800_1056121 Ga0451800_1056121_10_477 153
429 3300042011 Ga0439454_045497 Ga0439454_045497_229_693 153
430 3300042137 Ga0450902_061338 Ga0450902_061338_99_563 153
431 3300042157 Ga0439458_0022277 Ga0439458_0022277_347_811 153
432 3300044694 Ga0466963_0091650 Ga0466963_0091650_1075_1542 153
433 3300044706 Ga0466964_0083842 Ga0466964_0083842_590_1057 153
434 3300045051 Ga0451576_0000770 Ga0451576_0000770_23913_24386 153
435 3300045976 Ga0466967_0032894 Ga0466967_0032894_2491_2958 153
436 3300046460 Ga0495638_0000048 Ga0495638_0000048_80821_81282 153
437 3300046460 Ga0495638_0360479 Ga0495638_0360479_181_651 153
438 3300046506 Ga0495583_0022082 Ga0495583_0022082_2163_2633 153
439 3300046519 Ga0495632_0265548 Ga0495632_0265548_282_746 153
440 3300046524 Ga0495648_0102895 Ga0495648_0102895_687_1148 153
441 3300046529 Ga0495652_0391127 Ga0495652_0391127_471_932 153
442 3300046542 Ga0495597_0147750 Ga0495597_0147750_359_823 153
443 3300046616 Ga0495668_0118883 Ga0495668_0118883_612_1082 153
444 3300046660 Ga0495625_0000031 Ga0495625_0000031_235205_235666 153
445 3300046660 Ga0495625_0224450 Ga0495625_0224450_133_603 153
446 3300046691 Ga0495670_0157498 Ga0495670_0157498_539_1000 153
447 3300048917 Ga0496114_1463371 Ga0496114_1463371_31_495 153
448 3300048918 Ga0496115_0002045 Ga0496115_0002045_13339_13803 153
449 3300048920 Ga0496117_0558117 Ga0496117_0558117_47_508 153
450 3300048924 Ga0496121_0000123 Ga0496121_0000123_160513_160989 153
451 3300048924 Ga0496121_0478933 Ga0496121_0478933_103_564 153
452 3300048926 Ga0496123_0228533 Ga0496123_0228533_197_658 153
453 3300049515 Ga0501292_109237 Ga0501292_109237_18_482 153
454 3300049569 Ga0501032_0438965 Ga0501032_0438965_355_822 153
455 3300049570 Ga0501033_0452007 Ga0501033_0452007_65_529 153
456 3300049571 Ga0501034_0132716 Ga0501034_0132716_684_1151 153
457 3300049571 Ga0501034_0322550 Ga0501034_0322550_615_1082 153
458 3300049578 Ga0501042_0278549 Ga0501042_0278549_335_799 153
459 3300049578 Ga0501042_0925303 Ga0501042_0925303_24_488 153
460 3300049579 Ga0501043_0082420 Ga0501043_0082420_191_655 153
461 3300049580 Ga0501046_0926205 Ga0501046_0926205_103_567 153
462 3300049581 Ga0501047_0082116 Ga0501047_0082116_79_543 153
463 3300049582 Ga0501048_0943195 Ga0501048_0943195_120_584 153
464 3300049586 Ga0501070_1265764 Ga0501070_1265764_19_483 153
465 3300049742 Ga0501080_1621927 Ga0501080_1621927_59_523 153
466 3300049823 Ga0501044_0373772 Ga0501044_0373772_223_687 153
467 3300049823 Ga0501044_1437406 Ga0501044_1437406_59_520 153
468 3300050489 nmdc:mga03683_15265_c1 nmdc:mga03683_15265_c1_177_641 153
469 3300050489 nmdc:mga03683_28819_c1 nmdc:mga03683_28819_c1_108_572 153
470 3300050489 nmdc:mga03683_42029_c1 nmdc:mga03683_42029_c1_1382_1849 153
471 3300050490 nmdc:mga03n38_228227_c1 nmdc:mga03n38_228227_c1_251_715 153
472 3300050491 nmdc:mga00v17_207561_c1 nmdc:mga00v17_207561_c1_539_1003 153
473 3300050492 nmdc:mga0yw44_176765_c1 nmdc:mga0yw44_176765_c1_424_891 153
474 3300050492 nmdc:mga0yw44_350874_c1 nmdc:mga0yw44_350874_c1_158_625 153
475 3300050492 nmdc:mga0yw44_647851_c1 nmdc:mga0yw44_647851_c1_11_475 153
476 3300050494 nmdc:mga06z11_125914_c1 nmdc:mga06z11_125914_c1_716_1183 153
477 3300050494 nmdc:mga06z11_71934_c1 nmdc:mga06z11_71934_c1_56_520 153
478 3300050508 nmdc:mga09592_1221778_c1 nmdc:mga09592_1221778_c1_110_574 153
479 3300050516 nmdc:mga0sz30_54774_c1 nmdc:mga0sz30_54774_c1_643_1107 153
480 3300053087 Ga0500643_000850 Ga0500643_000850_18405_18875 153
481 3300053088 Ga0500644_0439248 Ga0500644_0439248_11_475 153
482 3300053092 Ga0500583_0553297 Ga0500583_0553297_56_523 153
483 3300053094 Ga0500566_0367408 Ga0500566_0367408_27_494 153
484 3300053096 Ga0500641_0002425 Ga0500641_0002425_118_585 153
485 3300053096 Ga0500641_0038567 Ga0500641_0038567_1015_1476 153
486 3300053130 Ga0500642_0027140 Ga0500642_0027140_58_522 153
487 3300053134 Ga0500658_0006334 Ga0500658_0006334_1036_1497 153
488 3300053136 Ga0500559_0040520 Ga0500559_0040520_725_1186 153
489 3300053136 Ga0500559_0147291 Ga0500559_0147291_143_616 153
490 3300053136 Ga0500559_0221578 Ga0500559_0221578_178_639 153
491 3300053139 Ga0500568_0058068 Ga0500568_0058068_774_1235 153
492 3300053139 Ga0500568_0115510 Ga0500568_0115510_138_602 153
493 3300053153 Ga0500616_0002245 Ga0500616_0002245_14976_15443 153
494 3300060353 Ga0501082_0870826 Ga0501082_0870826_77_544 153
495 3300001904 JGI24736J21556_1046316 JGI24736J21556_10463161 154
496 3300001904 JGI24736J21556_1063067 JGI24736J21556_10630671 154
497 3300001915 JGI24741J21665_1002675 JGI24741J21665_10026756 154
498 3300001979 JGI24740J21852_10003789 JGI24740J21852_100037891 154
499 3300001989 JGI24739J22299_10042349 JGI24739J22299_100423492 154
500 3300001990 JGI24737J22298_10015131 JGI24737J22298_100151313 154
501 3300002067 JGI24735J21928_10140226 JGI24735J21928_101402262 154
502 3300002075 JGI24738J21930_10041033 JGI24738J21930_100410332 154
503 3300002077 JGI24744J21845_10071195 JGI24744J21845_100711951 154
504 3300003215 JGI25153J46596_10001772 JGI25153J46596_100017729 154
505 3300003322 rootL2_10072004 rootL2_100720043 154
506 3300003759 Ga0055525_1000119 Ga0055525_100011924 154
507 3300003762 Ga0055542_1000142 Ga0055542_100014224 154
508 3300003763 Ga0055529_1000167 Ga0055529_100016724 154
509 3300005327 Ga0070658_10000762 Ga0070658_1000076218 154
510 3300005328 Ga0070676_10074490 Ga0070676_100744904 154
511 3300005333 Ga0070677_10104838 Ga0070677_101048381 154
512 3300005339 Ga0070660_100270280 Ga0070660_1002702803 154
513 3300005344 Ga0070661_100002228 Ga0070661_10000222812 154
514 3300005344 Ga0070661_100178534 Ga0070661_1001785341 154
515 3300005347 Ga0070668_100070577 Ga0070668_1000705774 154
516 3300005354 Ga0070675_100059315 Ga0070675_1000593153 154
517 3300005355 Ga0070671_100302136 Ga0070671_1003021361 154
518 3300005356 Ga0070674_100001273 Ga0070674_10000127311 154
519 3300005356 Ga0070674_100013503 Ga0070674_1000135036 154
520 3300005364 Ga0070673_100473932 Ga0070673_1004739322 154
521 3300005366 Ga0070659_100260867 Ga0070659_1002608672 154
522 3300005366 Ga0070659_100296458 Ga0070659_1002964582 154
523 3300005367 Ga0070667_100020682 Ga0070667_1000206824 154
524 3300005455 Ga0070663_100025213 Ga0070663_1000252134 154
525 3300005456 Ga0070678_100000825 Ga0070678_10000082511 154
526 3300005456 Ga0070678_100283939 Ga0070678_1002839392 154
527 3300005457 Ga0070662_100021805 Ga0070662_1000218054 154
528 3300005539 Ga0068853_100471648 Ga0068853_1004716483 154
529 3300005543 Ga0070672_100145663 Ga0070672_1001456634 154
530 3300005548 Ga0070665_100127251 Ga0070665_1001272513 154
531 3300005563 Ga0068855_100183648 Ga0068855_1001836484 154
532 3300005564 Ga0070664_100125786 Ga0070664_1001257864 154
533 3300005577 Ga0068857_102129002 Ga0068857_1021290021 154
534 3300005577 Ga0068857_102190824 Ga0068857_1021908241 154
535 3300005834 Ga0068851_10001870 Ga0068851_1000187011 154
536 3300006237 Ga0097621_100237342 Ga0097621_1002373422 154
537 3300006358 Ga0068871_100043958 Ga0068871_1000439584 154
538 3300009148 Ga0105243_10000788 Ga0105243_1000078833 154
539 3300009176 Ga0105242_10048387 Ga0105242_100483873 154
540 3300009177 Ga0105248_12838216 Ga0105248_128382161 154
541 3300009545 Ga0105237_10071672 Ga0105237_100716723 154
542 3300009551 Ga0105238_10236127 Ga0105238_102361271 154
543 3300010375 Ga0105239_12585170 Ga0105239_125851701 154
544 3300013100 Ga0157373_10046534 Ga0157373_100465344 154
545 3300013102 Ga0157371_10000723 Ga0157371_1000072324 154
546 3300013104 Ga0157370_10371719 Ga0157370_103717191 154
547 3300013308 Ga0157375_10945763 Ga0157375_109457631 154
548 3300014969 Ga0157376_10780256 Ga0157376_107802562 154
549 3300017792 Ga0163161_10279041 Ga0163161_102790411 154
550 3300020070 Ga0206356_11374598 Ga0206356_113745981 154
551 3300025226 Ga0209674_108561 Ga0209674_1085612 154
552 3300025230 Ga0209563_100024 Ga0209563_100024454 154
553 3300025253 Ga0209677_106631 Ga0209677_1066314 154
554 3300025254 Ga0209148_1000008 Ga0209148_1000008412 154
555 3300025272 Ga0209455_1000002 Ga0209455_10000021010 154
556 3300025297 Ga0209758_1000007 Ga0209758_10000071004 154
557 3300025321 Ga0207656_10006071 Ga0207656_100060711 154
558 3300025893 Ga0207682_10205093 Ga0207682_102050933 154
559 3300025901 Ga0207688_10170310 Ga0207688_101703103 154
560 3300025904 Ga0207647_10018473 Ga0207647_100184738 154
561 3300025904 Ga0207647_10080138 Ga0207647_100801383 154
562 3300025907 Ga0207645_10094421 Ga0207645_100944214 154
563 3300025909 Ga0207705_10000913 Ga0207705_1000091312 154
564 3300025911 Ga0207654_10000892 Ga0207654_100008923 154
565 3300025913 Ga0207695_10011004 Ga0207695_100110044 154
566 3300025914 Ga0207671_10005082 Ga0207671_100050824 154
567 3300025919 Ga0207657_10001738 Ga0207657_1000173824 154
568 3300025920 Ga0207649_10000549 Ga0207649_1000054923 154
569 3300025920 Ga0207649_10036622 Ga0207649_100366224 154
570 3300025924 Ga0207694_10064476 Ga0207694_100644763 154
571 3300025926 Ga0207659_10122486 Ga0207659_101224863 154
572 3300025932 Ga0207690_10000599 Ga0207690_1000059923 154
573 3300025932 Ga0207690_10112060 Ga0207690_101120603 154
574 3300025932 Ga0207690_10979497 Ga0207690_109794971 154
575 3300025933 Ga0207706_10047501 Ga0207706_100475013 154
576 3300025935 Ga0207709_10000005 Ga0207709_10000005675 154
577 3300025937 Ga0207669_10000511 Ga0207669_100005118 154
578 3300025937 Ga0207669_10017719 Ga0207669_100177194 154
579 3300025940 Ga0207691_10134025 Ga0207691_101340252 154
580 3300025945 Ga0207679_10065964 Ga0207679_100659644 154
581 3300025949 Ga0207667_10002847 Ga0207667_1000284725 154
582 3300025949 Ga0207667_10264954 Ga0207667_102649543 154
583 3300025960 Ga0207651_10600101 Ga0207651_106001012 154
584 3300025972 Ga0207668_10301731 Ga0207668_103017312 154
585 3300025981 Ga0207640_10011920 Ga0207640_100119207 154
586 3300025986 Ga0207658_10073398 Ga0207658_100733982 154
587 3300026041 Ga0207639_10252575 Ga0207639_102525751 154
588 3300026089 Ga0207648_10103522 Ga0207648_101035223 154
589 3300026116 Ga0207674_10061897 Ga0207674_100618971 154
590 3300026116 Ga0207674_10819969 Ga0207674_108199693 154
591 3300026118 Ga0207675_100627698 Ga0207675_1006276983 154
592 3300026121 Ga0207683_10001955 Ga0207683_1000195511 154
593 3300026121 Ga0207683_10110814 Ga0207683_101108144 154
594 3300026142 Ga0207698_10052426 Ga0207698_100524261 154
595 3300026142 Ga0207698_10187092 Ga0207698_101870921 154
596 3300028786 Ga0307517_10009194 Ga0307517_1000919413 154
597 3300031456 Ga0307513_10062169 Ga0307513_100621695 154
598 3300033180 Ga0307510_10053187 Ga0307510_100531874 154
599 3300037312 Ga0395899_0102933 Ga0395899_0102933_1104_1568 154
600 3300038443 Ga0395901_0303108 Ga0395901_0303108_563_1027 154
601 3300046452 Ga0495617_042129 Ga0495617_042129_841_1305 154
602 3300046459 Ga0495629_0051588 Ga0495629_0051588_1579_2043 154
603 3300046460 Ga0495638_0147585 Ga0495638_0147585_802_1266 154
604 3300046471 Ga0495650_0001045 Ga0495650_0001045_2191_2655 154
605 3300046492 Ga0495585_0072321 Ga0495585_0072321_85_549 154
606 3300046492 Ga0495585_0339949 Ga0495585_0339949_218_682 154
607 3300046500 Ga0495596_0025486 Ga0495596_0025486_86_550 154
608 3300046501 Ga0495607_0320309 Ga0495607_0320309_239_703 154
609 3300046506 Ga0495583_0005970 Ga0495583_0005970_2404_2868 154
610 3300046506 Ga0495583_0007771 Ga0495583_0007771_5936_6400 154
611 3300046506 Ga0495583_0204017 Ga0495583_0204017_46_510 154
612 3300046507 Ga0495606_0001395 Ga0495606_0001395_12686_13150 154
613 3300046507 Ga0495606_0122793 Ga0495606_0122793_326_790 154
614 3300046518 Ga0495631_0133994 Ga0495631_0133994_566_1030 154
615 3300046522 Ga0495643_0001127 Ga0495643_0001127_2028_2492 154
616 3300046522 Ga0495643_0011061 Ga0495643_0011061_2937_3401 154
617 3300046522 Ga0495643_0043761 Ga0495643_0043761_1674_2138 154
618 3300046522 Ga0495643_0052045 Ga0495643_0052045_122_586 154
619 3300046524 Ga0495648_0001672 Ga0495648_0001672_14197_14661 154
620 3300046525 Ga0495663_0000928 Ga0495663_0000928_178_642 154
621 3300046528 Ga0495642_0028796 Ga0495642_0028796_1718_2182 154
622 3300046536 Ga0495587_0097008 Ga0495587_0097008_898_1362 154
623 3300046538 Ga0495609_0159391 Ga0495609_0159391_361_825 154
624 3300046557 Ga0495622_0001350 Ga0495622_0001350_8170_8634 154
625 3300046558 Ga0495633_0006697 Ga0495633_0006697_4525_4989 154
626 3300046558 Ga0495633_0037394 Ga0495633_0037394_14_478 154
627 3300046616 Ga0495668_0000059 Ga0495668_0000059_58748_59212 154
628 3300046648 Ga0495611_0014418 Ga0495611_0014418_1889_2353 154
629 3300046648 Ga0495611_0036980 Ga0495611_0036980_218_682 154
630 3300046660 Ga0495625_0000571 Ga0495625_0000571_47701_48165 154
631 3300046660 Ga0495625_0009235 Ga0495625_0009235_344_808 154
632 3300046660 Ga0495625_0017069 Ga0495625_0017069_2133_2597 154
633 3300046660 Ga0495625_0362036 Ga0495625_0362036_397_861 154
634 3300046665 Ga0495661_0201061 Ga0495661_0201061_48_512 154
635 3300046684 Ga0495669_0000058 Ga0495669_0000058_73269_73733 154
636 3300046689 Ga0495613_0100358 Ga0495613_0100358_961_1425 154
637 3300046691 Ga0495670_0176621 Ga0495670_0176621_317_781 154
638 3300046694 Ga0495649_0020517 Ga0495649_0020517_1051_1515 154
639 3300046809 Ga0495600_0001229 Ga0495600_0001229_11593_12057 154
640 3300047323 Ga0495683_0002532 Ga0495683_0002532_10278_10742 154
641 3300047323 Ga0495683_0030288 Ga0495683_0030288_1761_2225 154
642 3300047443 Ga0495687_000083 Ga0495687_000083_64673_65137 154
643 3300047443 Ga0495687_000152 Ga0495687_000152_3000_3464 154
644 3300047445 Ga0495677_0021314 Ga0495677_0021314_1672_2136 154
645 3300047445 Ga0495677_0045158 Ga0495677_0045158_253_717 154
646 3300047469 Ga0495673_0166121 Ga0495673_0166121_109_573 154
647 3300047470 Ga0495681_0008587 Ga0495681_0008587_3962_4426 154
648 3300047470 Ga0495681_0109876 Ga0495681_0109876_39_503 154
649 3300047472 Ga0495686_0000209 Ga0495686_0000209_77945_78421 154
650 3300048904 Ga0496101_0162955 Ga0496101_0162955_1235_1699 154
651 3300048905 Ga0496102_0006473 Ga0496102_0006473_2076_2540 154
652 3300048906 Ga0496103_0000099 Ga0496103_0000099_91370_91834 154
653 3300048907 Ga0496104_0184966 Ga0496104_0184966_1235_1699 154
654 3300048908 Ga0496105_0000502 Ga0496105_0000502_2108_2572 154
655 3300048912 Ga0496109_0579009 Ga0496109_0579009_424_888 154
656 3300048914 Ga0496111_0036294 Ga0496111_0036294_1153_1617 154
657 3300048917 Ga0496114_0011239 Ga0496114_0011239_4828_5292 154
658 3300048918 Ga0496115_0000066 Ga0496115_0000066_2168_2632 154
659 3300048919 Ga0496116_0039634 Ga0496116_0039634_852_1316 154
660 3300048920 Ga0496117_0000744 Ga0496117_0000744_48972_49436 154
661 3300048921 Ga0496118_0000852 Ga0496118_0000852_2052_2516 154
662 3300048922 Ga0496119_0029867 Ga0496119_0029867_3168_3632 154
663 3300048923 Ga0496120_0051158 Ga0496120_0051158_1868_2332 154
664 3300048924 Ga0496121_0000417 Ga0496121_0000417_1975_2439 154
665 3300048925 Ga0496122_0009816 Ga0496122_0009816_1878_2342 154
666 3300048926 Ga0496123_0011327 Ga0496123_0011327_5376_5840 154
667 3300048927 Ga0496124_0000291 Ga0496124_0000291_1966_2430 154
668 3300048928 Ga0496125_0000687 Ga0496125_0000687_53887_54351 154
669 3300048929 Ga0496126_0001921 Ga0496126_0001921_2123_2587 154
670 3300049460 Ga0495682_0039516 Ga0495682_0039516_1153_1617 154
671 3300053079 Ga0500610_0000029 Ga0500610_0000029_47685_48149 154
672 3300053087 Ga0500643_142645 Ga0500643_142645_24_488 154
673 3300053091 Ga0500647_0033566 Ga0500647_0033566_961_1425 154
674 3300053092 Ga0500583_0019875 Ga0500583_0019875_333_797 154
675 3300053119 Ga0500595_009699 Ga0500595_009699_2279_2743 154
676 3300053130 Ga0500642_0002483 Ga0500642_0002483_382_846 154
677 3300053154 Ga0500619_006273 Ga0500619_006273_2145_2609 154
678 3300053177 Ga0500636_0020266 Ga0500636_0020266_1186_1650 154
679 3300053730 Ga0500645_000019 Ga0500645_000019_80046_80510 154
680 3300053735 Ga0500596_009933 Ga0500596_009933_219_683 154

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22811

NrdR-like_N

Transcriptional repressor NrdR-like, N-terminal domain

1

38

0.99

PF03477

ATP-cone

ATP cone domain

45

133

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1v59-assembly1.cif.gz_A crystal structure of yeast lipoamide dehydrogenase complexed with nad+ 0.8575 11 41
2xls-assembly1.cif.gz_A joint-functions of protein residues and nadp(h) in oxygen-activation by flavin-containing monooxygenase: asn78lys mutant 0.8538 11 41
2xlp-assembly2.cif.gz_B joint-functions of protein residues and nadp(h) in oxygen-activation by flavin-containing monooxygenase: asn78ser mutant 0.8498 11 41
2vq7-assembly2.cif.gz_C bacterial flavin-containing monooxygenase in complex with nadp: native data 0.8465 11 41
3er0-assembly1.cif.gz_A crystal structure of the full length eif5a from saccharomyces cerevisiae 0.8132 11 43
ID Description Score Start End Superfamily
af_P0A8D0_49_137_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9708 50 136 1.10.10.10
af_Q2FXP3_49_137_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9656 49 137 1.10.10.10
af_Q2FXP3_49_137_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9552 49 137 1.10.10.10
af_P0A8D0_49_137_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9391 50 136 1.10.10.10
af_P9WQM1_268_326_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9282 11 44 2.40.50.140
ID Description Score Start End GO Terms
AF-U5NAA6-F1-model_v4 Transcriptional repressor NrdR 0.981 51 147 GO:0003677
GO:0005524
GO:0008270
GO:0045892
AF-A0A1G8CD96-F1-model_v4 Transcriptional repressor NrdR 0.9735 49 149 GO:0003677
GO:0005524
GO:0008270
GO:0045892
AF-K1ZQN8-F1-model_v4 Transcriptional repressor NrdR 0.9671 52 147 GO:0003677
GO:0005524
GO:0008270
GO:0045892
AF-A0A135PDK6-F1-model_v4 deleted 0.9662 48 149
AF-A0A3M1DEJ3-F1-model_v4 Transcriptional repressor NrdR 0.9623 45 149 GO:0005524
GO:0008270
GO:0045892

Feature Viewer

pLDDT pTM Quality
85.77 0.64 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map