F474782

General Info

Members Datasets Scaffolds Average Seq Length
680 461 530 327

Family's Representative Sequence

Representative Sequence 3300025927|Ga0207687_10097858|Ga0207687_100978581
Length 329
Sequence MKGLPVIGALGAGRMGRGIAQVFAYAGHDVHLIDAKQRSPAARSKLEFEALAEIDSTLAMLSGLGAFDDAQRPHIMRRIHFADRAEADAALRACDVVFEGVPEVLDAKREALAFACEHMREEAILASTTSTILVTQLAGLVTYAERFLNAHWLNPAYIVPLVELSPHPGTNAAVLSHLKMLLEAIGKVPVVCAPAPGFIVPRLQALVMAEAARMIQDGVATAEDIDKATRYGFGFRFAAIGVVEFIDYGGNDILYYACRHLARELGERYHAPAIVDRLMQEGHVGLKTKRGFYDYAQVDIPAYRRDVISRALGLLRHHGLLVPPGNSNL

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
5 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
6 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
7 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
8 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
9 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
10 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
11 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
12 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
13 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
14 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
15 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
16 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
17 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
18 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
19 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
20 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
21 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
22 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
23 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
24 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
25 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
26 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
27 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
28 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
29 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
30 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
31 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
32 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
33 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
34 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
35 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
36 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
37 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
38 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
39 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
40 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
41 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
42 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
43 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
44 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
45 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
46 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
47 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
48 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
49 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
50 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
51 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
52 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
53 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
54 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
55 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
56 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
57 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
58 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
59 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
60 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
61 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
62 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
63 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
64 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
65 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
66 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
67 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
68 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
69 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
70 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
71 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
72 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
73 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
74 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
75 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
76 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
77 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
78 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
79 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
80 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
81 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
82 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
83 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
84 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
85 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
86 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
87 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
88 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
89 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
90 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
91 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
92 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
93 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
94 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
95 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
96 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
97 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
98 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
99 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
100 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
101 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
102 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
103 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
104 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
105 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
106 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
107 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
108 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
109 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
110 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
111 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
112 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
113 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
114 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
115 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
116 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
117 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
118 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
119 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
120 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
121 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
122 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
123 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
124 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
125 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
126 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
127 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
128 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
129 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
130 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
131 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
132 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
133 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
134 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
135 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
136 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
137 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
138 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
139 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
140 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
141 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
142 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
143 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
144 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
145 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
146 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
147 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
148 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
149 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
150 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
151 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
152 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
153 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
154 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
155 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
156 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
157 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
158 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
159 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
160 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
161 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
162 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
163 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
164 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
165 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
166 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
167 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
168 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
169 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
170 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
171 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
172 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
173 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
174 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
175 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
176 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
177 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
178 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
179 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
180 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
181 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
182 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
183 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
184 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
185 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
186 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
187 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
188 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
189 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
190 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
191 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
192 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
193 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
194 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
195 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
196 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
197 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
198 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
199 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
200 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
201 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
202 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
203 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
204 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
241 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
242 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
243 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
245 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
246 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
247 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
248 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
249 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
250 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
251 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
252 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
253 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
254 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
255 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
256 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
257 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
258 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
259 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
260 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
261 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
262 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
263 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
264 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
265 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
266 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
267 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
268 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
269 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
270 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
271 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
272 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
273 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
274 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
275 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
276 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
277 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
278 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
279 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
280 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
281 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
282 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
283 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
284 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
285 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
286 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
287 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
288 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
289 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
290 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
291 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
292 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
293 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
294 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
295 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
296 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
297 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
298 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
299 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
300 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
301 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
302 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
303 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
304 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
305 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
306 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
307 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
308 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
309 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
310 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
311 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
312 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
313 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
314 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
315 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
316 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
317 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
318 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
319 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
320 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
321 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
322 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
323 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
324 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
325 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
326 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
327 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
328 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
329 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
330 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
331 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
332 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
333 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
334 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
335 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
336 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
337 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
338 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
339 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
340 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
341 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
342 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
343 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
344 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
345 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
346 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
347 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
348 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
349 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
350 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
351 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
352 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
353 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
354 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
355 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
356 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
357 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
358 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
359 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
360 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
361 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
362 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
363 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
364 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
365 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
366 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
367 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
368 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
369 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
370 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
371 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
372 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
373 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
374 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
375 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
376 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
377 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
378 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
379 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
380 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
381 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
382 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
383 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
384 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
385 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
386 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
387 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
388 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
389 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
390 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
391 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
392 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
393 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
394 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
395 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
396 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
397 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
398 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
399 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
400 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
401 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
402 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
403 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
404 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
405 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
406 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
407 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
408 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
409 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
410 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
411 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
412 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
413 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
414 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
415 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
416 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
417 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
418 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
419 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
420 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
421 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
422 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
423 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
424 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
425 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
426 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
427 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
428 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
429 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
430 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
431 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
432 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
433 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
434 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
435 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
436 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
437 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
438 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
439 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
440 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
441 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
442 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
443 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
444 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
445 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
446 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
447 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
448 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
449 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
450 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
451 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
452 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
453 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
454 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
455 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
456 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
457 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
458 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
459 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere
460 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
461 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 77.61
Metatranscriptomes 0.44
Isolates 21.94

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.59
Nodule 16.62
Rhizoplane 4.56
Rhizosphere 49.71
Stem 0
Stem Tuber 0
Unclassified 13.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10000161 3300003215 Bacteria 67388
2 JGI25153J46596_10000354 3300003215 Bacteria 31788
3 JGI25160J50197_1001256 3300003354 Bacteria 12850
4 JGI25160J50197_1002809 3300003354 Bacteria 7972
5 Ga0055524_1023787 3300003775 Bacteria 1964
6 Ga0055531_10013705 3300003794 Bacteria 3716
7 Ga0065165_1000244 3300005262 Bacteria 93411
8 Ga0065165_1000368 3300005262 Bacteria 73904
9 Ga0065165_1008246 3300005262 Bacteria 4924
10 Ga0065165_1009309 3300005262 Bacteria 4422
11 Ga0070658_10003236 3300005327 Bacteria 13450
12 Ga0070658_10010916 3300005327 Bacteria 7281
13 Ga0070680_100010261 3300005336 Bacteria 7219
14 Ga0070680_100320974 3300005336 Bacteria 1315
15 Ga0068868_100132456 3300005338 Bacteria 2041
16 Ga0070660_100035699 3300005339 Bacteria 3763
17 Ga0070674_100195910 3300005356 Bacteria 1557
18 Ga0070659_100011570 3300005366 Bacteria 6531
19 Ga0070709_10001919 3300005434 Bacteria 11298
20 Ga0070709_10003278 3300005434 Bacteria 8702
21 Ga0070714_100174978 3300005435 Bacteria 1950
22 Ga0070713_100037231 3300005436 Bacteria 3933
23 Ga0070710_10000965 3300005437 Bacteria 13640
24 Ga0070710_10010432 3300005437 Bacteria 4564
25 Ga0070711_100026368 3300005439 Bacteria 3808
26 Ga0070663_100027527 3300005455 Bacteria 3862
27 Ga0070663_100044284 3300005455 Bacteria 3136
28 Ga0070663_100201757 3300005455 Bacteria 1553
29 Ga0070662_100185209 3300005457 Bacteria 1643
30 Ga0070681_10021162 3300005458 Bacteria 6517
31 Ga0070698_100036085 3300005471 Bacteria 5110
32 Ga0070698_100406963 3300005471 Bacteria 1294
33 Ga0070679_100067219 3300005530 Bacteria 3574
34 Ga0070679_100428715 3300005530 Bacteria 1267
35 Ga0070665_100020007 3300005548 Bacteria 6721
36 Ga0070665_100118650 3300005548 Bacteria 2648
37 Ga0068855_100026681 3300005563 Bacteria 6911
38 Ga0068855_100062155 3300005563 Bacteria 4361
39 Ga0068855_100097901 3300005563 Bacteria 3379
40 Ga0068855_100378096 3300005563 Bacteria 1556
41 Ga0068854_100104390 3300005578 Bacteria 2129
42 Ga0068854_100310020 3300005578 Bacteria 1280
43 Ga0068856_100033270 3300005614 Bacteria 5047
44 Ga0068856_100120925 3300005614 Bacteria 2620
45 Ga0068856_100274604 3300005614 Bacteria 1702
46 Ga0068856_100287558 3300005614 Bacteria 1661
47 Ga0068852_100001503 3300005616 Bacteria 15782
48 Ga0068852_100008740 3300005616 Bacteria 7488
49 Ga0068852_100091652 3300005616 Bacteria 2720
50 Ga0068859_100473627 3300005617 Bacteria 1348
51 Ga0068863_100056464 3300005841 Bacteria 3717
52 Ga0068863_100056875 3300005841 Bacteria 3703
53 Ga0068863_100112064 3300005841 Bacteria 2598
54 Ga0068858_100048822 3300005842 Bacteria 3920
55 Ga0068858_100362146 3300005842 Bacteria 1390
56 Ga0068858_100412551 3300005842 Bacteria 1298
57 Ga0068860_100000302 3300005843 Bacteria 68581
58 Ga0068860_100315016 3300005843 Bacteria 1535
59 Ga0081540_1024661 3300005983 Bacteria 3484
60 Ga0075365_10033031 3300006038 Bacteria 3332
61 Ga0075365_10064949 3300006038 Bacteria 2446
62 Ga0075368_10000322 3300006042 Bacteria 14006
63 Ga0070716_100044926 3300006173 Bacteria 2477
64 Ga0070712_100003519 3300006175 Bacteria 9636
65 Ga0070712_100093869 3300006175 Bacteria 2203
66 Ga0075367_10004226 3300006178 Bacteria 6973
67 Ga0075367_10048505 3300006178 Bacteria 2502
68 Ga0075369_10021636 3300006186 Bacteria 2645
69 Ga0075366_10002088 3300006195 Bacteria 10148
70 Ga0075370_10003222 3300006353 Bacteria 7724
71 Ga0075370_10035300 3300006353 Bacteria 2806
72 Ga0097620_100473652 3300006931 Bacteria 1348
73 Ga0099824_1033450 3300006942 Bacteria 1739
74 Ga0099794_10079129 3300007265 Bacteria 1619
75 Ga0099795_10037287 3300007788 Bacteria 1710
76 Ga0099795_10043594 3300007788 Bacteria 1606
77 Ga0105240_10008478 3300009093 Bacteria 14699
78 Ga0105240_10022848 3300009093 Bacteria 8285
79 Ga0105245_10029654 3300009098 Bacteria 4836
80 Ga0105247_10039539 3300009101 Bacteria 2881
81 Ga0105247_10067229 3300009101 Bacteria 2232
82 Ga0105241_10020161 3300009174 Bacteria 4925
83 Ga0105241_10024560 3300009174 Bacteria 4475
84 Ga0105241_10069727 3300009174 Bacteria 2726
85 Ga0105248_10105236 3300009177 Bacteria 3181
86 Ga0105237_10000892 3300009545 Bacteria 40254
87 Ga0105237_10007390 3300009545 Bacteria 12032
88 Ga0105237_10174254 3300009545 Bacteria 2151
89 Ga0105238_10081124 3300009551 Bacteria 3233
90 Ga0099796_10019942 3300010159 Bacteria 2041
91 Ga0105239_10007059 3300010375 Bacteria 12929
92 Ga0105239_10010770 3300010375 Bacteria 10216
93 Ga0105239_10052803 3300010375 Bacteria 4458
94 Ga0105239_10076576 3300010375 Bacteria 3679
95 Ga0105239_10095032 3300010375 Bacteria 3293
96 Ga0105239_10128843 3300010375 Bacteria 2813
97 Ga0105239_10379505 3300010375 Bacteria 1598
98 Ga0105246_10003773 3300011119 Bacteria 9185
99 Ga0105246_10115871 3300011119 Bacteria 1977
100 Ga0105246_10261077 3300011119 Unclassified 1380
101 Ga0157373_10149035 3300013100 Bacteria 1646
102 Ga0157371_10265631 3300013102 Bacteria 1238
103 Ga0157369_10042862 3300013105 Bacteria 4935
104 Ga0157369_10129388 3300013105 Bacteria 2676
105 Ga0157374_10013038 3300013296 Bacteria 7248
106 Ga0157374_10021625 3300013296 Bacteria 5728
107 Ga0157378_10152383 3300013297 Bacteria 2155
108 Ga0163162_10322055 3300013306 Bacteria 1678
109 Ga0163162_10368787 3300013306 Bacteria 1569
110 Ga0163162_10427355 3300013306 Bacteria 1457
111 Ga0157375_10021276 3300013308 Bacteria 5943
112 Ga0163163_10005130 3300014325 Bacteria 11291
113 Ga0157379_10230179 3300014968 Bacteria 1680
114 Ga0206356_11403519 3300020070 Bacteria 1791
115 Ga0206353_10436796 3300020082 Bacteria 2231
116 Ga0214545_1000028 3300021324 Bacteria 127957
117 Ga0214543_1000044 3300021327 Bacteria 158132
118 Ga0209563_101020 3300025230 Bacteria 8156
119 Ga0207425_1002884 3300025245 Bacteria 5777
120 Ga0209677_106052 3300025253 Bacteria 2980
121 Ga0209148_1000224 3300025254 Bacteria 92967
122 Ga0209233_1003000 3300025261 Bacteria 6013
123 Ga0209233_1004722 3300025261 Bacteria 4592
124 Ga0209233_1012100 3300025261 Bacteria 2514
125 Ga0209455_1000635 3300025272 Bacteria 21604
126 Ga0209455_1005926 3300025272 Bacteria 3685
127 Ga0209564_1002670 3300025295 Bacteria 13535
128 Ga0209564_1007718 3300025295 Bacteria 5478
129 Ga0209758_1000075 3300025297 Bacteria 271585
130 Ga0209758_1000087 3300025297 Bacteria 254384
131 Ga0209758_1001472 3300025297 Bacteria 27590
132 Ga0209758_1003696 3300025297 Bacteria 13586
133 Ga0209758_1006857 3300025297 Bacteria 7967
134 Ga0209758_1019189 3300025297 Bacteria 3311
135 Ga0209256_1009007 3300025299 Bacteria 4472
136 Ga0207426_1000160 3300025302 Bacteria 174540
137 Ga0207426_1000289 3300025302 Bacteria 99963
138 Ga0207426_1006711 3300025302 Bacteria 4937
139 Ga0207426_1025821 3300025302 Bacteria 1974
140 Ga0209257_1000382 3300025304 Bacteria 88368
141 Ga0209257_1010148 3300025304 Bacteria 4850
142 Ga0207692_10004122 3300025898 Bacteria 5734
143 Ga0207647_10006477 3300025904 Bacteria 8509
144 Ga0207699_10000561 3300025906 Bacteria 18332
145 Ga0207705_10031006 3300025909 Bacteria 3815
146 Ga0207705_10135283 3300025909 Bacteria 1837
147 Ga0207654_10049575 3300025911 Bacteria 2409
148 Ga0207695_10000029 3300025913 Bacteria 548364
149 Ga0207671_10005341 3300025914 Bacteria 11889
150 Ga0207671_10030419 3300025914 Bacteria 4027
151 Ga0207693_10003010 3300025915 Bacteria 14576
152 Ga0207693_10115668 3300025915 Bacteria 2106
153 Ga0207693_10181939 3300025915 Bacteria 1654
154 Ga0207693_10321853 3300025915 Bacteria 1210
155 Ga0207663_10034229 3300025916 Bacteria 3035
156 Ga0207663_10242542 3300025916 Bacteria 1322
157 Ga0207660_10220263 3300025917 Bacteria 1489
158 Ga0207657_10021590 3300025919 Bacteria 6053
159 Ga0207657_10051757 3300025919 Bacteria 3569
160 Ga0207694_10032091 3300025924 Bacteria 4018
161 Ga0207694_10118890 3300025924 Bacteria 2109
162 Ga0207650_10133886 3300025925 Bacteria 1942
163 Ga0207687_10097858 3300025927 Bacteria 2153
164 Ga0207700_10136870 3300025928 Bacteria 2007
165 Ga0207664_10190589 3300025929 Bacteria 1765
166 Ga0207644_10082189 3300025931 Bacteria 2382
167 Ga0207690_10271961 3300025932 Bacteria 1316
168 Ga0207706_10085276 3300025933 Bacteria 2777
169 Ga0207665_10050600 3300025939 Bacteria 2794
170 Ga0207665_10240123 3300025939 Bacteria 1335
171 Ga0207711_10032173 3300025941 Bacteria 4434
172 Ga0207661_10109003 3300025944 Bacteria 2339
173 Ga0207667_10085017 3300025949 Bacteria 3275
174 Ga0207667_10487137 3300025949 Bacteria 1251
175 Ga0207668_10136606 3300025972 Bacteria 1879
176 Ga0207640_10036570 3300025981 Bacteria 3084
177 Ga0207640_10400497 3300025981 Bacteria 1118
178 Ga0207658_10024166 3300025986 Bacteria 4249
179 Ga0207677_10038119 3300026023 Bacteria 3148
180 Ga0207703_10368767 3300026035 Bacteria 1326
181 Ga0207639_10526952 3300026041 Bacteria 1082
182 Ga0207678_10030711 3300026067 Bacteria 4691
183 Ga0207678_10043585 3300026067 Bacteria 3882
184 Ga0207678_10064794 3300026067 Bacteria 3140
185 Ga0207702_10001454 3300026078 Bacteria 23549
186 Ga0207702_10028517 3300026078 Bacteria 4641
187 Ga0207702_10057390 3300026078 Bacteria 3308
188 Ga0207702_10350173 3300026078 Bacteria 1413
189 Ga0207641_10024136 3300026088 Bacteria 5012
190 Ga0207648_10113957 3300026089 Bacteria 2375
191 Ga0207675_100084324 3300026118 Bacteria 2981
192 Ga0207675_100183563 3300026118 Bacteria 2004
193 Ga0207683_10464040 3300026121 Bacteria 1168
194 Ga0207698_10025095 3300026142 Bacteria 4193
195 Ga0207698_10045053 3300026142 Bacteria 3320
196 Ga0207698_10147244 3300026142 Bacteria 2038
197 Ga0207698_10258035 3300026142 Bacteria 1599
198 Ga0209389_1000137 3300027296 Bacteria 63287
199 Ga0209389_1000353 3300027296 Bacteria 27634
200 Ga0209589_1003439 3300027357 Bacteria 27634
201 Ga0209489_100192 3300027361 Bacteria 98028
202 Ga0209489_107326 3300027361 Bacteria 16591
203 Ga0268264_10000020 3300028381 Bacteria 483593
204 Ga0265337_1001859 3300028556 Bacteria 10076
205 Ga0265326_10005016 3300028558 Bacteria 4192
206 Ga0265319_1002640 3300028563 Bacteria 9640
207 Ga0265334_10000410 3300028573 Bacteria 22501
208 Ga0265318_10005488 3300028577 Bacteria 5951
209 Ga0265323_10000658 3300028653 Bacteria 18872
210 Ga0265322_10006993 3300028654 Bacteria 3308
211 Ga0265336_10000063 3300028666 Bacteria 98413
212 Ga0265338_10000154 3300028800 Bacteria 125708
213 Ga0265324_10002963 3300029957 Bacteria 8307
214 Ga0307511_10089184 3300030521 Bacteria 2103
215 Ga0265330_10054307 3300031235 Bacteria 1751
216 Ga0265332_10007749 3300031238 Bacteria 4850
217 Ga0265325_10020842 3300031241 Bacteria 3608
218 Ga0265331_10117920 3300031250 Bacteria 1214
219 Ga0307508_10000025 3300031616 Bacteria 174642
220 Ga0265314_10005071 3300031711 Bacteria 12001
221 Ga0265314_10030262 3300031711 Bacteria 4009
222 Ga0265342_10000638 3300031712 Bacteria 36736
223 Ga0307516_10097063 3300031730 Bacteria 2767
224 Ga0307516_10111412 3300031730 Bacteria 2538
225 Ga0307507_10092444 3300033179 Bacteria 2582
226 Ga0307510_10024769 3300033180 Bacteria 6930
227 Ga0307510_10044327 3300033180 Bacteria 4819
228 Ga0307510_10094433 3300033180 Bacteria 2816
229 Ga0316215_1006327 3300033544 Bacteria 1148
230 Ga0373953_0029074 3300035117 Bacteria 2135
231 Ga0373956_0012440 3300035119 Bacteria 3528
232 Ga0373956_0082558 3300035119 Bacteria 1476
233 Ga0373943_0002145 3300035170 Bacteria 8968
234 Ga0373946_0001257 3300035171 Bacteria 8767
235 Ga0373955_0002673 3300035172 Bacteria 7800
236 Ga0373924_0005844 3300035410 Bacteria 4381
237 Ga0373931_0007479 3300035691 Bacteria 5144
238 Ga0373935_0000494 3300035692 Bacteria 20439
239 Ga0373927_0002352 3300035695 Bacteria 13783
240 Ga0373927_0003230 3300035695 Bacteria 11734
241 Ga0373927_0024311 3300035695 Bacteria 3964
242 Ga0373947_0002117 3300035725 Bacteria 12102
243 Ga0373947_0055656 3300035725 Bacteria 2389
244 Ga0373937_0184864 3300036401 Bacteria 1957
245 Ga0372808_010345 3300036459 Bacteria 1312
246 Ga0373925_0007140 3300037068 Bacteria 8162
247 Ga0373925_0114334 3300037068 Bacteria 2088
248 Ga0395899_0311363 3300037312 Bacteria 1063
249 Ga0395900_0000943 3300037418 Bacteria 37925
250 Ga0395898_0002974 3300037466 Bacteria 19263
251 Ga0395898_0046280 3300037466 Bacteria 4273
252 Ga0395905_0021852 3300037471 Bacteria 6052
253 Ga0395905_0062455 3300037471 Bacteria 3485
254 Ga0395905_0088532 3300037471 Bacteria 2902
255 Ga0436364_1007205 3300037853 Bacteria 1674
256 Ga0395901_0001973 3300038443 Bacteria 21111
257 Ga0400483_139608 3300039062 Bacteria 5764
258 Ga0400483_185274 3300039062 Bacteria 4901
259 Ga0436365_0556026 3300039437 Bacteria 1330
260 Ga0466972_0016158 3300044658 Bacteria 3730
261 Ga0466972_0025155 3300044658 Bacteria 2953
262 Ga0466972_0026707 3300044658 Bacteria 2860
263 Ga0466965_0129236 3300044683 Bacteria 1309
264 Ga0466966_0034958 3300044684 Bacteria 3248
265 Ga0466961_0000029 3300044693 Bacteria 86710
266 Ga0466963_0033929 3300044694 Bacteria 3318
267 Ga0466963_0049448 3300044694 Bacteria 2781
268 Ga0466964_0012459 3300044706 Bacteria 3217
269 Ga0466968_0032351 3300044735 Bacteria 2175
270 Ga0466957_0014169 3300044842 Bacteria 4639
271 Ga0466957_0026990 3300044842 Bacteria 3410
272 Ga0466960_0091707 3300044901 Bacteria 1550
273 Ga0466959_0000533 3300045049 Bacteria 22053
274 Ga0466959_0035145 3300045049 Bacteria 3708
275 Ga0466959_0228406 3300045049 Bacteria 1289
276 Ga0466958_0024101 3300045836 Bacteria 3578
277 Ga0466958_0310358 3300045836 Bacteria 1013
278 Ga0466967_0002064 3300045976 Bacteria 12276
279 Ga0495603_0000237 3300046455 Bacteria 28782
280 Ga0495603_0004991 3300046455 Bacteria 7942
281 Ga0495603_0023749 3300046455 Bacteria 3709
282 Ga0495629_0000772 3300046459 Bacteria 25859
283 Ga0495638_0006370 3300046460 Bacteria 8597
284 Ga0495638_0022968 3300046460 Bacteria 4086
285 Ga0495641_0004443 3300046461 Bacteria 9917
286 Ga0495651_0081569 3300046462 Bacteria 2441
287 Ga0495580_0001324 3300046472 Bacteria 21841
288 Ga0495582_0000209 3300046473 Bacteria 32511
289 Ga0495639_0000387 3300046475 Bacteria 20931
290 Ga0495664_0017088 3300046477 Bacteria 4144
291 Ga0495664_0019150 3300046477 Bacteria 3932
292 Ga0495664_0116664 3300046477 Bacteria 1614
293 Ga0495584_0170921 3300046491 Bacteria 1105
294 Ga0495594_0000342 3300046499 Bacteria 23227
295 Ga0495606_0047231 3300046507 Bacteria 2839
296 Ga0495606_0050544 3300046507 Bacteria 2719
297 Ga0495606_0156710 3300046507 Bacteria 1332
298 Ga0495608_0032019 3300046511 Bacteria 3554
299 Ga0495608_0046562 3300046511 Bacteria 2886
300 Ga0495618_0134916 3300046514 Bacteria 1579
301 Ga0495628_0064005 3300046516 Bacteria 2880
302 Ga0495631_0059022 3300046518 Bacteria 1668
303 Ga0495643_0010018 3300046522 Bacteria 5850
304 Ga0495648_0046159 3300046524 Bacteria 2703
305 Ga0495652_0079703 3300046529 Bacteria 2706
306 Ga0495665_0000280 3300046531 Bacteria 25894
307 Ga0495640_0001578 3300046533 Bacteria 17975
308 Ga0495587_0059147 3300046536 Bacteria 2250
309 Ga0495645_0042873 3300046543 Bacteria 3300
310 Ga0495645_0305447 3300046543 Bacteria 1038
311 Ga0495622_0004227 3300046557 Bacteria 6694
312 Ga0495622_0004573 3300046557 Bacteria 6407
313 Ga0495667_0042094 3300046559 Bacteria 3028
314 Ga0495634_0000865 3300046642 Bacteria 29129
315 Ga0495634_0135607 3300046642 Bacteria 1566
316 Ga0495625_0066671 3300046660 Bacteria 2535
317 Ga0495635_0003213 3300046663 Bacteria 11263
318 Ga0495635_0017357 3300046663 Bacteria 5028
319 Ga0495661_0023616 3300046665 Bacteria 3988
320 Ga0495588_0030385 3300046674 Bacteria 2715
321 Ga0495588_0123030 3300046674 Bacteria 1368
322 Ga0495588_0138150 3300046674 Bacteria 1287
323 Ga0495657_0011035 3300046675 Bacteria 6774
324 Ga0495657_0029981 3300046675 Bacteria 3812
325 Ga0495658_0004391 3300046683 Bacteria 6944
326 Ga0495613_0003086 3300046689 Bacteria 12448
327 Ga0495613_0280465 3300046689 Bacteria 1157
328 Ga0495624_0001082 3300046690 Bacteria 21523
329 Ga0495670_0032726 3300046691 Bacteria 2586
330 Ga0495671_0023365 3300046692 Bacteria 3230
331 Ga0495581_0022904 3300047315 Bacteria 3618
332 Ga0495581_0035677 3300047315 Bacteria 2877
333 Ga0495604_0016851 3300047317 Bacteria 5844
334 Ga0495674_0004372 3300047319 Bacteria 13583
335 Ga0495674_0024884 3300047319 Bacteria 5496
336 Ga0495672_0111865 3300047320 Bacteria 1464
337 Ga0495676_0009743 3300047321 Bacteria 8733
338 Ga0495676_0179397 3300047321 Bacteria 1485
339 Ga0495680_0106242 3300047322 Bacteria 2086
340 Ga0495683_0007012 3300047323 Bacteria 6119
341 Ga0495687_011591 3300047443 Bacteria 4727
342 Ga0495675_0106351 3300047444 Bacteria 1753
343 Ga0495684_0005777 3300047471 Bacteria 9626
344 Ga0495686_0052830 3300047472 Bacteria 2547
345 Ga0495686_0066199 3300047472 Bacteria 2233
346 Ga0495686_0100399 3300047472 Bacteria 1746
347 Ga0495593_0000238 3300047673 Bacteria 29664
348 Ga0495593_0018220 3300047673 Bacteria 3948
349 Ga0495593_0140641 3300047673 Bacteria 1223
350 Ga0495602_0121244 3300048088 Bacteria 2103
351 Ga0495614_0027859 3300048089 Bacteria 2436
352 Ga0496101_0018685 3300048904 Bacteria 4717
353 Ga0496101_0125245 3300048904 Bacteria 1947
354 Ga0496101_0253962 3300048904 Bacteria 1370
355 Ga0496102_0001874 3300048905 Bacteria 18120
356 Ga0496102_0408515 3300048905 Bacteria 1276
357 Ga0496102_0466857 3300048905 Bacteria 1183
358 Ga0496103_0002168 3300048906 Bacteria 12474
359 Ga0496103_0117414 3300048906 Bacteria 1693
360 Ga0496104_0004135 3300048907 Bacteria 12598
361 Ga0496104_0019755 3300048907 Bacteria 6168
362 Ga0496104_0022321 3300048907 Bacteria 5813
363 Ga0496105_0006240 3300048908 Bacteria 9152
364 Ga0496105_0123905 3300048908 Bacteria 2130
365 Ga0496106_0008194 3300048909 Bacteria 7724
366 Ga0496106_0058907 3300048909 Bacteria 2909
367 Ga0496107_0068287 3300048910 Bacteria 2580
368 Ga0496108_0123258 3300048911 Bacteria 2224
369 Ga0496109_0070568 3300048912 Bacteria 3206
370 Ga0496109_0511656 3300048912 Bacteria 1133
371 Ga0496110_0021529 3300048913 Bacteria 5462
372 Ga0496110_0053113 3300048913 Bacteria 3561
373 Ga0496111_0076159 3300048914 Bacteria 2445
374 Ga0496112_0006808 3300048915 Bacteria 10073
375 Ga0496112_0029058 3300048915 Bacteria 5344
376 Ga0496112_0043753 3300048915 Bacteria 4385
377 Ga0496112_0169163 3300048915 Bacteria 2151
378 Ga0496113_0211644 3300048916 Bacteria 1543
379 Ga0496115_0007927 3300048918 Bacteria 7835
380 Ga0496115_0031944 3300048918 Bacteria 4151
381 Ga0496115_0041576 3300048918 Bacteria 3659
382 Ga0496115_0071326 3300048918 Bacteria 2817
383 Ga0496116_0037607 3300048919 Bacteria 3373
384 Ga0496116_0110232 3300048919 Bacteria 1620
385 Ga0496117_0064917 3300048920 Bacteria 2485
386 Ga0496117_0066703 3300048920 Bacteria 2439
387 Ga0496117_0083776 3300048920 Bacteria 2083
388 Ga0496117_0124629 3300048920 Bacteria 1575
389 Ga0496117_0135207 3300048920 Bacteria 1486
390 Ga0496118_0012281 3300048921 Bacteria 8243
391 Ga0496118_0050582 3300048921 Bacteria 3187
392 Ga0496118_0088336 3300048921 Bacteria 2144
393 Ga0496118_0198990 3300048921 Bacteria 1189
394 Ga0496119_0014153 3300048922 Bacteria 6267
395 Ga0496119_0226181 3300048922 Bacteria 955
396 Ga0496120_0019887 3300048923 Bacteria 4282
397 Ga0496120_0152667 3300048923 Bacteria 1159
398 Ga0496121_0006808 3300048924 Bacteria 14001
399 Ga0496121_0028079 3300048924 Bacteria 5247
400 Ga0496121_0057700 3300048924 Bacteria 3215
401 Ga0496121_0099694 3300048924 Bacteria 2244
402 Ga0496121_0207651 3300048924 Bacteria 1390
403 Ga0496122_0106238 3300048925 Bacteria 1859
404 Ga0496122_0130188 3300048925 Bacteria 1601
405 Ga0496123_0050611 3300048926 Bacteria 2774
406 Ga0496124_0021977 3300048927 Bacteria 5866
407 Ga0496124_0114609 3300048927 Bacteria 2164
408 Ga0496124_0243128 3300048927 Bacteria 1337
409 Ga0496125_0001999 3300048928 Bacteria 27642
410 Ga0496125_0040960 3300048928 Bacteria 3966
411 Ga0496125_0062019 3300048928 Bacteria 2993
412 Ga0496125_0075096 3300048928 Bacteria 2617
413 Ga0496125_0103437 3300048928 Bacteria 2090
414 Ga0496125_0230291 3300048928 Bacteria 1185
415 Ga0496126_0036078 3300048929 Bacteria 4627
416 Ga0496126_0042281 3300048929 Bacteria 4209
417 Ga0496126_0192430 3300048929 Bacteria 1727
418 Ga0496126_0251548 3300048929 Bacteria 1472
419 Ga0496126_0322864 3300048929 Bacteria 1268
420 Ga0501031_0002641 3300049568 Bacteria 11413
421 Ga0501031_0106017 3300049568 Bacteria 1834
422 Ga0501032_0002207 3300049569 Bacteria 15325
423 Ga0501032_0050080 3300049569 Bacteria 2817
424 Ga0501032_0212433 3300049569 Bacteria 1261
425 Ga0501033_0000124 3300049570 Bacteria 74731
426 Ga0501033_0056696 3300049570 Bacteria 2895
427 Ga0501034_0019549 3300049571 Bacteria 6926
428 Ga0501034_0154547 3300049571 Bacteria 2269
429 Ga0501036_0000104 3300049572 Bacteria 52974
430 Ga0501036_0020262 3300049572 Bacteria 5585
431 Ga0501037_0000247 3300049573 Bacteria 46080
432 Ga0501037_0032929 3300049573 Bacteria 3830
433 Ga0501038_0000041 3300049574 Bacteria 120557
434 Ga0501038_0237935 3300049574 Bacteria 1446
435 Ga0501039_0000064 3300049575 Bacteria 83415
436 Ga0501046_0080151 3300049580 Bacteria 2523
437 Ga0501047_0000392 3300049581 Bacteria 49114
438 Ga0501047_0008093 3300049581 Bacteria 9921
439 Ga0501047_0051691 3300049581 Bacteria 3971
440 Ga0501048_0009128 3300049582 Bacteria 7462
441 Ga0501068_0024106 3300049584 Bacteria 3571
442 Ga0501069_0015986 3300049585 Bacteria 4025
443 Ga0501070_0000175 3300049586 Bacteria 59483
444 Ga0501070_0127455 3300049586 Bacteria 2103
445 Ga0501070_0130813 3300049586 Bacteria 2073
446 Ga0501073_0034325 3300049589 Bacteria 3611
447 Ga0501074_0005773 3300049590 Bacteria 8929
448 Ga0501074_0046422 3300049590 Bacteria 3141
449 Ga0501074_0070785 3300049590 Bacteria 2507
450 Ga0501075_0169726 3300049591 Bacteria 1664
451 Ga0501249_000109 3300049679 Bacteria 25443
452 Ga0501080_0013998 3300049742 Bacteria 7383
453 Ga0501080_0235787 3300049742 Bacteria 1671
454 Ga0501035_0000155 3300049822 Bacteria 84012
455 Ga0501035_0217664 3300049822 Bacteria 1632
456 Ga0501035_0239608 3300049822 Bacteria 1543
457 Ga0501044_0052450 3300049823 Bacteria 4202
458 Ga0501044_0149764 3300049823 Bacteria 2316
459 Ga0501044_0188517 3300049823 Bacteria 2026
460 Ga0501044_0305575 3300049823 Bacteria 1518
461 Ga0501044_0477102 3300049823 Bacteria 1151
462 Ga0501044_0516659 3300049823 Bacteria 1094
463 nmdc:mga03n38_9307_c1 3300050490 Bacteria 3567
464 nmdc:mga0yw44_12005_c1 3300050492 Bacteria 4497
465 nmdc:mga0yw44_2009_c1 3300050492 Bacteria 7778
466 nmdc:mga0yw44_26139_c1 3300050492 Bacteria 3330
467 nmdc:mga0yw44_33015_c1 3300050492 Bacteria 3021
468 nmdc:mga0yw44_723_c1 3300050492 Bacteria 12145
469 nmdc:mga06z11_86157_c1 3300050494 Bacteria 1696
470 nmdc:mga0sz30_117968_c1 3300050516 Bacteria 1165
471 nmdc:mga0sz30_87711_c1 3300050516 Bacteria 1351
472 Ga0495601_0024808 3300053077 Bacteria 3693
473 Ga0495601_0070957 3300053077 Bacteria 2224
474 Ga0495601_0110795 3300053077 Bacteria 1778
475 Ga0500635_0005633 3300053080 Bacteria 3299
476 Ga0500635_0019411 3300053080 Bacteria 2066
477 Ga0495619_0350524 3300053085 Bacteria 1021
478 Ga0500578_0033112 3300053086 Bacteria 3322
479 Ga0500578_0058889 3300053086 Bacteria 2455
480 Ga0500643_000037 3300053087 Bacteria 180821
481 Ga0500644_0045195 3300053088 Bacteria 1482
482 Ga0500646_0023844 3300053090 Bacteria 1644
483 Ga0500583_0059845 3300053092 Bacteria 1794
484 Ga0500566_0000166 3300053094 Bacteria 33843
485 Ga0500566_0002225 3300053094 Bacteria 11453
486 Ga0500554_000266 3300053102 Bacteria 11311
487 Ga0500555_000550 3300053103 Bacteria 14953
488 Ga0500556_0000089 3300053104 Bacteria 84468
489 Ga0500557_000047 3300053105 Bacteria 59226
490 Ga0500562_002316 3300053108 Bacteria 4777
491 Ga0500569_000281 3300053109 Bacteria 8048
492 Ga0500569_005744 3300053109 Bacteria 2682
493 Ga0500569_033619 3300053109 Bacteria 1458
494 Ga0500569_070348 3300053109 Bacteria 1100
495 Ga0500572_000614 3300053111 Bacteria 11989
496 Ga0500572_009367 3300053111 Bacteria 2314
497 Ga0500594_0006659 3300053118 Bacteria 2603
498 Ga0500595_014345 3300053119 Bacteria 3007
499 Ga0500642_0000030 3300053130 Bacteria 115114
500 Ga0500642_0000071 3300053130 Bacteria 55663
501 Ga0500652_001206 3300053131 Bacteria 8252
502 Ga0500658_0027909 3300053134 Bacteria 2186
503 Ga0500559_0000136 3300053136 Bacteria 56922
504 Ga0500559_0002659 3300053136 Bacteria 9097
505 Ga0500559_0013191 3300053136 Bacteria 3499
506 Ga0500568_0005713 3300053139 Bacteria 6378
507 Ga0500573_0015952 3300053140 Bacteria 4261
508 Ga0500586_000203 3300053145 Bacteria 11555
509 Ga0500603_000324 3300053150 Bacteria 12495
510 Ga0500616_0000026 3300053153 Bacteria 454314
511 Ga0500616_0019257 3300053153 Bacteria 3849
512 Ga0500616_0055446 3300053153 Bacteria 2073
513 Ga0500620_000914 3300053155 Bacteria 5136
514 Ga0500622_0001149 3300053156 Bacteria 22026
515 Ga0500622_0001752 3300053156 Bacteria 16718
516 Ga0500634_0093229 3300053161 Bacteria 1523
517 Ga0500634_0149545 3300053161 Bacteria 1094
518 Ga0500639_029038 3300053163 Bacteria 2923
519 Ga0500639_086960 3300053163 Bacteria 1564
520 Ga0500636_0004341 3300053177 Bacteria 8020
521 Ga0500636_0028276 3300053177 Bacteria 3311
522 Ga0500636_0030053 3300053177 Bacteria 3212
523 Ga0500637_0000582 3300053178 Bacteria 14362
524 Ga0500576_005569 3300053725 Bacteria 5228
525 Ga0500625_002984 3300053729 Bacteria 6534
526 Ga0500609_000505 3300053731 Bacteria 5838
527 Ga0500596_002967 3300053735 Bacteria 3281
528 Ga0500599_000769 3300053736 Bacteria 3510
529 Ga0500601_000014 3300053737 Bacteria 41972
530 Ga0466962_0157617 3300061719 Bacteria 1103

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 8019648815 8019656001 295
2 3300044683 Ga0466965_0129236 Ga0466965_0129236_382_1275 297
3 3300048908 Ga0496105_0123905 Ga0496105_0123905_1210_2109 299
4 3300048918 Ga0496115_0031944 Ga0496115_0031944_24_923 299
5 3300048922 Ga0496119_0226181 Ga0496119_0226181_37_936 299
6 3300053736 Ga0500599_000769 Ga0500599_000769_2583_3482 299
7 3300061719 Ga0466962_0157617 Ga0466962_0157617_168_1067 299
8 3300005548 Ga0070665_100020007 Ga0070665_1000200076 309
9 3300045836 Ga0466958_0310358 Ga0466958_0310358_61_996 311
10 iso_pu_bacteria 2515154112 2515628658 312
11 iso_pu_bacteria 2932784394 2932793107 312
12 iso_pu_bacteria 2932809354 2932814587 312
13 iso_pu_bacteria 2932828146 2932836567 312
14 iso_pu_bacteria 2935675223 2935682501 312
15 iso_pu_bacteria 8017057580 8017060784 312
16 3300005436 Ga0070713_100037231 Ga0070713_1000372312 313
17 3300035695 Ga0373927_0024311 Ga0373927_0024311_1728_2669 313
18 3300036459 Ga0372808_010345 Ga0372808_010345_190_1131 313
19 3300037312 Ga0395899_0311363 Ga0395899_0311363_40_981 313
20 3300044684 Ga0466966_0034958 Ga0466966_0034958_1448_2389 313
21 3300044842 Ga0466957_0014169 Ga0466957_0014169_1574_2515 313
22 3300045049 Ga0466959_0035145 Ga0466959_0035145_1553_2494 313
23 3300045836 Ga0466958_0024101 Ga0466958_0024101_896_1837 313
24 3300048928 Ga0496125_0230291 Ga0496125_0230291_31_972 313
25 3300049569 Ga0501032_0212433 Ga0501032_0212433_166_1107 313
26 3300049570 Ga0501033_0056696 Ga0501033_0056696_517_1458 313
27 3300049572 Ga0501036_0020262 Ga0501036_0020262_3365_4306 313
28 3300049574 Ga0501038_0237935 Ga0501038_0237935_472_1413 313
29 3300049822 Ga0501035_0239608 Ga0501035_0239608_42_983 313
30 3300049823 Ga0501044_0149764 Ga0501044_0149764_1331_2272 313
31 3300049823 Ga0501044_0516659 Ga0501044_0516659_52_993 313
32 3300050492 nmdc:mga0yw44_12005_c1 nmdc:mga0yw44_12005_c1_2618_3559 313
33 3300053088 Ga0500644_0045195 Ga0500644_0045195_308_1249 313
34 3300053153 Ga0500616_0055446 Ga0500616_0055446_50_991 313
35 3300053161 Ga0500634_0149545 Ga0500634_0149545_34_975 313
36 3300005843 Ga0068860_100000302 Ga0068860_10000030251 314
37 3300028381 Ga0268264_10000020 Ga0268264_10000020153 314
38 3300047673 Ga0495593_0140641 Ga0495593_0140641_262_1206 314
39 3300048904 Ga0496101_0125245 Ga0496101_0125245_600_1544 314
40 3300048905 Ga0496102_0466857 Ga0496102_0466857_210_1154 314
41 3300050494 nmdc:mga06z11_86157_c1 nmdc:mga06z11_86157_c1_521_1489 314
42 3300005458 Ga0070681_10021162 Ga0070681_100211625 315
43 3300005366 Ga0070659_100011570 Ga0070659_1000115702 316
44 3300005530 Ga0070679_100428715 Ga0070679_1004287152 316
45 3300005563 Ga0068855_100378096 Ga0068855_1003780962 316
46 3300007265 Ga0099794_10079129 Ga0099794_100791292 316
47 3300007788 Ga0099795_10037287 Ga0099795_100372872 316
48 3300007788 Ga0099795_10043594 Ga0099795_100435942 316
49 3300026118 Ga0207675_100183563 Ga0207675_1001835632 316
50 3300035695 Ga0373927_0003230 Ga0373927_0003230_1279_2229 316
51 3300035725 Ga0373947_0002117 Ga0373947_0002117_10065_11015 316
52 3300037068 Ga0373925_0114334 Ga0373925_0114334_894_1844 316
53 3300039062 Ga0400483_139608 Ga0400483_139608_1382_2332 316
54 3300039062 Ga0400483_185274 Ga0400483_185274_2261_3211 316
55 3300044694 Ga0466963_0033929 Ga0466963_0033929_1204_2154 316
56 3300044694 Ga0466963_0049448 Ga0466963_0049448_238_1188 316
57 3300045976 Ga0466967_0002064 Ga0466967_0002064_6097_7047 316
58 3300046455 Ga0495603_0004991 Ga0495603_0004991_5926_6876 316
59 3300046455 Ga0495603_0023749 Ga0495603_0023749_1190_2140 316
60 3300046518 Ga0495631_0059022 Ga0495631_0059022_33_983 316
61 3300046529 Ga0495652_0079703 Ga0495652_0079703_17_967 316
62 3300046543 Ga0495645_0305447 Ga0495645_0305447_17_967 316
63 3300046683 Ga0495658_0004391 Ga0495658_0004391_20_970 316
64 3300047320 Ga0495672_0111865 Ga0495672_0111865_479_1429 316
65 3300047472 Ga0495686_0100399 Ga0495686_0100399_268_1218 316
66 3300048088 Ga0495602_0121244 Ga0495602_0121244_1129_2079 316
67 3300048918 Ga0496115_0041576 Ga0496115_0041576_1328_2278 316
68 3300053080 Ga0500635_0005633 Ga0500635_0005633_1736_2686 316
69 3300053102 Ga0500554_000266 Ga0500554_000266_1426_2376 316
70 3300053105 Ga0500557_000047 Ga0500557_000047_4894_5844 316
71 3300053130 Ga0500642_0000071 Ga0500642_0000071_12793_13743 316
72 3300053150 Ga0500603_000324 Ga0500603_000324_7802_8752 316
73 3300053178 Ga0500637_0000582 Ga0500637_0000582_5619_6569 316
74 3300053729 Ga0500625_002984 Ga0500625_002984_395_1345 316
75 iso_pu_bacteria 8054302542 8054303252 322
76 iso_pu_bacteria 2857524615 2857529848 323
77 iso_pu_bacteria 2893066018 2893069505 323
78 iso_pu_bacteria 2919073203 2919077296 323
79 3300005327 Ga0070658_10003236 Ga0070658_1000323613 324
80 3300005336 Ga0070680_100010261 Ga0070680_1000102613 324
81 3300005339 Ga0070660_100035699 Ga0070660_1000356992 324
82 3300005530 Ga0070679_100067219 Ga0070679_1000672193 324
83 3300005563 Ga0068855_100026681 Ga0068855_1000266815 324
84 3300005563 Ga0068855_100097901 Ga0068855_1000979013 324
85 3300005614 Ga0068856_100033270 Ga0068856_1000332705 324
86 3300005616 Ga0068852_100008740 Ga0068852_1000087404 324
87 3300009551 Ga0105238_10081124 Ga0105238_100811242 324
88 3300013100 Ga0157373_10149035 Ga0157373_101490352 324
89 3300013105 Ga0157369_10129388 Ga0157369_101293882 324
90 3300025909 Ga0207705_10031006 Ga0207705_100310063 324
91 3300025909 Ga0207705_10135283 Ga0207705_101352832 324
92 3300025917 Ga0207660_10220263 Ga0207660_102202632 324
93 3300025924 Ga0207694_10032091 Ga0207694_100320912 324
94 3300025949 Ga0207667_10085017 Ga0207667_100850172 324
95 3300026142 Ga0207698_10025095 Ga0207698_100250953 324
96 3300031711 Ga0265314_10030262 Ga0265314_100302622 324
97 3300031712 Ga0265342_10000638 Ga0265342_1000063819 324
98 3300049581 Ga0501047_0008093 Ga0501047_0008093_6261_7235 324
99 3300049590 Ga0501074_0046422 Ga0501074_0046422_1269_2243 324
100 3300049822 Ga0501035_0217664 Ga0501035_0217664_158_1132 324
101 3300049823 Ga0501044_0305575 Ga0501044_0305575_186_1160 324
102 iso_pu_bacteria 2857509624 2857516139 324
103 3300035117 Ga0373953_0029074 Ga0373953_0029074_502_1479 325
104 3300035119 Ga0373956_0012440 Ga0373956_0012440_2252_3229 325
105 3300036401 Ga0373937_0184864 Ga0373937_0184864_547_1524 325
106 3300046491 Ga0495584_0170921 Ga0495584_0170921_57_1034 325
107 3300046642 Ga0495634_0135607 Ga0495634_0135607_445_1422 325
108 3300047322 Ga0495680_0106242 Ga0495680_0106242_548_1525 325
109 3300047444 Ga0495675_0106351 Ga0495675_0106351_327_1304 325
110 3300047673 Ga0495593_0018220 Ga0495593_0018220_2342_3319 325
111 iso_pu_bacteria 2906626472 2906634097 325
112 iso_pu_bacteria 2937843397 2937846012 325
113 iso_pu_bacteria 8016583857 8016590062 325
114 3300005327 Ga0070658_10010916 Ga0070658_100109162 326
115 3300005336 Ga0070680_100320974 Ga0070680_1003209742 326
116 3300009093 Ga0105240_10022848 Ga0105240_100228483 326
117 3300013102 Ga0157371_10265631 Ga0157371_102656312 326
118 3300013105 Ga0157369_10042862 Ga0157369_100428624 326
119 3300020070 Ga0206356_11403519 Ga0206356_114035192 326
120 3300020082 Ga0206353_10436796 Ga0206353_104367962 326
121 3300025919 Ga0207657_10051757 Ga0207657_100517572 326
122 3300025949 Ga0207667_10487137 Ga0207667_104871372 326
123 3300026078 Ga0207702_10057390 Ga0207702_100573903 326
124 3300044901 Ga0466960_0091707 Ga0466960_0091707_167_1147 326
125 3300049571 Ga0501034_0154547 Ga0501034_0154547_1259_2239 326
126 3300049590 Ga0501074_0070785 Ga0501074_0070785_92_1075 326
127 3300049679 Ga0501249_000109 Ga0501249_000109_5141_6136 326
128 3300049742 Ga0501080_0235787 Ga0501080_0235787_234_1217 326
129 3300049823 Ga0501044_0477102 Ga0501044_0477102_107_1090 326
130 iso_pu_bacteria 2507262055 2507510606 326
131 iso_pu_bacteria 2508501009 2508544408 326
132 iso_pu_bacteria 2508501042 2508697451 326
133 iso_pu_bacteria 2511231028 2511396334 326
134 iso_pu_bacteria 2513237092 2513628817 326
135 iso_pu_bacteria 2513237094 2513640200 326
136 iso_pu_bacteria 2513237102 2513703830 326
137 iso_pu_bacteria 2513237104 2513715860 326
138 iso_pu_bacteria 2513237139 2513877762 326
139 iso_pu_bacteria 2513237161 2514015047 326
140 iso_pu_bacteria 2517093001 2517105518 326
141 iso_pu_bacteria 2524023205 2524437009 326
142 iso_pu_bacteria 2528768022 2528852288 326
143 iso_pu_bacteria 2617270735 2617350023 326
144 iso_pu_bacteria 2617270741 2617378702 326
145 iso_pu_bacteria 2744054633 2745076161 326
146 iso_pu_bacteria 2791355196 2793063371 326
147 iso_pu_bacteria 2802429603 2805917110 326
148 iso_pu_bacteria 2816332527 2818243555 326
149 iso_pu_bacteria 2824617872 2824621735 326
150 iso_pu_bacteria 2824626560 2824630796 326
151 iso_pu_bacteria 2824635225 2824637427 326
152 iso_pu_bacteria 2824644064 2824646324 326
153 iso_pu_bacteria 2824679649 2824682340 326
154 iso_pu_bacteria 2824704595 2824705694 326
155 iso_pu_bacteria 2824714736 2824717488 326
156 iso_pu_bacteria 2824723954 2824726716 326
157 iso_pu_bacteria 2824732956 2824733671 326
158 iso_pu_bacteria 2824746037 2824747971 326
159 iso_pu_bacteria 2824753945 2824756376 326
160 iso_pu_bacteria 2824763712 2824764061 326
161 iso_pu_bacteria 2824773399 2824776737 326
162 iso_pu_bacteria 2838122688 2838125394 326
163 iso_pu_bacteria 2841941048 2841941946 326
164 iso_pu_bacteria 2841949485 2841951380 326
165 iso_pu_bacteria 2841957949 2841958937 326
166 iso_pu_bacteria 2841966195 2841968621 326
167 iso_pu_bacteria 2841974524 2841976178 326
168 iso_pu_bacteria 2841983080 2841987543 326
169 iso_pu_bacteria 2842038055 2842045084 326
170 iso_pu_bacteria 2842045827 2842049255 326
171 iso_pu_bacteria 2844315083 2844317321 326
172 iso_pu_bacteria 2847930680 2847934026 326
173 iso_pu_bacteria 2847939898 2847944685 326
174 iso_pu_bacteria 2849076700 2849081088 326
175 iso_pu_bacteria 2874612657 2874612944 326
176 iso_pu_bacteria 2874620515 2874620669 326
177 iso_pu_bacteria 2874628541 2874634733 326
178 iso_pu_bacteria 2874645413 2874646885 326
179 iso_pu_bacteria 2876761206 2876769392 326
180 iso_pu_bacteria 2879083081 2879086885 326
181 iso_pu_bacteria 2879127579 2879129888 326
182 iso_pu_bacteria 2879142872 2879146213 326
183 iso_pu_bacteria 2881364244 2881369200 326
184 iso_pu_bacteria 2881665667 2881667633 326
185 iso_pu_bacteria 2885366525 2885367415 326
186 iso_pu_bacteria 2885409591 2885417653 326
187 iso_pu_bacteria 2888378607 2888382006 326
188 iso_pu_bacteria 2888388044 2888388643 326
189 iso_pu_bacteria 2903727486 2903733293 326
190 iso_pu_bacteria 2904666416 2904666592 326
191 iso_pu_bacteria 2904711408 2904720356 326
192 iso_pu_bacteria 2906602504 2906606259 326
193 iso_pu_bacteria 2906643746 2906647532 326
194 iso_pu_bacteria 2908775508 2908778263 326
195 iso_pu_bacteria 2922368715 2922371959 326
196 iso_pu_bacteria 2922393267 2922399300 326
197 iso_pu_bacteria 2929615660 2929616699 326
198 iso_pu_bacteria 2929624759 2929625443 326
199 iso_pu_bacteria 2932794094 2932801239 326
200 iso_pu_bacteria 2932801729 2932803633 326
201 iso_pu_bacteria 2932818245 2932824652 326
202 iso_pu_bacteria 2933577622 2933578018 326
203 iso_pu_bacteria 2935608549 2935610661 326
204 iso_pu_bacteria 2935638405 2935646702 326
205 iso_pu_bacteria 2935648319 2935652432 326
206 iso_pu_bacteria 2935656913 2935661014 326
207 iso_pu_bacteria 2935665750 2935672628 326
208 iso_pu_bacteria 2935694250 2935699574 326
209 iso_pu_bacteria 2935703347 2935707811 326
210 iso_pu_bacteria 2935760218 2935761718 326
211 iso_pu_bacteria 2935769743 2935770559 326
212 iso_pu_bacteria 2935777560 2935782792 326
213 iso_pu_bacteria 2935785616 2935787156 326
214 iso_pu_bacteria 2935793552 2935795204 326
215 iso_pu_bacteria 2935801545 2935810086 326
216 iso_pu_bacteria 2935819856 2935820158 326
217 iso_pu_bacteria 2935827899 2935835969 326
218 iso_pu_bacteria 2935837841 2935844907 326
219 iso_pu_bacteria 2935847175 2935849831 326
220 iso_pu_bacteria 2935864058 2935870739 326
221 iso_pu_bacteria 2935873716 2935881388 326
222 iso_pu_bacteria 2935883170 2935887904 326
223 iso_pu_bacteria 2935908558 2935914479 326
224 iso_pu_bacteria 2935916978 2935919029 326
225 iso_pu_bacteria 2935926038 2935932140 326
226 iso_pu_bacteria 2935934488 2935940738 326
227 iso_pu_bacteria 2935942939 2935948675 326
228 iso_pu_bacteria 2935951376 2935957218 326
229 iso_pu_bacteria 2935959822 2935963648 326
230 iso_pu_bacteria 2935967501 2935973810 326
231 iso_pu_bacteria 2935984226 2935988949 326
232 iso_pu_bacteria 2936002035 2936005447 326
233 iso_pu_bacteria 2936011229 2936015071 326
234 iso_pu_bacteria 2936019824 2936023216 326
235 iso_pu_bacteria 2936028420 2936032331 326
236 iso_pu_bacteria 2936046547 2936050192 326
237 iso_pu_bacteria 2936055302 2936061100 326
238 iso_pu_bacteria 2941531003 2941535144 326
239 iso_pu_bacteria 2941538514 2941546714 326
240 iso_pu_bacteria 3005483717 3005486318 326
241 iso_pu_bacteria 3005506211 3005512145 326
242 iso_pu_bacteria 3005594810 3005597018 326
243 iso_pu_bacteria 3005710791 3005713090 326
244 iso_pu_bacteria 3005718088 3005720450 326
245 iso_pu_bacteria 8016522445 8016523280 326
246 iso_pu_bacteria 8016539877 8016541045 326
247 iso_pu_bacteria 8016548790 8016552208 326
248 iso_pu_bacteria 8016557553 8016560588 326
249 iso_pu_bacteria 8016566248 8016566434 326
250 iso_pu_bacteria 8016575299 8016579184 326
251 iso_pu_bacteria 8016595262 8016598482 326
252 iso_pu_bacteria 8016603502 8016612654 326
253 iso_pu_bacteria 8016622563 8016628853 326
254 iso_pu_bacteria 8016630954 8016633380 326
255 iso_pu_bacteria 8019538911 8019542977 326
256 iso_pu_bacteria 8019547302 8019547776 326
257 iso_pu_bacteria 8019576017 8019580307 326
258 iso_pu_bacteria 8019586578 8019588025 326
259 iso_pu_bacteria 8019608314 8019615219 326
260 iso_pu_bacteria 8019638758 8019643170 326
261 iso_pu_bacteria 8019687851 8019687978 326
262 iso_pu_bacteria 8055742211 8055748345 326
263 iso_pu_bacteria 8056967851 8056971967 326
264 3300005434 Ga0070709_10001919 Ga0070709_100019192 327
265 3300005434 Ga0070709_10003278 Ga0070709_100032787 327
266 3300005435 Ga0070714_100174978 Ga0070714_1001749782 327
267 3300005437 Ga0070710_10000965 Ga0070710_100009656 327
268 3300005437 Ga0070710_10010432 Ga0070710_100104324 327
269 3300005439 Ga0070711_100026368 Ga0070711_1000263684 327
270 3300005455 Ga0070663_100201757 Ga0070663_1002017572 327
271 3300005471 Ga0070698_100036085 Ga0070698_1000360853 327
272 3300006173 Ga0070716_100044926 Ga0070716_1000449262 327
273 3300006175 Ga0070712_100003519 Ga0070712_1000035194 327
274 3300025295 Ga0209564_1007718 Ga0209564_10077182 327
275 3300025898 Ga0207692_10004122 Ga0207692_100041225 327
276 3300025906 Ga0207699_10000561 Ga0207699_100005612 327
277 3300025915 Ga0207693_10003010 Ga0207693_100030109 327
278 3300025915 Ga0207693_10115668 Ga0207693_101156684 327
279 3300025916 Ga0207663_10034229 Ga0207663_100342292 327
280 3300025919 Ga0207657_10021590 Ga0207657_100215902 327
281 3300025928 Ga0207700_10136870 Ga0207700_101368702 327
282 3300025929 Ga0207664_10190589 Ga0207664_101905892 327
283 3300025939 Ga0207665_10050600 Ga0207665_100506003 327
284 3300025939 Ga0207665_10240123 Ga0207665_102401232 327
285 3300026067 Ga0207678_10030711 Ga0207678_100307113 327
286 3300033544 Ga0316215_1006327 Ga0316215_10063272 327
287 3300037466 Ga0395898_0046280 Ga0395898_0046280_3214_4200 327
288 3300046460 Ga0495638_0022968 Ga0495638_0022968_1728_2711 327
289 3300046507 Ga0495606_0156710 Ga0495606_0156710_223_1206 327
290 3300046660 Ga0495625_0066671 Ga0495625_0066671_879_1862 327
291 3300046665 Ga0495661_0023616 Ga0495661_0023616_2238_3221 327
292 3300046674 Ga0495588_0138150 Ga0495588_0138150_175_1158 327
293 3300046691 Ga0495670_0032726 Ga0495670_0032726_1518_2501 327
294 3300047472 Ga0495686_0066199 Ga0495686_0066199_418_1401 327
295 3300048919 Ga0496116_0110232 Ga0496116_0110232_191_1174 327
296 3300048920 Ga0496117_0064917 Ga0496117_0064917_1306_2289 327
297 3300048920 Ga0496117_0066703 Ga0496117_0066703_27_1010 327
298 3300048920 Ga0496117_0135207 Ga0496117_0135207_204_1187 327
299 3300048921 Ga0496118_0088336 Ga0496118_0088336_966_1949 327
300 3300048921 Ga0496118_0198990 Ga0496118_0198990_55_1038 327
301 3300048923 Ga0496120_0152667 Ga0496120_0152667_46_1029 327
302 3300048924 Ga0496121_0006808 Ga0496121_0006808_2823_3806 327
303 3300048925 Ga0496122_0106238 Ga0496122_0106238_539_1522 327
304 3300048925 Ga0496122_0130188 Ga0496122_0130188_250_1233 327
305 3300048926 Ga0496123_0050611 Ga0496123_0050611_1613_2596 327
306 3300048927 Ga0496124_0243128 Ga0496124_0243128_164_1147 327
307 3300048928 Ga0496125_0001999 Ga0496125_0001999_23764_24747 327
308 3300048928 Ga0496125_0062019 Ga0496125_0062019_315_1298 327
309 3300048929 Ga0496126_0042281 Ga0496126_0042281_701_1684 327
310 3300048929 Ga0496126_0322864 Ga0496126_0322864_244_1230 327
311 3300049568 Ga0501031_0002641 Ga0501031_0002641_6621_7604 327
312 3300049568 Ga0501031_0106017 Ga0501031_0106017_94_1086 327
313 3300049569 Ga0501032_0002207 Ga0501032_0002207_10716_11699 327
314 3300049569 Ga0501032_0050080 Ga0501032_0050080_352_1344 327
315 3300049570 Ga0501033_0000124 Ga0501033_0000124_3666_4649 327
316 3300049571 Ga0501034_0019549 Ga0501034_0019549_5422_6405 327
317 3300049572 Ga0501036_0000104 Ga0501036_0000104_45935_46918 327
318 3300049573 Ga0501037_0000247 Ga0501037_0000247_5345_6328 327
319 3300049573 Ga0501037_0032929 Ga0501037_0032929_2136_3128 327
320 3300049574 Ga0501038_0000041 Ga0501038_0000041_69419_70402 327
321 3300049575 Ga0501039_0000064 Ga0501039_0000064_13493_14476 327
322 3300049580 Ga0501046_0080151 Ga0501046_0080151_417_1400 327
323 3300049581 Ga0501047_0000392 Ga0501047_0000392_36786_37769 327
324 3300049581 Ga0501047_0051691 Ga0501047_0051691_874_1866 327
325 3300049582 Ga0501048_0009128 Ga0501048_0009128_3136_4119 327
326 3300049584 Ga0501068_0024106 Ga0501068_0024106_2067_3050 327
327 3300049585 Ga0501069_0015986 Ga0501069_0015986_942_1925 327
328 3300049586 Ga0501070_0000175 Ga0501070_0000175_5329_6312 327
329 3300049586 Ga0501070_0127455 Ga0501070_0127455_730_1722 327
330 3300049586 Ga0501070_0130813 Ga0501070_0130813_827_1813 327
331 3300049589 Ga0501073_0034325 Ga0501073_0034325_1027_2010 327
332 3300049590 Ga0501074_0005773 Ga0501074_0005773_6776_7759 327
333 3300049742 Ga0501080_0013998 Ga0501080_0013998_4479_5462 327
334 3300049822 Ga0501035_0000155 Ga0501035_0000155_50629_51612 327
335 3300049823 Ga0501044_0052450 Ga0501044_0052450_1294_2277 327
336 3300049823 Ga0501044_0188517 Ga0501044_0188517_661_1644 327
337 3300050516 nmdc:mga0sz30_117968_c1 nmdc:mga0sz30_117968_c1_27_1010 327
338 3300050516 nmdc:mga0sz30_87711_c1 nmdc:mga0sz30_87711_c1_336_1319 327
339 3300053090 Ga0500646_0023844 Ga0500646_0023844_139_1122 327
340 3300053094 Ga0500566_0002225 Ga0500566_0002225_5084_6067 327
341 3300053104 Ga0500556_0000089 Ga0500556_0000089_5612_6595 327
342 3300053109 Ga0500569_005744 Ga0500569_005744_583_1566 327
343 3300053109 Ga0500569_033619 Ga0500569_033619_59_1042 327
344 3300053130 Ga0500642_0000030 Ga0500642_0000030_110568_111551 327
345 3300053131 Ga0500652_001206 Ga0500652_001206_6133_7116 327
346 3300053134 Ga0500658_0027909 Ga0500658_0027909_222_1205 327
347 3300053136 Ga0500559_0000136 Ga0500559_0000136_50914_51897 327
348 3300053145 Ga0500586_000203 Ga0500586_000203_3211_4206 327
349 3300053153 Ga0500616_0000026 Ga0500616_0000026_82493_83476 327
350 3300053156 Ga0500622_0001149 Ga0500622_0001149_15901_16884 327
351 3300005356 Ga0070674_100195910 Ga0070674_1001959102 328
352 3300005578 Ga0068854_100104390 Ga0068854_1001043902 328
353 3300005841 Ga0068863_100056464 Ga0068863_1000564644 328
354 3300005841 Ga0068863_100056875 Ga0068863_1000568753 328
355 3300005842 Ga0068858_100048822 Ga0068858_1000488224 328
356 3300005842 Ga0068858_100412551 Ga0068858_1004125512 328
357 3300005843 Ga0068860_100315016 Ga0068860_1003150162 328
358 3300005983 Ga0081540_1024661 Ga0081540_10246612 328
359 3300006178 Ga0075367_10048505 Ga0075367_100485052 328
360 3300009101 Ga0105247_10039539 Ga0105247_100395392 328
361 3300009545 Ga0105237_10174254 Ga0105237_101742542 328
362 3300010375 Ga0105239_10052803 Ga0105239_100528032 328
363 3300011119 Ga0105246_10261077 Ga0105246_102610772 328
364 3300013297 Ga0157378_10152383 Ga0157378_101523832 328
365 3300013306 Ga0163162_10427355 Ga0163162_104273551 328
366 3300014968 Ga0157379_10230179 Ga0157379_102301791 328
367 3300025261 Ga0209233_1003000 Ga0209233_10030002 328
368 3300025272 Ga0209455_1005926 Ga0209455_10059264 328
369 3300025925 Ga0207650_10133886 Ga0207650_101338862 328
370 3300025927 Ga0207687_10097858 Ga0207687_100978581 328
371 3300025981 Ga0207640_10036570 Ga0207640_100365702 328
372 3300026035 Ga0207703_10368767 Ga0207703_103687672 328
373 3300026088 Ga0207641_10024136 Ga0207641_100241364 328
374 3300026089 Ga0207648_10113957 Ga0207648_101139572 328
375 3300026118 Ga0207675_100084324 Ga0207675_1000843243 328
376 3300028556 Ga0265337_1001859 Ga0265337_10018594 328
377 3300028558 Ga0265326_10005016 Ga0265326_100050164 328
378 3300028563 Ga0265319_1002640 Ga0265319_10026404 328
379 3300028573 Ga0265334_10000410 Ga0265334_1000041018 328
380 3300028577 Ga0265318_10005488 Ga0265318_100054884 328
381 3300028653 Ga0265323_10000658 Ga0265323_100006588 328
382 3300028654 Ga0265322_10006993 Ga0265322_100069932 328
383 3300028666 Ga0265336_10000063 Ga0265336_1000006360 328
384 3300028800 Ga0265338_10000154 Ga0265338_1000015434 328
385 3300029957 Ga0265324_10002963 Ga0265324_100029636 328
386 3300030521 Ga0307511_10089184 Ga0307511_100891842 328
387 3300031616 Ga0307508_10000025 Ga0307508_1000002517 328
388 3300031730 Ga0307516_10097063 Ga0307516_100970632 328
389 3300031730 Ga0307516_10111412 Ga0307516_101114122 328
390 3300033179 Ga0307507_10092444 Ga0307507_100924442 328
391 3300037853 Ga0436364_1007205 Ga0436364_1007205_669_1655 328
392 3300039437 Ga0436365_0556026 Ga0436365_0556026_151_1137 328
393 3300044842 Ga0466957_0026990 Ga0466957_0026990_1171_2157 328
394 3300045049 Ga0466959_0228406 Ga0466959_0228406_239_1225 328
395 3300046507 Ga0495606_0050544 Ga0495606_0050544_667_1656 328
396 3300046524 Ga0495648_0046159 Ga0495648_0046159_776_1780 328
397 3300046692 Ga0495671_0023365 Ga0495671_0023365_1618_2622 328
398 3300048909 Ga0496106_0008194 Ga0496106_0008194_3960_4949 328
399 3300048920 Ga0496117_0083776 Ga0496117_0083776_331_1320 328
400 3300048921 Ga0496118_0012281 Ga0496118_0012281_2931_3917 328
401 3300048921 Ga0496118_0050582 Ga0496118_0050582_1535_2524 328
402 3300048924 Ga0496121_0028079 Ga0496121_0028079_515_1504 328
403 3300048924 Ga0496121_0057700 Ga0496121_0057700_997_1986 328
404 3300048927 Ga0496124_0021977 Ga0496124_0021977_829_1818 328
405 3300048927 Ga0496124_0114609 Ga0496124_0114609_346_1332 328
406 3300048928 Ga0496125_0040960 Ga0496125_0040960_936_1925 328
407 3300048928 Ga0496125_0075096 Ga0496125_0075096_795_1781 328
408 3300048928 Ga0496125_0103437 Ga0496125_0103437_1058_2044 328
409 3300048929 Ga0496126_0036078 Ga0496126_0036078_2409_3398 328
410 3300053111 Ga0500572_000614 Ga0500572_000614_2141_3130 328
411 3300053118 Ga0500594_0006659 Ga0500594_0006659_866_1870 328
412 3300053136 Ga0500559_0002659 Ga0500559_0002659_3193_4182 328
413 3300053136 Ga0500559_0013191 Ga0500559_0013191_2007_2996 328
414 3300053140 Ga0500573_0015952 Ga0500573_0015952_2585_3574 328
415 3300053163 Ga0500639_029038 Ga0500639_029038_322_1311 328
416 3300053163 Ga0500639_086960 Ga0500639_086960_210_1199 328
417 3300053177 Ga0500636_0028276 Ga0500636_0028276_577_1566 328
418 3300053177 Ga0500636_0030053 Ga0500636_0030053_1872_2858 328
419 3300053725 Ga0500576_005569 Ga0500576_005569_685_1674 328
420 3300053735 Ga0500596_002967 Ga0500596_002967_1890_2879 328
421 3300044658 Ga0466972_0016158 Ga0466972_0016158_1210_2199 329
422 3300048929 Ga0496126_0192430 Ga0496126_0192430_14_1006 329
423 3300049591 Ga0501075_0169726 Ga0501075_0169726_292_1284 329
424 iso_pu_bacteria 2891048133 2891049780 329
425 3300003215 JGI25153J46596_10000161 JGI25153J46596_1000016171 330
426 3300003215 JGI25153J46596_10000354 JGI25153J46596_1000035423 330
427 3300003354 JGI25160J50197_1001256 JGI25160J50197_100125611 330
428 3300003354 JGI25160J50197_1002809 JGI25160J50197_10028092 330
429 3300003775 Ga0055524_1023787 Ga0055524_10237872 330
430 3300003794 Ga0055531_10013705 Ga0055531_100137053 330
431 3300005262 Ga0065165_1000244 Ga0065165_100024488 330
432 3300005262 Ga0065165_1000368 Ga0065165_10003688 330
433 3300005262 Ga0065165_1008246 Ga0065165_10082463 330
434 3300005262 Ga0065165_1009309 Ga0065165_10093094 330
435 3300005338 Ga0068868_100132456 Ga0068868_1001324562 330
436 3300005455 Ga0070663_100027527 Ga0070663_1000275272 330
437 3300005455 Ga0070663_100044284 Ga0070663_1000442843 330
438 3300005457 Ga0070662_100185209 Ga0070662_1001852092 330
439 3300005471 Ga0070698_100406963 Ga0070698_1004069632 330
440 3300005548 Ga0070665_100118650 Ga0070665_1001186501 330
441 3300005563 Ga0068855_100062155 Ga0068855_1000621552 330
442 3300005578 Ga0068854_100310020 Ga0068854_1003100202 330
443 3300005614 Ga0068856_100120925 Ga0068856_1001209253 330
444 3300005614 Ga0068856_100274604 Ga0068856_1002746042 330
445 3300005614 Ga0068856_100287558 Ga0068856_1002875582 330
446 3300005616 Ga0068852_100001503 Ga0068852_1000015036 330
447 3300005616 Ga0068852_100091652 Ga0068852_1000916522 330
448 3300005617 Ga0068859_100473627 Ga0068859_1004736272 330
449 3300005841 Ga0068863_100112064 Ga0068863_1001120642 330
450 3300005842 Ga0068858_100362146 Ga0068858_1003621462 330
451 3300006038 Ga0075365_10033031 Ga0075365_100330312 330
452 3300006038 Ga0075365_10064949 Ga0075365_100649492 330
453 3300006042 Ga0075368_10000322 Ga0075368_1000032210 330
454 3300006175 Ga0070712_100093869 Ga0070712_1000938692 330
455 3300006178 Ga0075367_10004226 Ga0075367_100042262 330
456 3300006186 Ga0075369_10021636 Ga0075369_100216362 330
457 3300006195 Ga0075366_10002088 Ga0075366_100020889 330
458 3300006353 Ga0075370_10003222 Ga0075370_100032227 330
459 3300006353 Ga0075370_10035300 Ga0075370_100353003 330
460 3300006931 Ga0097620_100473652 Ga0097620_1004736522 330
461 3300006942 Ga0099824_1033450 Ga0099824_10334502 330
462 3300009093 Ga0105240_10008478 Ga0105240_100084785 330
463 3300009098 Ga0105245_10029654 Ga0105245_100296544 330
464 3300009101 Ga0105247_10067229 Ga0105247_100672292 330
465 3300009174 Ga0105241_10020161 Ga0105241_100201614 330
466 3300009174 Ga0105241_10024560 Ga0105241_100245603 330
467 3300009174 Ga0105241_10069727 Ga0105241_100697272 330
468 3300009177 Ga0105248_10105236 Ga0105248_101052363 330
469 3300009545 Ga0105237_10000892 Ga0105237_1000089217 330
470 3300009545 Ga0105237_10007390 Ga0105237_1000739010 330
471 3300010159 Ga0099796_10019942 Ga0099796_100199422 330
472 3300010375 Ga0105239_10007059 Ga0105239_100070594 330
473 3300010375 Ga0105239_10010770 Ga0105239_100107706 330
474 3300010375 Ga0105239_10076576 Ga0105239_100765762 330
475 3300010375 Ga0105239_10095032 Ga0105239_100950323 330
476 3300010375 Ga0105239_10128843 Ga0105239_101288432 330
477 3300010375 Ga0105239_10379505 Ga0105239_103795052 330
478 3300011119 Ga0105246_10003773 Ga0105246_100037737 330
479 3300011119 Ga0105246_10115871 Ga0105246_101158712 330
480 3300013296 Ga0157374_10013038 Ga0157374_100130386 330
481 3300013296 Ga0157374_10021625 Ga0157374_100216255 330
482 3300013306 Ga0163162_10322055 Ga0163162_103220552 330
483 3300013306 Ga0163162_10368787 Ga0163162_103687873 330
484 3300013308 Ga0157375_10021276 Ga0157375_100212766 330
485 3300014325 Ga0163163_10005130 Ga0163163_100051304 330
486 3300021324 Ga0214545_1000028 Ga0214545_1000028110 330
487 3300021327 Ga0214543_1000044 Ga0214543_100004454 330
488 3300025230 Ga0209563_101020 Ga0209563_1010204 330
489 3300025245 Ga0207425_1002884 Ga0207425_10028843 330
490 3300025253 Ga0209677_106052 Ga0209677_1060522 330
491 3300025254 Ga0209148_1000224 Ga0209148_100022428 330
492 3300025261 Ga0209233_1004722 Ga0209233_10047222 330
493 3300025261 Ga0209233_1012100 Ga0209233_10121003 330
494 3300025272 Ga0209455_1000635 Ga0209455_10006356 330
495 3300025295 Ga0209564_1002670 Ga0209564_10026708 330
496 3300025297 Ga0209758_1000075 Ga0209758_100007579 330
497 3300025297 Ga0209758_1000087 Ga0209758_1000087151 330
498 3300025297 Ga0209758_1001472 Ga0209758_10014728 330
499 3300025297 Ga0209758_1003696 Ga0209758_10036962 330
500 3300025297 Ga0209758_1006857 Ga0209758_10068577 330
501 3300025297 Ga0209758_1019189 Ga0209758_10191893 330
502 3300025299 Ga0209256_1009007 Ga0209256_10090072 330
503 3300025302 Ga0207426_1000160 Ga0207426_10001602 330
504 3300025302 Ga0207426_1000289 Ga0207426_1000289107 330
505 3300025302 Ga0207426_1006711 Ga0207426_10067115 330
506 3300025302 Ga0207426_1025821 Ga0207426_10258212 330
507 3300025304 Ga0209257_1000382 Ga0209257_100038276 330
508 3300025304 Ga0209257_1010148 Ga0209257_10101482 330
509 3300025904 Ga0207647_10006477 Ga0207647_100064777 330
510 3300025911 Ga0207654_10049575 Ga0207654_100495753 330
511 3300025913 Ga0207695_10000029 Ga0207695_10000029503 330
512 3300025914 Ga0207671_10005341 Ga0207671_100053418 330
513 3300025914 Ga0207671_10030419 Ga0207671_100304194 330
514 3300025915 Ga0207693_10181939 Ga0207693_101819392 330
515 3300025915 Ga0207693_10321853 Ga0207693_103218531 330
516 3300025916 Ga0207663_10242542 Ga0207663_102425421 330
517 3300025924 Ga0207694_10118890 Ga0207694_101188902 330
518 3300025931 Ga0207644_10082189 Ga0207644_100821893 330
519 3300025932 Ga0207690_10271961 Ga0207690_102719612 330
520 3300025933 Ga0207706_10085276 Ga0207706_100852763 330
521 3300025941 Ga0207711_10032173 Ga0207711_100321733 330
522 3300025944 Ga0207661_10109003 Ga0207661_101090032 330
523 3300025972 Ga0207668_10136606 Ga0207668_101366062 330
524 3300025981 Ga0207640_10400497 Ga0207640_104004971 330
525 3300025986 Ga0207658_10024166 Ga0207658_100241662 330
526 3300026023 Ga0207677_10038119 Ga0207677_100381192 330
527 3300026041 Ga0207639_10526952 Ga0207639_105269521 330
528 3300026067 Ga0207678_10043585 Ga0207678_100435854 330
529 3300026067 Ga0207678_10064794 Ga0207678_100647943 330
530 3300026078 Ga0207702_10001454 Ga0207702_1000145414 330
531 3300026078 Ga0207702_10028517 Ga0207702_100285173 330
532 3300026078 Ga0207702_10350173 Ga0207702_103501731 330
533 3300026121 Ga0207683_10464040 Ga0207683_104640401 330
534 3300026142 Ga0207698_10045053 Ga0207698_100450532 330
535 3300026142 Ga0207698_10147244 Ga0207698_101472442 330
536 3300026142 Ga0207698_10258035 Ga0207698_102580352 330
537 3300027296 Ga0209389_1000137 Ga0209389_100013753 330
538 3300027296 Ga0209389_1000353 Ga0209389_100035312 330
539 3300027357 Ga0209589_1003439 Ga0209589_100343912 330
540 3300027361 Ga0209489_100192 Ga0209489_10019239 330
541 3300027361 Ga0209489_107326 Ga0209489_1073268 330
542 3300031235 Ga0265330_10054307 Ga0265330_100543072 330
543 3300031238 Ga0265332_10007749 Ga0265332_100077492 330
544 3300031241 Ga0265325_10020842 Ga0265325_100208422 330
545 3300031250 Ga0265331_10117920 Ga0265331_101179202 330
546 3300031711 Ga0265314_10005071 Ga0265314_100050719 330
547 3300033180 Ga0307510_10024769 Ga0307510_100247695 330
548 3300033180 Ga0307510_10044327 Ga0307510_100443274 330
549 3300033180 Ga0307510_10094433 Ga0307510_100944333 330
550 3300035119 Ga0373956_0082558 Ga0373956_0082558_85_1080 330
551 3300035170 Ga0373943_0002145 Ga0373943_0002145_3011_4006 330
552 3300035171 Ga0373946_0001257 Ga0373946_0001257_1065_2060 330
553 3300035172 Ga0373955_0002673 Ga0373955_0002673_763_1758 330
554 3300035410 Ga0373924_0005844 Ga0373924_0005844_1666_2661 330
555 3300035691 Ga0373931_0007479 Ga0373931_0007479_974_1969 330
556 3300035692 Ga0373935_0000494 Ga0373935_0000494_4960_5955 330
557 3300035695 Ga0373927_0002352 Ga0373927_0002352_359_1354 330
558 3300035725 Ga0373947_0055656 Ga0373947_0055656_219_1214 330
559 3300037068 Ga0373925_0007140 Ga0373925_0007140_5870_6865 330
560 3300037418 Ga0395900_0000943 Ga0395900_0000943_28734_29726 330
561 3300037466 Ga0395898_0002974 Ga0395898_0002974_9432_10424 330
562 3300037471 Ga0395905_0021852 Ga0395905_0021852_3675_4670 330
563 3300037471 Ga0395905_0062455 Ga0395905_0062455_1201_2193 330
564 3300037471 Ga0395905_0088532 Ga0395905_0088532_489_1481 330
565 3300038443 Ga0395901_0001973 Ga0395901_0001973_9544_10536 330
566 3300044658 Ga0466972_0025155 Ga0466972_0025155_773_1765 330
567 3300044658 Ga0466972_0026707 Ga0466972_0026707_387_1379 330
568 3300044693 Ga0466961_0000029 Ga0466961_0000029_62186_63178 330
569 3300044706 Ga0466964_0012459 Ga0466964_0012459_2211_3203 330
570 3300044735 Ga0466968_0032351 Ga0466968_0032351_351_1343 330
571 3300045049 Ga0466959_0000533 Ga0466959_0000533_2015_3007 330
572 3300046455 Ga0495603_0000237 Ga0495603_0000237_21124_22119 330
573 3300046459 Ga0495629_0000772 Ga0495629_0000772_12080_13075 330
574 3300046460 Ga0495638_0006370 Ga0495638_0006370_5677_6669 330
575 3300046461 Ga0495641_0004443 Ga0495641_0004443_3649_4644 330
576 3300046462 Ga0495651_0081569 Ga0495651_0081569_101_1093 330
577 3300046472 Ga0495580_0001324 Ga0495580_0001324_15890_16885 330
578 3300046473 Ga0495582_0000209 Ga0495582_0000209_17730_18725 330
579 3300046475 Ga0495639_0000387 Ga0495639_0000387_3531_4526 330
580 3300046477 Ga0495664_0017088 Ga0495664_0017088_2888_3883 330
581 3300046477 Ga0495664_0019150 Ga0495664_0019150_2490_3482 330
582 3300046477 Ga0495664_0116664 Ga0495664_0116664_288_1283 330
583 3300046499 Ga0495594_0000342 Ga0495594_0000342_13906_14901 330
584 3300046507 Ga0495606_0047231 Ga0495606_0047231_1566_2558 330
585 3300046511 Ga0495608_0032019 Ga0495608_0032019_1735_2727 330
586 3300046511 Ga0495608_0046562 Ga0495608_0046562_1402_2394 330
587 3300046514 Ga0495618_0134916 Ga0495618_0134916_290_1285 330
588 3300046516 Ga0495628_0064005 Ga0495628_0064005_1088_2080 330
589 3300046522 Ga0495643_0010018 Ga0495643_0010018_1019_2011 330
590 3300046531 Ga0495665_0000280 Ga0495665_0000280_10849_11844 330
591 3300046533 Ga0495640_0001578 Ga0495640_0001578_5866_6861 330
592 3300046536 Ga0495587_0059147 Ga0495587_0059147_203_1195 330
593 3300046543 Ga0495645_0042873 Ga0495645_0042873_2169_3161 330
594 3300046557 Ga0495622_0004227 Ga0495622_0004227_5081_6073 330
595 3300046557 Ga0495622_0004573 Ga0495622_0004573_790_1785 330
596 3300046559 Ga0495667_0042094 Ga0495667_0042094_947_1942 330
597 3300046642 Ga0495634_0000865 Ga0495634_0000865_16055_17050 330
598 3300046663 Ga0495635_0003213 Ga0495635_0003213_3359_4351 330
599 3300046663 Ga0495635_0017357 Ga0495635_0017357_844_1836 330
600 3300046674 Ga0495588_0030385 Ga0495588_0030385_399_1394 330
601 3300046674 Ga0495588_0123030 Ga0495588_0123030_303_1295 330
602 3300046675 Ga0495657_0011035 Ga0495657_0011035_2224_3216 330
603 3300046675 Ga0495657_0029981 Ga0495657_0029981_1621_2613 330
604 3300046689 Ga0495613_0003086 Ga0495613_0003086_6486_7481 330
605 3300046689 Ga0495613_0280465 Ga0495613_0280465_115_1107 330
606 3300046690 Ga0495624_0001082 Ga0495624_0001082_9051_10046 330
607 3300047315 Ga0495581_0022904 Ga0495581_0022904_726_1721 330
608 3300047315 Ga0495581_0035677 Ga0495581_0035677_12_1004 330
609 3300047317 Ga0495604_0016851 Ga0495604_0016851_171_1163 330
610 3300047319 Ga0495674_0004372 Ga0495674_0004372_7499_8494 330
611 3300047319 Ga0495674_0024884 Ga0495674_0024884_3733_4725 330
612 3300047321 Ga0495676_0009743 Ga0495676_0009743_78_1073 330
613 3300047321 Ga0495676_0179397 Ga0495676_0179397_424_1416 330
614 3300047323 Ga0495683_0007012 Ga0495683_0007012_4109_5101 330
615 3300047443 Ga0495687_011591 Ga0495687_011591_1119_2111 330
616 3300047471 Ga0495684_0005777 Ga0495684_0005777_8195_9190 330
617 3300047472 Ga0495686_0052830 Ga0495686_0052830_284_1276 330
618 3300047673 Ga0495593_0000238 Ga0495593_0000238_11972_12967 330
619 3300048089 Ga0495614_0027859 Ga0495614_0027859_392_1387 330
620 3300048904 Ga0496101_0018685 Ga0496101_0018685_1735_2727 330
621 3300048904 Ga0496101_0253962 Ga0496101_0253962_154_1146 330
622 3300048905 Ga0496102_0001874 Ga0496102_0001874_12568_13560 330
623 3300048905 Ga0496102_0408515 Ga0496102_0408515_74_1066 330
624 3300048906 Ga0496103_0002168 Ga0496103_0002168_1608_2600 330
625 3300048906 Ga0496103_0117414 Ga0496103_0117414_228_1220 330
626 3300048907 Ga0496104_0004135 Ga0496104_0004135_1065_2057 330
627 3300048907 Ga0496104_0019755 Ga0496104_0019755_112_1104 330
628 3300048907 Ga0496104_0022321 Ga0496104_0022321_1720_2712 330
629 3300048908 Ga0496105_0006240 Ga0496105_0006240_284_1276 330
630 3300048909 Ga0496106_0058907 Ga0496106_0058907_1281_2273 330
631 3300048910 Ga0496107_0068287 Ga0496107_0068287_892_1884 330
632 3300048911 Ga0496108_0123258 Ga0496108_0123258_111_1106 330
633 3300048912 Ga0496109_0070568 Ga0496109_0070568_386_1378 330
634 3300048912 Ga0496109_0511656 Ga0496109_0511656_121_1116 330
635 3300048913 Ga0496110_0021529 Ga0496110_0021529_1340_2332 330
636 3300048913 Ga0496110_0053113 Ga0496110_0053113_703_1698 330
637 3300048914 Ga0496111_0076159 Ga0496111_0076159_1149_2141 330
638 3300048915 Ga0496112_0006808 Ga0496112_0006808_873_1865 330
639 3300048915 Ga0496112_0029058 Ga0496112_0029058_2850_3845 330
640 3300048915 Ga0496112_0043753 Ga0496112_0043753_1676_2671 330
641 3300048915 Ga0496112_0169163 Ga0496112_0169163_637_1629 330
642 3300048916 Ga0496113_0211644 Ga0496113_0211644_384_1376 330
643 3300048918 Ga0496115_0007927 Ga0496115_0007927_816_1808 330
644 3300048918 Ga0496115_0071326 Ga0496115_0071326_98_1090 330
645 3300048919 Ga0496116_0037607 Ga0496116_0037607_1307_2299 330
646 3300048920 Ga0496117_0124629 Ga0496117_0124629_331_1323 330
647 3300048922 Ga0496119_0014153 Ga0496119_0014153_122_1114 330
648 3300048923 Ga0496120_0019887 Ga0496120_0019887_1257_2249 330
649 3300048924 Ga0496121_0099694 Ga0496121_0099694_584_1576 330
650 3300048924 Ga0496121_0207651 Ga0496121_0207651_153_1145 330
651 3300048929 Ga0496126_0251548 Ga0496126_0251548_206_1198 330
652 3300050490 nmdc:mga03n38_9307_c1 nmdc:mga03n38_9307_c1_355_1347 330
653 3300050492 nmdc:mga0yw44_2009_c1 nmdc:mga0yw44_2009_c1_4578_5570 330
654 3300050492 nmdc:mga0yw44_26139_c1 nmdc:mga0yw44_26139_c1_162_1154 330
655 3300050492 nmdc:mga0yw44_33015_c1 nmdc:mga0yw44_33015_c1_189_1181 330
656 3300050492 nmdc:mga0yw44_723_c1 nmdc:mga0yw44_723_c1_1261_2253 330
657 3300053077 Ga0495601_0024808 Ga0495601_0024808_2181_3176 330
658 3300053077 Ga0495601_0070957 Ga0495601_0070957_907_1902 330
659 3300053077 Ga0495601_0110795 Ga0495601_0110795_652_1647 330
660 3300053080 Ga0500635_0019411 Ga0500635_0019411_122_1114 330
661 3300053085 Ga0495619_0350524 Ga0495619_0350524_12_1007 330
662 3300053086 Ga0500578_0033112 Ga0500578_0033112_716_1708 330
663 3300053086 Ga0500578_0058889 Ga0500578_0058889_1420_2412 330
664 3300053087 Ga0500643_000037 Ga0500643_000037_111896_112888 330
665 3300053092 Ga0500583_0059845 Ga0500583_0059845_422_1414 330
666 3300053094 Ga0500566_0000166 Ga0500566_0000166_11730_12722 330
667 3300053103 Ga0500555_000550 Ga0500555_000550_3584_4576 330
668 3300053108 Ga0500562_002316 Ga0500562_002316_3014_4006 330
669 3300053109 Ga0500569_000281 Ga0500569_000281_3616_4608 330
670 3300053109 Ga0500569_070348 Ga0500569_070348_47_1039 330
671 3300053111 Ga0500572_009367 Ga0500572_009367_507_1499 330
672 3300053119 Ga0500595_014345 Ga0500595_014345_1950_2942 330
673 3300053139 Ga0500568_0005713 Ga0500568_0005713_4459_5451 330
674 3300053153 Ga0500616_0019257 Ga0500616_0019257_2352_3344 330
675 3300053155 Ga0500620_000914 Ga0500620_000914_3131_4123 330
676 3300053156 Ga0500622_0001752 Ga0500622_0001752_7279_8271 330
677 3300053161 Ga0500634_0093229 Ga0500634_0093229_23_1015 330
678 3300053177 Ga0500636_0004341 Ga0500636_0004341_5731_6723 330
679 3300053731 Ga0500609_000505 Ga0500609_000505_2979_3971 330
680 3300053737 Ga0500601_000014 Ga0500601_000014_30570_31562 330

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00725

3HCDH

3-hydroxyacyl-CoA dehydrogenase, C-terminal domain

197

295

0.96

PF02737

3HCDH_N

3-hydroxyacyl-CoA dehydrogenase, NAD binding domain

6

195

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5mog-assembly1.cif.gz_C oryza sativa phytoene desaturase inhibited by norflurazon 0.8911 2 36
3bly-assembly1.cif.gz_A pyranose 2-oxidase from trametes multicolor, e542k/l537w 0.8879 5 35
6xtf-assembly1.cif.gz_B crystal structure a thioredoxin reductase from gloeobacter violaceus bound to its electron donor 0.8838 5 36
4mop-assembly1.cif.gz_D pyranose 2-oxidase v546c mutant with 3-fluorinated galactose 0.8829 5 35
3k4l-assembly1.cif.gz_A pyranose 2-oxidase f454n mutant in complex with 2fg 0.8815 5 35
ID Description Score Start End Superfamily
4kuhA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9581 5 200 3.40.50.720
af_A0A0R0JSV2_33_153_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9571 91 199 3.40.50.720
2wtbA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.952 5 197 3.40.50.720
4kuhA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9481 5 200 3.40.50.720
af_Q54VB8_19_206_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9451 3 199 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A6M1LHE8-F1-model_v4 L-gulonate 3-dehydrogenase (EC 1.1.1.45) (L-gulonate 3-dehydrogenase) 0.9799 2 330 GO:0006631
GO:0008691
GO:0009056
GO:0050104
GO:0070403
AF-A0A7C3N468-F1-model_v4 L-gulonate 3-dehydrogenase (EC 1.1.1.45) (L-gulonate 3-dehydrogenase) 0.9784 6 320 GO:0006631
GO:0009056
GO:0050104
GO:0070403
AF-B4ELK6-F1-model_v4 L-gulonate 3-dehydrogenase (EC 1.1.1.45) (L-gulonate 3-dehydrogenase) 0.9732 5 329 GO:0006631
GO:0009056
GO:0016020
GO:0050104
GO:0070403
AF-A0A2V7HX34-F1-model_v4 3-hydroxyacyl-CoA dehydrogenase 0.9718 150 320 GO:0006631
GO:0009056
GO:0050104
GO:0070403
AF-A0A7S2V1P9-F1-model_v4 3-hydroxyacyl-CoA dehydrogenase NAD binding domain-containing protein 0.9717 95 170 GO:0003857
GO:0005777
GO:0006635
GO:0016829
GO:0016853
GO:0070403

Feature Viewer

pLDDT pTM Quality
93.96 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map