F474782
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 680 | 461 | 530 | 327 |
Family's Representative Sequence
| Representative Sequence | 3300025927|Ga0207687_10097858|Ga0207687_100978581 |
| Length | 329 |
| Sequence | MKGLPVIGALGAGRMGRGIAQVFAYAGHDVHLIDAKQRSPAARSKLEFEALAEIDSTLAMLSGLGAFDDAQRPHIMRRIHFADRAEADAALRACDVVFEGVPEVLDAKREALAFACEHMREEAILASTTSTILVTQLAGLVTYAERFLNAHWLNPAYIVPLVELSPHPGTNAAVLSHLKMLLEAIGKVPVVCAPAPGFIVPRLQALVMAEAARMIQDGVATAEDIDKATRYGFGFRFAAIGVVEFIDYGGNDILYYACRHLARELGERYHAPAIVDRLMQEGHVGLKTKRGFYDYAQVDIPAYRRDVISRALGLLRHHGLLVPPGNSNL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 5 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 6 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 7 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 8 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 9 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 10 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 11 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 12 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 13 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 14 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 15 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 16 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 17 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 18 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 19 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 20 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 21 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 22 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 23 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 24 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 25 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 26 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 27 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 28 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 29 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 30 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 31 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 32 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 33 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 34 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 35 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 36 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 37 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 38 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 39 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 40 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 41 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 42 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 43 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 44 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 45 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 46 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 47 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 48 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 49 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 50 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 51 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 52 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 53 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 54 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 55 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 56 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 57 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 58 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 59 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 60 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 61 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 62 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 63 | 2891048133 | Martelella lutilitoris GH2-6 | Isolate | Rhizosphere |
| 64 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 65 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 66 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 67 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 68 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 69 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 70 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 71 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 72 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 73 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 74 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 75 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 76 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 77 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 78 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 79 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 80 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 81 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 82 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 83 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 84 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 85 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 86 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 87 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 88 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 89 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 90 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 91 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 92 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 93 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 94 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 95 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 96 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 97 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 98 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 99 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 100 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 101 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 102 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 103 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 104 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 105 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 106 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 107 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 108 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 109 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 110 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 111 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 112 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 113 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 114 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 115 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 116 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 117 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 118 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 119 | 2937843397 | Mesorhizobium xinjiangense lm94 | Isolate | Rhizosphere |
| 120 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 121 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 122 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 123 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 124 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 125 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 126 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 127 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 128 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 129 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 130 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 131 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 132 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 133 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 134 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 135 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 136 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 137 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 138 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 139 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 140 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 141 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 142 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 143 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 144 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 145 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 146 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 147 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 148 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 149 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 150 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 151 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 152 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 153 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 154 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 155 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 156 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 157 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 158 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 159 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 160 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 161 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 162 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 163 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 164 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 165 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 166 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 168 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 169 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 170 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 171 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 172 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 173 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 174 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 175 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 176 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 177 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 178 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 179 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 180 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 181 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 182 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 183 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 184 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 185 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 186 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 187 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 188 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 189 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 190 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 191 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 192 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 193 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 194 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 195 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 196 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 197 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 198 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 199 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 200 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 201 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 202 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 203 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 204 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 241 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 242 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 243 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 245 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 246 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 247 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 248 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 249 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 250 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 251 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 252 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 253 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 254 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 255 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 256 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 257 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 258 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 259 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 260 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 261 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 262 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 263 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 264 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 265 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 266 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 267 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 268 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 269 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 270 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 271 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 272 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 273 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 274 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 275 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 276 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 277 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 278 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 279 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 280 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 281 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 282 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 283 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 284 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 285 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 286 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 287 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 288 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 289 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 290 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 291 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 292 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 293 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 294 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 295 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 296 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 297 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 298 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 299 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 350 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 351 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 352 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 353 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 354 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 355 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 356 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 357 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 358 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 359 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 360 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 361 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 362 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 363 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 364 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 365 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 366 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 367 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 368 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 369 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 370 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 371 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 372 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 373 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 374 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 377 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 379 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 382 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 385 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 386 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 387 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 388 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 389 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 390 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 391 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 392 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 393 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 394 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 395 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 396 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 397 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 398 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 399 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 401 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 403 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 404 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 405 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 406 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 407 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 408 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 409 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 410 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 411 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 412 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 413 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 414 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 415 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 416 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 417 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 418 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 419 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 420 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 421 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 422 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 423 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 424 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 425 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 426 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 427 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 428 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 429 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 430 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 431 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 432 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 433 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 434 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 435 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 436 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 437 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 438 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 439 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 440 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 441 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 442 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 443 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 444 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 445 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 446 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 447 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 448 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 449 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 450 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 451 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 452 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 453 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 454 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 455 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 456 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 457 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 458 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 459 | 8054302542 | Novosphingobium kaempferiae Sx8-5 | Isolate | Rhizosphere |
| 460 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 461 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 77.61 |
| Metatranscriptomes | 0.44 |
| Isolates | 21.94 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 15.59 |
| Nodule | 16.62 |
| Rhizoplane | 4.56 |
| Rhizosphere | 49.71 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13.53 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25153J46596_10000161 | 3300003215 | Bacteria | 67388 |
| 2 | JGI25153J46596_10000354 | 3300003215 | Bacteria | 31788 |
| 3 | JGI25160J50197_1001256 | 3300003354 | Bacteria | 12850 |
| 4 | JGI25160J50197_1002809 | 3300003354 | Bacteria | 7972 |
| 5 | Ga0055524_1023787 | 3300003775 | Bacteria | 1964 |
| 6 | Ga0055531_10013705 | 3300003794 | Bacteria | 3716 |
| 7 | Ga0065165_1000244 | 3300005262 | Bacteria | 93411 |
| 8 | Ga0065165_1000368 | 3300005262 | Bacteria | 73904 |
| 9 | Ga0065165_1008246 | 3300005262 | Bacteria | 4924 |
| 10 | Ga0065165_1009309 | 3300005262 | Bacteria | 4422 |
| 11 | Ga0070658_10003236 | 3300005327 | Bacteria | 13450 |
| 12 | Ga0070658_10010916 | 3300005327 | Bacteria | 7281 |
| 13 | Ga0070680_100010261 | 3300005336 | Bacteria | 7219 |
| 14 | Ga0070680_100320974 | 3300005336 | Bacteria | 1315 |
| 15 | Ga0068868_100132456 | 3300005338 | Bacteria | 2041 |
| 16 | Ga0070660_100035699 | 3300005339 | Bacteria | 3763 |
| 17 | Ga0070674_100195910 | 3300005356 | Bacteria | 1557 |
| 18 | Ga0070659_100011570 | 3300005366 | Bacteria | 6531 |
| 19 | Ga0070709_10001919 | 3300005434 | Bacteria | 11298 |
| 20 | Ga0070709_10003278 | 3300005434 | Bacteria | 8702 |
| 21 | Ga0070714_100174978 | 3300005435 | Bacteria | 1950 |
| 22 | Ga0070713_100037231 | 3300005436 | Bacteria | 3933 |
| 23 | Ga0070710_10000965 | 3300005437 | Bacteria | 13640 |
| 24 | Ga0070710_10010432 | 3300005437 | Bacteria | 4564 |
| 25 | Ga0070711_100026368 | 3300005439 | Bacteria | 3808 |
| 26 | Ga0070663_100027527 | 3300005455 | Bacteria | 3862 |
| 27 | Ga0070663_100044284 | 3300005455 | Bacteria | 3136 |
| 28 | Ga0070663_100201757 | 3300005455 | Bacteria | 1553 |
| 29 | Ga0070662_100185209 | 3300005457 | Bacteria | 1643 |
| 30 | Ga0070681_10021162 | 3300005458 | Bacteria | 6517 |
| 31 | Ga0070698_100036085 | 3300005471 | Bacteria | 5110 |
| 32 | Ga0070698_100406963 | 3300005471 | Bacteria | 1294 |
| 33 | Ga0070679_100067219 | 3300005530 | Bacteria | 3574 |
| 34 | Ga0070679_100428715 | 3300005530 | Bacteria | 1267 |
| 35 | Ga0070665_100020007 | 3300005548 | Bacteria | 6721 |
| 36 | Ga0070665_100118650 | 3300005548 | Bacteria | 2648 |
| 37 | Ga0068855_100026681 | 3300005563 | Bacteria | 6911 |
| 38 | Ga0068855_100062155 | 3300005563 | Bacteria | 4361 |
| 39 | Ga0068855_100097901 | 3300005563 | Bacteria | 3379 |
| 40 | Ga0068855_100378096 | 3300005563 | Bacteria | 1556 |
| 41 | Ga0068854_100104390 | 3300005578 | Bacteria | 2129 |
| 42 | Ga0068854_100310020 | 3300005578 | Bacteria | 1280 |
| 43 | Ga0068856_100033270 | 3300005614 | Bacteria | 5047 |
| 44 | Ga0068856_100120925 | 3300005614 | Bacteria | 2620 |
| 45 | Ga0068856_100274604 | 3300005614 | Bacteria | 1702 |
| 46 | Ga0068856_100287558 | 3300005614 | Bacteria | 1661 |
| 47 | Ga0068852_100001503 | 3300005616 | Bacteria | 15782 |
| 48 | Ga0068852_100008740 | 3300005616 | Bacteria | 7488 |
| 49 | Ga0068852_100091652 | 3300005616 | Bacteria | 2720 |
| 50 | Ga0068859_100473627 | 3300005617 | Bacteria | 1348 |
| 51 | Ga0068863_100056464 | 3300005841 | Bacteria | 3717 |
| 52 | Ga0068863_100056875 | 3300005841 | Bacteria | 3703 |
| 53 | Ga0068863_100112064 | 3300005841 | Bacteria | 2598 |
| 54 | Ga0068858_100048822 | 3300005842 | Bacteria | 3920 |
| 55 | Ga0068858_100362146 | 3300005842 | Bacteria | 1390 |
| 56 | Ga0068858_100412551 | 3300005842 | Bacteria | 1298 |
| 57 | Ga0068860_100000302 | 3300005843 | Bacteria | 68581 |
| 58 | Ga0068860_100315016 | 3300005843 | Bacteria | 1535 |
| 59 | Ga0081540_1024661 | 3300005983 | Bacteria | 3484 |
| 60 | Ga0075365_10033031 | 3300006038 | Bacteria | 3332 |
| 61 | Ga0075365_10064949 | 3300006038 | Bacteria | 2446 |
| 62 | Ga0075368_10000322 | 3300006042 | Bacteria | 14006 |
| 63 | Ga0070716_100044926 | 3300006173 | Bacteria | 2477 |
| 64 | Ga0070712_100003519 | 3300006175 | Bacteria | 9636 |
| 65 | Ga0070712_100093869 | 3300006175 | Bacteria | 2203 |
| 66 | Ga0075367_10004226 | 3300006178 | Bacteria | 6973 |
| 67 | Ga0075367_10048505 | 3300006178 | Bacteria | 2502 |
| 68 | Ga0075369_10021636 | 3300006186 | Bacteria | 2645 |
| 69 | Ga0075366_10002088 | 3300006195 | Bacteria | 10148 |
| 70 | Ga0075370_10003222 | 3300006353 | Bacteria | 7724 |
| 71 | Ga0075370_10035300 | 3300006353 | Bacteria | 2806 |
| 72 | Ga0097620_100473652 | 3300006931 | Bacteria | 1348 |
| 73 | Ga0099824_1033450 | 3300006942 | Bacteria | 1739 |
| 74 | Ga0099794_10079129 | 3300007265 | Bacteria | 1619 |
| 75 | Ga0099795_10037287 | 3300007788 | Bacteria | 1710 |
| 76 | Ga0099795_10043594 | 3300007788 | Bacteria | 1606 |
| 77 | Ga0105240_10008478 | 3300009093 | Bacteria | 14699 |
| 78 | Ga0105240_10022848 | 3300009093 | Bacteria | 8285 |
| 79 | Ga0105245_10029654 | 3300009098 | Bacteria | 4836 |
| 80 | Ga0105247_10039539 | 3300009101 | Bacteria | 2881 |
| 81 | Ga0105247_10067229 | 3300009101 | Bacteria | 2232 |
| 82 | Ga0105241_10020161 | 3300009174 | Bacteria | 4925 |
| 83 | Ga0105241_10024560 | 3300009174 | Bacteria | 4475 |
| 84 | Ga0105241_10069727 | 3300009174 | Bacteria | 2726 |
| 85 | Ga0105248_10105236 | 3300009177 | Bacteria | 3181 |
| 86 | Ga0105237_10000892 | 3300009545 | Bacteria | 40254 |
| 87 | Ga0105237_10007390 | 3300009545 | Bacteria | 12032 |
| 88 | Ga0105237_10174254 | 3300009545 | Bacteria | 2151 |
| 89 | Ga0105238_10081124 | 3300009551 | Bacteria | 3233 |
| 90 | Ga0099796_10019942 | 3300010159 | Bacteria | 2041 |
| 91 | Ga0105239_10007059 | 3300010375 | Bacteria | 12929 |
| 92 | Ga0105239_10010770 | 3300010375 | Bacteria | 10216 |
| 93 | Ga0105239_10052803 | 3300010375 | Bacteria | 4458 |
| 94 | Ga0105239_10076576 | 3300010375 | Bacteria | 3679 |
| 95 | Ga0105239_10095032 | 3300010375 | Bacteria | 3293 |
| 96 | Ga0105239_10128843 | 3300010375 | Bacteria | 2813 |
| 97 | Ga0105239_10379505 | 3300010375 | Bacteria | 1598 |
| 98 | Ga0105246_10003773 | 3300011119 | Bacteria | 9185 |
| 99 | Ga0105246_10115871 | 3300011119 | Bacteria | 1977 |
| 100 | Ga0105246_10261077 | 3300011119 | Unclassified | 1380 |
| 101 | Ga0157373_10149035 | 3300013100 | Bacteria | 1646 |
| 102 | Ga0157371_10265631 | 3300013102 | Bacteria | 1238 |
| 103 | Ga0157369_10042862 | 3300013105 | Bacteria | 4935 |
| 104 | Ga0157369_10129388 | 3300013105 | Bacteria | 2676 |
| 105 | Ga0157374_10013038 | 3300013296 | Bacteria | 7248 |
| 106 | Ga0157374_10021625 | 3300013296 | Bacteria | 5728 |
| 107 | Ga0157378_10152383 | 3300013297 | Bacteria | 2155 |
| 108 | Ga0163162_10322055 | 3300013306 | Bacteria | 1678 |
| 109 | Ga0163162_10368787 | 3300013306 | Bacteria | 1569 |
| 110 | Ga0163162_10427355 | 3300013306 | Bacteria | 1457 |
| 111 | Ga0157375_10021276 | 3300013308 | Bacteria | 5943 |
| 112 | Ga0163163_10005130 | 3300014325 | Bacteria | 11291 |
| 113 | Ga0157379_10230179 | 3300014968 | Bacteria | 1680 |
| 114 | Ga0206356_11403519 | 3300020070 | Bacteria | 1791 |
| 115 | Ga0206353_10436796 | 3300020082 | Bacteria | 2231 |
| 116 | Ga0214545_1000028 | 3300021324 | Bacteria | 127957 |
| 117 | Ga0214543_1000044 | 3300021327 | Bacteria | 158132 |
| 118 | Ga0209563_101020 | 3300025230 | Bacteria | 8156 |
| 119 | Ga0207425_1002884 | 3300025245 | Bacteria | 5777 |
| 120 | Ga0209677_106052 | 3300025253 | Bacteria | 2980 |
| 121 | Ga0209148_1000224 | 3300025254 | Bacteria | 92967 |
| 122 | Ga0209233_1003000 | 3300025261 | Bacteria | 6013 |
| 123 | Ga0209233_1004722 | 3300025261 | Bacteria | 4592 |
| 124 | Ga0209233_1012100 | 3300025261 | Bacteria | 2514 |
| 125 | Ga0209455_1000635 | 3300025272 | Bacteria | 21604 |
| 126 | Ga0209455_1005926 | 3300025272 | Bacteria | 3685 |
| 127 | Ga0209564_1002670 | 3300025295 | Bacteria | 13535 |
| 128 | Ga0209564_1007718 | 3300025295 | Bacteria | 5478 |
| 129 | Ga0209758_1000075 | 3300025297 | Bacteria | 271585 |
| 130 | Ga0209758_1000087 | 3300025297 | Bacteria | 254384 |
| 131 | Ga0209758_1001472 | 3300025297 | Bacteria | 27590 |
| 132 | Ga0209758_1003696 | 3300025297 | Bacteria | 13586 |
| 133 | Ga0209758_1006857 | 3300025297 | Bacteria | 7967 |
| 134 | Ga0209758_1019189 | 3300025297 | Bacteria | 3311 |
| 135 | Ga0209256_1009007 | 3300025299 | Bacteria | 4472 |
| 136 | Ga0207426_1000160 | 3300025302 | Bacteria | 174540 |
| 137 | Ga0207426_1000289 | 3300025302 | Bacteria | 99963 |
| 138 | Ga0207426_1006711 | 3300025302 | Bacteria | 4937 |
| 139 | Ga0207426_1025821 | 3300025302 | Bacteria | 1974 |
| 140 | Ga0209257_1000382 | 3300025304 | Bacteria | 88368 |
| 141 | Ga0209257_1010148 | 3300025304 | Bacteria | 4850 |
| 142 | Ga0207692_10004122 | 3300025898 | Bacteria | 5734 |
| 143 | Ga0207647_10006477 | 3300025904 | Bacteria | 8509 |
| 144 | Ga0207699_10000561 | 3300025906 | Bacteria | 18332 |
| 145 | Ga0207705_10031006 | 3300025909 | Bacteria | 3815 |
| 146 | Ga0207705_10135283 | 3300025909 | Bacteria | 1837 |
| 147 | Ga0207654_10049575 | 3300025911 | Bacteria | 2409 |
| 148 | Ga0207695_10000029 | 3300025913 | Bacteria | 548364 |
| 149 | Ga0207671_10005341 | 3300025914 | Bacteria | 11889 |
| 150 | Ga0207671_10030419 | 3300025914 | Bacteria | 4027 |
| 151 | Ga0207693_10003010 | 3300025915 | Bacteria | 14576 |
| 152 | Ga0207693_10115668 | 3300025915 | Bacteria | 2106 |
| 153 | Ga0207693_10181939 | 3300025915 | Bacteria | 1654 |
| 154 | Ga0207693_10321853 | 3300025915 | Bacteria | 1210 |
| 155 | Ga0207663_10034229 | 3300025916 | Bacteria | 3035 |
| 156 | Ga0207663_10242542 | 3300025916 | Bacteria | 1322 |
| 157 | Ga0207660_10220263 | 3300025917 | Bacteria | 1489 |
| 158 | Ga0207657_10021590 | 3300025919 | Bacteria | 6053 |
| 159 | Ga0207657_10051757 | 3300025919 | Bacteria | 3569 |
| 160 | Ga0207694_10032091 | 3300025924 | Bacteria | 4018 |
| 161 | Ga0207694_10118890 | 3300025924 | Bacteria | 2109 |
| 162 | Ga0207650_10133886 | 3300025925 | Bacteria | 1942 |
| 163 | Ga0207687_10097858 | 3300025927 | Bacteria | 2153 |
| 164 | Ga0207700_10136870 | 3300025928 | Bacteria | 2007 |
| 165 | Ga0207664_10190589 | 3300025929 | Bacteria | 1765 |
| 166 | Ga0207644_10082189 | 3300025931 | Bacteria | 2382 |
| 167 | Ga0207690_10271961 | 3300025932 | Bacteria | 1316 |
| 168 | Ga0207706_10085276 | 3300025933 | Bacteria | 2777 |
| 169 | Ga0207665_10050600 | 3300025939 | Bacteria | 2794 |
| 170 | Ga0207665_10240123 | 3300025939 | Bacteria | 1335 |
| 171 | Ga0207711_10032173 | 3300025941 | Bacteria | 4434 |
| 172 | Ga0207661_10109003 | 3300025944 | Bacteria | 2339 |
| 173 | Ga0207667_10085017 | 3300025949 | Bacteria | 3275 |
| 174 | Ga0207667_10487137 | 3300025949 | Bacteria | 1251 |
| 175 | Ga0207668_10136606 | 3300025972 | Bacteria | 1879 |
| 176 | Ga0207640_10036570 | 3300025981 | Bacteria | 3084 |
| 177 | Ga0207640_10400497 | 3300025981 | Bacteria | 1118 |
| 178 | Ga0207658_10024166 | 3300025986 | Bacteria | 4249 |
| 179 | Ga0207677_10038119 | 3300026023 | Bacteria | 3148 |
| 180 | Ga0207703_10368767 | 3300026035 | Bacteria | 1326 |
| 181 | Ga0207639_10526952 | 3300026041 | Bacteria | 1082 |
| 182 | Ga0207678_10030711 | 3300026067 | Bacteria | 4691 |
| 183 | Ga0207678_10043585 | 3300026067 | Bacteria | 3882 |
| 184 | Ga0207678_10064794 | 3300026067 | Bacteria | 3140 |
| 185 | Ga0207702_10001454 | 3300026078 | Bacteria | 23549 |
| 186 | Ga0207702_10028517 | 3300026078 | Bacteria | 4641 |
| 187 | Ga0207702_10057390 | 3300026078 | Bacteria | 3308 |
| 188 | Ga0207702_10350173 | 3300026078 | Bacteria | 1413 |
| 189 | Ga0207641_10024136 | 3300026088 | Bacteria | 5012 |
| 190 | Ga0207648_10113957 | 3300026089 | Bacteria | 2375 |
| 191 | Ga0207675_100084324 | 3300026118 | Bacteria | 2981 |
| 192 | Ga0207675_100183563 | 3300026118 | Bacteria | 2004 |
| 193 | Ga0207683_10464040 | 3300026121 | Bacteria | 1168 |
| 194 | Ga0207698_10025095 | 3300026142 | Bacteria | 4193 |
| 195 | Ga0207698_10045053 | 3300026142 | Bacteria | 3320 |
| 196 | Ga0207698_10147244 | 3300026142 | Bacteria | 2038 |
| 197 | Ga0207698_10258035 | 3300026142 | Bacteria | 1599 |
| 198 | Ga0209389_1000137 | 3300027296 | Bacteria | 63287 |
| 199 | Ga0209389_1000353 | 3300027296 | Bacteria | 27634 |
| 200 | Ga0209589_1003439 | 3300027357 | Bacteria | 27634 |
| 201 | Ga0209489_100192 | 3300027361 | Bacteria | 98028 |
| 202 | Ga0209489_107326 | 3300027361 | Bacteria | 16591 |
| 203 | Ga0268264_10000020 | 3300028381 | Bacteria | 483593 |
| 204 | Ga0265337_1001859 | 3300028556 | Bacteria | 10076 |
| 205 | Ga0265326_10005016 | 3300028558 | Bacteria | 4192 |
| 206 | Ga0265319_1002640 | 3300028563 | Bacteria | 9640 |
| 207 | Ga0265334_10000410 | 3300028573 | Bacteria | 22501 |
| 208 | Ga0265318_10005488 | 3300028577 | Bacteria | 5951 |
| 209 | Ga0265323_10000658 | 3300028653 | Bacteria | 18872 |
| 210 | Ga0265322_10006993 | 3300028654 | Bacteria | 3308 |
| 211 | Ga0265336_10000063 | 3300028666 | Bacteria | 98413 |
| 212 | Ga0265338_10000154 | 3300028800 | Bacteria | 125708 |
| 213 | Ga0265324_10002963 | 3300029957 | Bacteria | 8307 |
| 214 | Ga0307511_10089184 | 3300030521 | Bacteria | 2103 |
| 215 | Ga0265330_10054307 | 3300031235 | Bacteria | 1751 |
| 216 | Ga0265332_10007749 | 3300031238 | Bacteria | 4850 |
| 217 | Ga0265325_10020842 | 3300031241 | Bacteria | 3608 |
| 218 | Ga0265331_10117920 | 3300031250 | Bacteria | 1214 |
| 219 | Ga0307508_10000025 | 3300031616 | Bacteria | 174642 |
| 220 | Ga0265314_10005071 | 3300031711 | Bacteria | 12001 |
| 221 | Ga0265314_10030262 | 3300031711 | Bacteria | 4009 |
| 222 | Ga0265342_10000638 | 3300031712 | Bacteria | 36736 |
| 223 | Ga0307516_10097063 | 3300031730 | Bacteria | 2767 |
| 224 | Ga0307516_10111412 | 3300031730 | Bacteria | 2538 |
| 225 | Ga0307507_10092444 | 3300033179 | Bacteria | 2582 |
| 226 | Ga0307510_10024769 | 3300033180 | Bacteria | 6930 |
| 227 | Ga0307510_10044327 | 3300033180 | Bacteria | 4819 |
| 228 | Ga0307510_10094433 | 3300033180 | Bacteria | 2816 |
| 229 | Ga0316215_1006327 | 3300033544 | Bacteria | 1148 |
| 230 | Ga0373953_0029074 | 3300035117 | Bacteria | 2135 |
| 231 | Ga0373956_0012440 | 3300035119 | Bacteria | 3528 |
| 232 | Ga0373956_0082558 | 3300035119 | Bacteria | 1476 |
| 233 | Ga0373943_0002145 | 3300035170 | Bacteria | 8968 |
| 234 | Ga0373946_0001257 | 3300035171 | Bacteria | 8767 |
| 235 | Ga0373955_0002673 | 3300035172 | Bacteria | 7800 |
| 236 | Ga0373924_0005844 | 3300035410 | Bacteria | 4381 |
| 237 | Ga0373931_0007479 | 3300035691 | Bacteria | 5144 |
| 238 | Ga0373935_0000494 | 3300035692 | Bacteria | 20439 |
| 239 | Ga0373927_0002352 | 3300035695 | Bacteria | 13783 |
| 240 | Ga0373927_0003230 | 3300035695 | Bacteria | 11734 |
| 241 | Ga0373927_0024311 | 3300035695 | Bacteria | 3964 |
| 242 | Ga0373947_0002117 | 3300035725 | Bacteria | 12102 |
| 243 | Ga0373947_0055656 | 3300035725 | Bacteria | 2389 |
| 244 | Ga0373937_0184864 | 3300036401 | Bacteria | 1957 |
| 245 | Ga0372808_010345 | 3300036459 | Bacteria | 1312 |
| 246 | Ga0373925_0007140 | 3300037068 | Bacteria | 8162 |
| 247 | Ga0373925_0114334 | 3300037068 | Bacteria | 2088 |
| 248 | Ga0395899_0311363 | 3300037312 | Bacteria | 1063 |
| 249 | Ga0395900_0000943 | 3300037418 | Bacteria | 37925 |
| 250 | Ga0395898_0002974 | 3300037466 | Bacteria | 19263 |
| 251 | Ga0395898_0046280 | 3300037466 | Bacteria | 4273 |
| 252 | Ga0395905_0021852 | 3300037471 | Bacteria | 6052 |
| 253 | Ga0395905_0062455 | 3300037471 | Bacteria | 3485 |
| 254 | Ga0395905_0088532 | 3300037471 | Bacteria | 2902 |
| 255 | Ga0436364_1007205 | 3300037853 | Bacteria | 1674 |
| 256 | Ga0395901_0001973 | 3300038443 | Bacteria | 21111 |
| 257 | Ga0400483_139608 | 3300039062 | Bacteria | 5764 |
| 258 | Ga0400483_185274 | 3300039062 | Bacteria | 4901 |
| 259 | Ga0436365_0556026 | 3300039437 | Bacteria | 1330 |
| 260 | Ga0466972_0016158 | 3300044658 | Bacteria | 3730 |
| 261 | Ga0466972_0025155 | 3300044658 | Bacteria | 2953 |
| 262 | Ga0466972_0026707 | 3300044658 | Bacteria | 2860 |
| 263 | Ga0466965_0129236 | 3300044683 | Bacteria | 1309 |
| 264 | Ga0466966_0034958 | 3300044684 | Bacteria | 3248 |
| 265 | Ga0466961_0000029 | 3300044693 | Bacteria | 86710 |
| 266 | Ga0466963_0033929 | 3300044694 | Bacteria | 3318 |
| 267 | Ga0466963_0049448 | 3300044694 | Bacteria | 2781 |
| 268 | Ga0466964_0012459 | 3300044706 | Bacteria | 3217 |
| 269 | Ga0466968_0032351 | 3300044735 | Bacteria | 2175 |
| 270 | Ga0466957_0014169 | 3300044842 | Bacteria | 4639 |
| 271 | Ga0466957_0026990 | 3300044842 | Bacteria | 3410 |
| 272 | Ga0466960_0091707 | 3300044901 | Bacteria | 1550 |
| 273 | Ga0466959_0000533 | 3300045049 | Bacteria | 22053 |
| 274 | Ga0466959_0035145 | 3300045049 | Bacteria | 3708 |
| 275 | Ga0466959_0228406 | 3300045049 | Bacteria | 1289 |
| 276 | Ga0466958_0024101 | 3300045836 | Bacteria | 3578 |
| 277 | Ga0466958_0310358 | 3300045836 | Bacteria | 1013 |
| 278 | Ga0466967_0002064 | 3300045976 | Bacteria | 12276 |
| 279 | Ga0495603_0000237 | 3300046455 | Bacteria | 28782 |
| 280 | Ga0495603_0004991 | 3300046455 | Bacteria | 7942 |
| 281 | Ga0495603_0023749 | 3300046455 | Bacteria | 3709 |
| 282 | Ga0495629_0000772 | 3300046459 | Bacteria | 25859 |
| 283 | Ga0495638_0006370 | 3300046460 | Bacteria | 8597 |
| 284 | Ga0495638_0022968 | 3300046460 | Bacteria | 4086 |
| 285 | Ga0495641_0004443 | 3300046461 | Bacteria | 9917 |
| 286 | Ga0495651_0081569 | 3300046462 | Bacteria | 2441 |
| 287 | Ga0495580_0001324 | 3300046472 | Bacteria | 21841 |
| 288 | Ga0495582_0000209 | 3300046473 | Bacteria | 32511 |
| 289 | Ga0495639_0000387 | 3300046475 | Bacteria | 20931 |
| 290 | Ga0495664_0017088 | 3300046477 | Bacteria | 4144 |
| 291 | Ga0495664_0019150 | 3300046477 | Bacteria | 3932 |
| 292 | Ga0495664_0116664 | 3300046477 | Bacteria | 1614 |
| 293 | Ga0495584_0170921 | 3300046491 | Bacteria | 1105 |
| 294 | Ga0495594_0000342 | 3300046499 | Bacteria | 23227 |
| 295 | Ga0495606_0047231 | 3300046507 | Bacteria | 2839 |
| 296 | Ga0495606_0050544 | 3300046507 | Bacteria | 2719 |
| 297 | Ga0495606_0156710 | 3300046507 | Bacteria | 1332 |
| 298 | Ga0495608_0032019 | 3300046511 | Bacteria | 3554 |
| 299 | Ga0495608_0046562 | 3300046511 | Bacteria | 2886 |
| 300 | Ga0495618_0134916 | 3300046514 | Bacteria | 1579 |
| 301 | Ga0495628_0064005 | 3300046516 | Bacteria | 2880 |
| 302 | Ga0495631_0059022 | 3300046518 | Bacteria | 1668 |
| 303 | Ga0495643_0010018 | 3300046522 | Bacteria | 5850 |
| 304 | Ga0495648_0046159 | 3300046524 | Bacteria | 2703 |
| 305 | Ga0495652_0079703 | 3300046529 | Bacteria | 2706 |
| 306 | Ga0495665_0000280 | 3300046531 | Bacteria | 25894 |
| 307 | Ga0495640_0001578 | 3300046533 | Bacteria | 17975 |
| 308 | Ga0495587_0059147 | 3300046536 | Bacteria | 2250 |
| 309 | Ga0495645_0042873 | 3300046543 | Bacteria | 3300 |
| 310 | Ga0495645_0305447 | 3300046543 | Bacteria | 1038 |
| 311 | Ga0495622_0004227 | 3300046557 | Bacteria | 6694 |
| 312 | Ga0495622_0004573 | 3300046557 | Bacteria | 6407 |
| 313 | Ga0495667_0042094 | 3300046559 | Bacteria | 3028 |
| 314 | Ga0495634_0000865 | 3300046642 | Bacteria | 29129 |
| 315 | Ga0495634_0135607 | 3300046642 | Bacteria | 1566 |
| 316 | Ga0495625_0066671 | 3300046660 | Bacteria | 2535 |
| 317 | Ga0495635_0003213 | 3300046663 | Bacteria | 11263 |
| 318 | Ga0495635_0017357 | 3300046663 | Bacteria | 5028 |
| 319 | Ga0495661_0023616 | 3300046665 | Bacteria | 3988 |
| 320 | Ga0495588_0030385 | 3300046674 | Bacteria | 2715 |
| 321 | Ga0495588_0123030 | 3300046674 | Bacteria | 1368 |
| 322 | Ga0495588_0138150 | 3300046674 | Bacteria | 1287 |
| 323 | Ga0495657_0011035 | 3300046675 | Bacteria | 6774 |
| 324 | Ga0495657_0029981 | 3300046675 | Bacteria | 3812 |
| 325 | Ga0495658_0004391 | 3300046683 | Bacteria | 6944 |
| 326 | Ga0495613_0003086 | 3300046689 | Bacteria | 12448 |
| 327 | Ga0495613_0280465 | 3300046689 | Bacteria | 1157 |
| 328 | Ga0495624_0001082 | 3300046690 | Bacteria | 21523 |
| 329 | Ga0495670_0032726 | 3300046691 | Bacteria | 2586 |
| 330 | Ga0495671_0023365 | 3300046692 | Bacteria | 3230 |
| 331 | Ga0495581_0022904 | 3300047315 | Bacteria | 3618 |
| 332 | Ga0495581_0035677 | 3300047315 | Bacteria | 2877 |
| 333 | Ga0495604_0016851 | 3300047317 | Bacteria | 5844 |
| 334 | Ga0495674_0004372 | 3300047319 | Bacteria | 13583 |
| 335 | Ga0495674_0024884 | 3300047319 | Bacteria | 5496 |
| 336 | Ga0495672_0111865 | 3300047320 | Bacteria | 1464 |
| 337 | Ga0495676_0009743 | 3300047321 | Bacteria | 8733 |
| 338 | Ga0495676_0179397 | 3300047321 | Bacteria | 1485 |
| 339 | Ga0495680_0106242 | 3300047322 | Bacteria | 2086 |
| 340 | Ga0495683_0007012 | 3300047323 | Bacteria | 6119 |
| 341 | Ga0495687_011591 | 3300047443 | Bacteria | 4727 |
| 342 | Ga0495675_0106351 | 3300047444 | Bacteria | 1753 |
| 343 | Ga0495684_0005777 | 3300047471 | Bacteria | 9626 |
| 344 | Ga0495686_0052830 | 3300047472 | Bacteria | 2547 |
| 345 | Ga0495686_0066199 | 3300047472 | Bacteria | 2233 |
| 346 | Ga0495686_0100399 | 3300047472 | Bacteria | 1746 |
| 347 | Ga0495593_0000238 | 3300047673 | Bacteria | 29664 |
| 348 | Ga0495593_0018220 | 3300047673 | Bacteria | 3948 |
| 349 | Ga0495593_0140641 | 3300047673 | Bacteria | 1223 |
| 350 | Ga0495602_0121244 | 3300048088 | Bacteria | 2103 |
| 351 | Ga0495614_0027859 | 3300048089 | Bacteria | 2436 |
| 352 | Ga0496101_0018685 | 3300048904 | Bacteria | 4717 |
| 353 | Ga0496101_0125245 | 3300048904 | Bacteria | 1947 |
| 354 | Ga0496101_0253962 | 3300048904 | Bacteria | 1370 |
| 355 | Ga0496102_0001874 | 3300048905 | Bacteria | 18120 |
| 356 | Ga0496102_0408515 | 3300048905 | Bacteria | 1276 |
| 357 | Ga0496102_0466857 | 3300048905 | Bacteria | 1183 |
| 358 | Ga0496103_0002168 | 3300048906 | Bacteria | 12474 |
| 359 | Ga0496103_0117414 | 3300048906 | Bacteria | 1693 |
| 360 | Ga0496104_0004135 | 3300048907 | Bacteria | 12598 |
| 361 | Ga0496104_0019755 | 3300048907 | Bacteria | 6168 |
| 362 | Ga0496104_0022321 | 3300048907 | Bacteria | 5813 |
| 363 | Ga0496105_0006240 | 3300048908 | Bacteria | 9152 |
| 364 | Ga0496105_0123905 | 3300048908 | Bacteria | 2130 |
| 365 | Ga0496106_0008194 | 3300048909 | Bacteria | 7724 |
| 366 | Ga0496106_0058907 | 3300048909 | Bacteria | 2909 |
| 367 | Ga0496107_0068287 | 3300048910 | Bacteria | 2580 |
| 368 | Ga0496108_0123258 | 3300048911 | Bacteria | 2224 |
| 369 | Ga0496109_0070568 | 3300048912 | Bacteria | 3206 |
| 370 | Ga0496109_0511656 | 3300048912 | Bacteria | 1133 |
| 371 | Ga0496110_0021529 | 3300048913 | Bacteria | 5462 |
| 372 | Ga0496110_0053113 | 3300048913 | Bacteria | 3561 |
| 373 | Ga0496111_0076159 | 3300048914 | Bacteria | 2445 |
| 374 | Ga0496112_0006808 | 3300048915 | Bacteria | 10073 |
| 375 | Ga0496112_0029058 | 3300048915 | Bacteria | 5344 |
| 376 | Ga0496112_0043753 | 3300048915 | Bacteria | 4385 |
| 377 | Ga0496112_0169163 | 3300048915 | Bacteria | 2151 |
| 378 | Ga0496113_0211644 | 3300048916 | Bacteria | 1543 |
| 379 | Ga0496115_0007927 | 3300048918 | Bacteria | 7835 |
| 380 | Ga0496115_0031944 | 3300048918 | Bacteria | 4151 |
| 381 | Ga0496115_0041576 | 3300048918 | Bacteria | 3659 |
| 382 | Ga0496115_0071326 | 3300048918 | Bacteria | 2817 |
| 383 | Ga0496116_0037607 | 3300048919 | Bacteria | 3373 |
| 384 | Ga0496116_0110232 | 3300048919 | Bacteria | 1620 |
| 385 | Ga0496117_0064917 | 3300048920 | Bacteria | 2485 |
| 386 | Ga0496117_0066703 | 3300048920 | Bacteria | 2439 |
| 387 | Ga0496117_0083776 | 3300048920 | Bacteria | 2083 |
| 388 | Ga0496117_0124629 | 3300048920 | Bacteria | 1575 |
| 389 | Ga0496117_0135207 | 3300048920 | Bacteria | 1486 |
| 390 | Ga0496118_0012281 | 3300048921 | Bacteria | 8243 |
| 391 | Ga0496118_0050582 | 3300048921 | Bacteria | 3187 |
| 392 | Ga0496118_0088336 | 3300048921 | Bacteria | 2144 |
| 393 | Ga0496118_0198990 | 3300048921 | Bacteria | 1189 |
| 394 | Ga0496119_0014153 | 3300048922 | Bacteria | 6267 |
| 395 | Ga0496119_0226181 | 3300048922 | Bacteria | 955 |
| 396 | Ga0496120_0019887 | 3300048923 | Bacteria | 4282 |
| 397 | Ga0496120_0152667 | 3300048923 | Bacteria | 1159 |
| 398 | Ga0496121_0006808 | 3300048924 | Bacteria | 14001 |
| 399 | Ga0496121_0028079 | 3300048924 | Bacteria | 5247 |
| 400 | Ga0496121_0057700 | 3300048924 | Bacteria | 3215 |
| 401 | Ga0496121_0099694 | 3300048924 | Bacteria | 2244 |
| 402 | Ga0496121_0207651 | 3300048924 | Bacteria | 1390 |
| 403 | Ga0496122_0106238 | 3300048925 | Bacteria | 1859 |
| 404 | Ga0496122_0130188 | 3300048925 | Bacteria | 1601 |
| 405 | Ga0496123_0050611 | 3300048926 | Bacteria | 2774 |
| 406 | Ga0496124_0021977 | 3300048927 | Bacteria | 5866 |
| 407 | Ga0496124_0114609 | 3300048927 | Bacteria | 2164 |
| 408 | Ga0496124_0243128 | 3300048927 | Bacteria | 1337 |
| 409 | Ga0496125_0001999 | 3300048928 | Bacteria | 27642 |
| 410 | Ga0496125_0040960 | 3300048928 | Bacteria | 3966 |
| 411 | Ga0496125_0062019 | 3300048928 | Bacteria | 2993 |
| 412 | Ga0496125_0075096 | 3300048928 | Bacteria | 2617 |
| 413 | Ga0496125_0103437 | 3300048928 | Bacteria | 2090 |
| 414 | Ga0496125_0230291 | 3300048928 | Bacteria | 1185 |
| 415 | Ga0496126_0036078 | 3300048929 | Bacteria | 4627 |
| 416 | Ga0496126_0042281 | 3300048929 | Bacteria | 4209 |
| 417 | Ga0496126_0192430 | 3300048929 | Bacteria | 1727 |
| 418 | Ga0496126_0251548 | 3300048929 | Bacteria | 1472 |
| 419 | Ga0496126_0322864 | 3300048929 | Bacteria | 1268 |
| 420 | Ga0501031_0002641 | 3300049568 | Bacteria | 11413 |
| 421 | Ga0501031_0106017 | 3300049568 | Bacteria | 1834 |
| 422 | Ga0501032_0002207 | 3300049569 | Bacteria | 15325 |
| 423 | Ga0501032_0050080 | 3300049569 | Bacteria | 2817 |
| 424 | Ga0501032_0212433 | 3300049569 | Bacteria | 1261 |
| 425 | Ga0501033_0000124 | 3300049570 | Bacteria | 74731 |
| 426 | Ga0501033_0056696 | 3300049570 | Bacteria | 2895 |
| 427 | Ga0501034_0019549 | 3300049571 | Bacteria | 6926 |
| 428 | Ga0501034_0154547 | 3300049571 | Bacteria | 2269 |
| 429 | Ga0501036_0000104 | 3300049572 | Bacteria | 52974 |
| 430 | Ga0501036_0020262 | 3300049572 | Bacteria | 5585 |
| 431 | Ga0501037_0000247 | 3300049573 | Bacteria | 46080 |
| 432 | Ga0501037_0032929 | 3300049573 | Bacteria | 3830 |
| 433 | Ga0501038_0000041 | 3300049574 | Bacteria | 120557 |
| 434 | Ga0501038_0237935 | 3300049574 | Bacteria | 1446 |
| 435 | Ga0501039_0000064 | 3300049575 | Bacteria | 83415 |
| 436 | Ga0501046_0080151 | 3300049580 | Bacteria | 2523 |
| 437 | Ga0501047_0000392 | 3300049581 | Bacteria | 49114 |
| 438 | Ga0501047_0008093 | 3300049581 | Bacteria | 9921 |
| 439 | Ga0501047_0051691 | 3300049581 | Bacteria | 3971 |
| 440 | Ga0501048_0009128 | 3300049582 | Bacteria | 7462 |
| 441 | Ga0501068_0024106 | 3300049584 | Bacteria | 3571 |
| 442 | Ga0501069_0015986 | 3300049585 | Bacteria | 4025 |
| 443 | Ga0501070_0000175 | 3300049586 | Bacteria | 59483 |
| 444 | Ga0501070_0127455 | 3300049586 | Bacteria | 2103 |
| 445 | Ga0501070_0130813 | 3300049586 | Bacteria | 2073 |
| 446 | Ga0501073_0034325 | 3300049589 | Bacteria | 3611 |
| 447 | Ga0501074_0005773 | 3300049590 | Bacteria | 8929 |
| 448 | Ga0501074_0046422 | 3300049590 | Bacteria | 3141 |
| 449 | Ga0501074_0070785 | 3300049590 | Bacteria | 2507 |
| 450 | Ga0501075_0169726 | 3300049591 | Bacteria | 1664 |
| 451 | Ga0501249_000109 | 3300049679 | Bacteria | 25443 |
| 452 | Ga0501080_0013998 | 3300049742 | Bacteria | 7383 |
| 453 | Ga0501080_0235787 | 3300049742 | Bacteria | 1671 |
| 454 | Ga0501035_0000155 | 3300049822 | Bacteria | 84012 |
| 455 | Ga0501035_0217664 | 3300049822 | Bacteria | 1632 |
| 456 | Ga0501035_0239608 | 3300049822 | Bacteria | 1543 |
| 457 | Ga0501044_0052450 | 3300049823 | Bacteria | 4202 |
| 458 | Ga0501044_0149764 | 3300049823 | Bacteria | 2316 |
| 459 | Ga0501044_0188517 | 3300049823 | Bacteria | 2026 |
| 460 | Ga0501044_0305575 | 3300049823 | Bacteria | 1518 |
| 461 | Ga0501044_0477102 | 3300049823 | Bacteria | 1151 |
| 462 | Ga0501044_0516659 | 3300049823 | Bacteria | 1094 |
| 463 | nmdc:mga03n38_9307_c1 | 3300050490 | Bacteria | 3567 |
| 464 | nmdc:mga0yw44_12005_c1 | 3300050492 | Bacteria | 4497 |
| 465 | nmdc:mga0yw44_2009_c1 | 3300050492 | Bacteria | 7778 |
| 466 | nmdc:mga0yw44_26139_c1 | 3300050492 | Bacteria | 3330 |
| 467 | nmdc:mga0yw44_33015_c1 | 3300050492 | Bacteria | 3021 |
| 468 | nmdc:mga0yw44_723_c1 | 3300050492 | Bacteria | 12145 |
| 469 | nmdc:mga06z11_86157_c1 | 3300050494 | Bacteria | 1696 |
| 470 | nmdc:mga0sz30_117968_c1 | 3300050516 | Bacteria | 1165 |
| 471 | nmdc:mga0sz30_87711_c1 | 3300050516 | Bacteria | 1351 |
| 472 | Ga0495601_0024808 | 3300053077 | Bacteria | 3693 |
| 473 | Ga0495601_0070957 | 3300053077 | Bacteria | 2224 |
| 474 | Ga0495601_0110795 | 3300053077 | Bacteria | 1778 |
| 475 | Ga0500635_0005633 | 3300053080 | Bacteria | 3299 |
| 476 | Ga0500635_0019411 | 3300053080 | Bacteria | 2066 |
| 477 | Ga0495619_0350524 | 3300053085 | Bacteria | 1021 |
| 478 | Ga0500578_0033112 | 3300053086 | Bacteria | 3322 |
| 479 | Ga0500578_0058889 | 3300053086 | Bacteria | 2455 |
| 480 | Ga0500643_000037 | 3300053087 | Bacteria | 180821 |
| 481 | Ga0500644_0045195 | 3300053088 | Bacteria | 1482 |
| 482 | Ga0500646_0023844 | 3300053090 | Bacteria | 1644 |
| 483 | Ga0500583_0059845 | 3300053092 | Bacteria | 1794 |
| 484 | Ga0500566_0000166 | 3300053094 | Bacteria | 33843 |
| 485 | Ga0500566_0002225 | 3300053094 | Bacteria | 11453 |
| 486 | Ga0500554_000266 | 3300053102 | Bacteria | 11311 |
| 487 | Ga0500555_000550 | 3300053103 | Bacteria | 14953 |
| 488 | Ga0500556_0000089 | 3300053104 | Bacteria | 84468 |
| 489 | Ga0500557_000047 | 3300053105 | Bacteria | 59226 |
| 490 | Ga0500562_002316 | 3300053108 | Bacteria | 4777 |
| 491 | Ga0500569_000281 | 3300053109 | Bacteria | 8048 |
| 492 | Ga0500569_005744 | 3300053109 | Bacteria | 2682 |
| 493 | Ga0500569_033619 | 3300053109 | Bacteria | 1458 |
| 494 | Ga0500569_070348 | 3300053109 | Bacteria | 1100 |
| 495 | Ga0500572_000614 | 3300053111 | Bacteria | 11989 |
| 496 | Ga0500572_009367 | 3300053111 | Bacteria | 2314 |
| 497 | Ga0500594_0006659 | 3300053118 | Bacteria | 2603 |
| 498 | Ga0500595_014345 | 3300053119 | Bacteria | 3007 |
| 499 | Ga0500642_0000030 | 3300053130 | Bacteria | 115114 |
| 500 | Ga0500642_0000071 | 3300053130 | Bacteria | 55663 |
| 501 | Ga0500652_001206 | 3300053131 | Bacteria | 8252 |
| 502 | Ga0500658_0027909 | 3300053134 | Bacteria | 2186 |
| 503 | Ga0500559_0000136 | 3300053136 | Bacteria | 56922 |
| 504 | Ga0500559_0002659 | 3300053136 | Bacteria | 9097 |
| 505 | Ga0500559_0013191 | 3300053136 | Bacteria | 3499 |
| 506 | Ga0500568_0005713 | 3300053139 | Bacteria | 6378 |
| 507 | Ga0500573_0015952 | 3300053140 | Bacteria | 4261 |
| 508 | Ga0500586_000203 | 3300053145 | Bacteria | 11555 |
| 509 | Ga0500603_000324 | 3300053150 | Bacteria | 12495 |
| 510 | Ga0500616_0000026 | 3300053153 | Bacteria | 454314 |
| 511 | Ga0500616_0019257 | 3300053153 | Bacteria | 3849 |
| 512 | Ga0500616_0055446 | 3300053153 | Bacteria | 2073 |
| 513 | Ga0500620_000914 | 3300053155 | Bacteria | 5136 |
| 514 | Ga0500622_0001149 | 3300053156 | Bacteria | 22026 |
| 515 | Ga0500622_0001752 | 3300053156 | Bacteria | 16718 |
| 516 | Ga0500634_0093229 | 3300053161 | Bacteria | 1523 |
| 517 | Ga0500634_0149545 | 3300053161 | Bacteria | 1094 |
| 518 | Ga0500639_029038 | 3300053163 | Bacteria | 2923 |
| 519 | Ga0500639_086960 | 3300053163 | Bacteria | 1564 |
| 520 | Ga0500636_0004341 | 3300053177 | Bacteria | 8020 |
| 521 | Ga0500636_0028276 | 3300053177 | Bacteria | 3311 |
| 522 | Ga0500636_0030053 | 3300053177 | Bacteria | 3212 |
| 523 | Ga0500637_0000582 | 3300053178 | Bacteria | 14362 |
| 524 | Ga0500576_005569 | 3300053725 | Bacteria | 5228 |
| 525 | Ga0500625_002984 | 3300053729 | Bacteria | 6534 |
| 526 | Ga0500609_000505 | 3300053731 | Bacteria | 5838 |
| 527 | Ga0500596_002967 | 3300053735 | Bacteria | 3281 |
| 528 | Ga0500599_000769 | 3300053736 | Bacteria | 3510 |
| 529 | Ga0500601_000014 | 3300053737 | Bacteria | 41972 |
| 530 | Ga0466962_0157617 | 3300061719 | Bacteria | 1103 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 8019648815 | 8019656001 | 295 |
| 2 | 3300044683 | Ga0466965_0129236 | Ga0466965_0129236_382_1275 | 297 |
| 3 | 3300048908 | Ga0496105_0123905 | Ga0496105_0123905_1210_2109 | 299 |
| 4 | 3300048918 | Ga0496115_0031944 | Ga0496115_0031944_24_923 | 299 |
| 5 | 3300048922 | Ga0496119_0226181 | Ga0496119_0226181_37_936 | 299 |
| 6 | 3300053736 | Ga0500599_000769 | Ga0500599_000769_2583_3482 | 299 |
| 7 | 3300061719 | Ga0466962_0157617 | Ga0466962_0157617_168_1067 | 299 |
| 8 | 3300005548 | Ga0070665_100020007 | Ga0070665_1000200076 | 309 |
| 9 | 3300045836 | Ga0466958_0310358 | Ga0466958_0310358_61_996 | 311 |
| 10 | iso_pu_bacteria | 2515154112 | 2515628658 | 312 |
| 11 | iso_pu_bacteria | 2932784394 | 2932793107 | 312 |
| 12 | iso_pu_bacteria | 2932809354 | 2932814587 | 312 |
| 13 | iso_pu_bacteria | 2932828146 | 2932836567 | 312 |
| 14 | iso_pu_bacteria | 2935675223 | 2935682501 | 312 |
| 15 | iso_pu_bacteria | 8017057580 | 8017060784 | 312 |
| 16 | 3300005436 | Ga0070713_100037231 | Ga0070713_1000372312 | 313 |
| 17 | 3300035695 | Ga0373927_0024311 | Ga0373927_0024311_1728_2669 | 313 |
| 18 | 3300036459 | Ga0372808_010345 | Ga0372808_010345_190_1131 | 313 |
| 19 | 3300037312 | Ga0395899_0311363 | Ga0395899_0311363_40_981 | 313 |
| 20 | 3300044684 | Ga0466966_0034958 | Ga0466966_0034958_1448_2389 | 313 |
| 21 | 3300044842 | Ga0466957_0014169 | Ga0466957_0014169_1574_2515 | 313 |
| 22 | 3300045049 | Ga0466959_0035145 | Ga0466959_0035145_1553_2494 | 313 |
| 23 | 3300045836 | Ga0466958_0024101 | Ga0466958_0024101_896_1837 | 313 |
| 24 | 3300048928 | Ga0496125_0230291 | Ga0496125_0230291_31_972 | 313 |
| 25 | 3300049569 | Ga0501032_0212433 | Ga0501032_0212433_166_1107 | 313 |
| 26 | 3300049570 | Ga0501033_0056696 | Ga0501033_0056696_517_1458 | 313 |
| 27 | 3300049572 | Ga0501036_0020262 | Ga0501036_0020262_3365_4306 | 313 |
| 28 | 3300049574 | Ga0501038_0237935 | Ga0501038_0237935_472_1413 | 313 |
| 29 | 3300049822 | Ga0501035_0239608 | Ga0501035_0239608_42_983 | 313 |
| 30 | 3300049823 | Ga0501044_0149764 | Ga0501044_0149764_1331_2272 | 313 |
| 31 | 3300049823 | Ga0501044_0516659 | Ga0501044_0516659_52_993 | 313 |
| 32 | 3300050492 | nmdc:mga0yw44_12005_c1 | nmdc:mga0yw44_12005_c1_2618_3559 | 313 |
| 33 | 3300053088 | Ga0500644_0045195 | Ga0500644_0045195_308_1249 | 313 |
| 34 | 3300053153 | Ga0500616_0055446 | Ga0500616_0055446_50_991 | 313 |
| 35 | 3300053161 | Ga0500634_0149545 | Ga0500634_0149545_34_975 | 313 |
| 36 | 3300005843 | Ga0068860_100000302 | Ga0068860_10000030251 | 314 |
| 37 | 3300028381 | Ga0268264_10000020 | Ga0268264_10000020153 | 314 |
| 38 | 3300047673 | Ga0495593_0140641 | Ga0495593_0140641_262_1206 | 314 |
| 39 | 3300048904 | Ga0496101_0125245 | Ga0496101_0125245_600_1544 | 314 |
| 40 | 3300048905 | Ga0496102_0466857 | Ga0496102_0466857_210_1154 | 314 |
| 41 | 3300050494 | nmdc:mga06z11_86157_c1 | nmdc:mga06z11_86157_c1_521_1489 | 314 |
| 42 | 3300005458 | Ga0070681_10021162 | Ga0070681_100211625 | 315 |
| 43 | 3300005366 | Ga0070659_100011570 | Ga0070659_1000115702 | 316 |
| 44 | 3300005530 | Ga0070679_100428715 | Ga0070679_1004287152 | 316 |
| 45 | 3300005563 | Ga0068855_100378096 | Ga0068855_1003780962 | 316 |
| 46 | 3300007265 | Ga0099794_10079129 | Ga0099794_100791292 | 316 |
| 47 | 3300007788 | Ga0099795_10037287 | Ga0099795_100372872 | 316 |
| 48 | 3300007788 | Ga0099795_10043594 | Ga0099795_100435942 | 316 |
| 49 | 3300026118 | Ga0207675_100183563 | Ga0207675_1001835632 | 316 |
| 50 | 3300035695 | Ga0373927_0003230 | Ga0373927_0003230_1279_2229 | 316 |
| 51 | 3300035725 | Ga0373947_0002117 | Ga0373947_0002117_10065_11015 | 316 |
| 52 | 3300037068 | Ga0373925_0114334 | Ga0373925_0114334_894_1844 | 316 |
| 53 | 3300039062 | Ga0400483_139608 | Ga0400483_139608_1382_2332 | 316 |
| 54 | 3300039062 | Ga0400483_185274 | Ga0400483_185274_2261_3211 | 316 |
| 55 | 3300044694 | Ga0466963_0033929 | Ga0466963_0033929_1204_2154 | 316 |
| 56 | 3300044694 | Ga0466963_0049448 | Ga0466963_0049448_238_1188 | 316 |
| 57 | 3300045976 | Ga0466967_0002064 | Ga0466967_0002064_6097_7047 | 316 |
| 58 | 3300046455 | Ga0495603_0004991 | Ga0495603_0004991_5926_6876 | 316 |
| 59 | 3300046455 | Ga0495603_0023749 | Ga0495603_0023749_1190_2140 | 316 |
| 60 | 3300046518 | Ga0495631_0059022 | Ga0495631_0059022_33_983 | 316 |
| 61 | 3300046529 | Ga0495652_0079703 | Ga0495652_0079703_17_967 | 316 |
| 62 | 3300046543 | Ga0495645_0305447 | Ga0495645_0305447_17_967 | 316 |
| 63 | 3300046683 | Ga0495658_0004391 | Ga0495658_0004391_20_970 | 316 |
| 64 | 3300047320 | Ga0495672_0111865 | Ga0495672_0111865_479_1429 | 316 |
| 65 | 3300047472 | Ga0495686_0100399 | Ga0495686_0100399_268_1218 | 316 |
| 66 | 3300048088 | Ga0495602_0121244 | Ga0495602_0121244_1129_2079 | 316 |
| 67 | 3300048918 | Ga0496115_0041576 | Ga0496115_0041576_1328_2278 | 316 |
| 68 | 3300053080 | Ga0500635_0005633 | Ga0500635_0005633_1736_2686 | 316 |
| 69 | 3300053102 | Ga0500554_000266 | Ga0500554_000266_1426_2376 | 316 |
| 70 | 3300053105 | Ga0500557_000047 | Ga0500557_000047_4894_5844 | 316 |
| 71 | 3300053130 | Ga0500642_0000071 | Ga0500642_0000071_12793_13743 | 316 |
| 72 | 3300053150 | Ga0500603_000324 | Ga0500603_000324_7802_8752 | 316 |
| 73 | 3300053178 | Ga0500637_0000582 | Ga0500637_0000582_5619_6569 | 316 |
| 74 | 3300053729 | Ga0500625_002984 | Ga0500625_002984_395_1345 | 316 |
| 75 | iso_pu_bacteria | 8054302542 | 8054303252 | 322 |
| 76 | iso_pu_bacteria | 2857524615 | 2857529848 | 323 |
| 77 | iso_pu_bacteria | 2893066018 | 2893069505 | 323 |
| 78 | iso_pu_bacteria | 2919073203 | 2919077296 | 323 |
| 79 | 3300005327 | Ga0070658_10003236 | Ga0070658_1000323613 | 324 |
| 80 | 3300005336 | Ga0070680_100010261 | Ga0070680_1000102613 | 324 |
| 81 | 3300005339 | Ga0070660_100035699 | Ga0070660_1000356992 | 324 |
| 82 | 3300005530 | Ga0070679_100067219 | Ga0070679_1000672193 | 324 |
| 83 | 3300005563 | Ga0068855_100026681 | Ga0068855_1000266815 | 324 |
| 84 | 3300005563 | Ga0068855_100097901 | Ga0068855_1000979013 | 324 |
| 85 | 3300005614 | Ga0068856_100033270 | Ga0068856_1000332705 | 324 |
| 86 | 3300005616 | Ga0068852_100008740 | Ga0068852_1000087404 | 324 |
| 87 | 3300009551 | Ga0105238_10081124 | Ga0105238_100811242 | 324 |
| 88 | 3300013100 | Ga0157373_10149035 | Ga0157373_101490352 | 324 |
| 89 | 3300013105 | Ga0157369_10129388 | Ga0157369_101293882 | 324 |
| 90 | 3300025909 | Ga0207705_10031006 | Ga0207705_100310063 | 324 |
| 91 | 3300025909 | Ga0207705_10135283 | Ga0207705_101352832 | 324 |
| 92 | 3300025917 | Ga0207660_10220263 | Ga0207660_102202632 | 324 |
| 93 | 3300025924 | Ga0207694_10032091 | Ga0207694_100320912 | 324 |
| 94 | 3300025949 | Ga0207667_10085017 | Ga0207667_100850172 | 324 |
| 95 | 3300026142 | Ga0207698_10025095 | Ga0207698_100250953 | 324 |
| 96 | 3300031711 | Ga0265314_10030262 | Ga0265314_100302622 | 324 |
| 97 | 3300031712 | Ga0265342_10000638 | Ga0265342_1000063819 | 324 |
| 98 | 3300049581 | Ga0501047_0008093 | Ga0501047_0008093_6261_7235 | 324 |
| 99 | 3300049590 | Ga0501074_0046422 | Ga0501074_0046422_1269_2243 | 324 |
| 100 | 3300049822 | Ga0501035_0217664 | Ga0501035_0217664_158_1132 | 324 |
| 101 | 3300049823 | Ga0501044_0305575 | Ga0501044_0305575_186_1160 | 324 |
| 102 | iso_pu_bacteria | 2857509624 | 2857516139 | 324 |
| 103 | 3300035117 | Ga0373953_0029074 | Ga0373953_0029074_502_1479 | 325 |
| 104 | 3300035119 | Ga0373956_0012440 | Ga0373956_0012440_2252_3229 | 325 |
| 105 | 3300036401 | Ga0373937_0184864 | Ga0373937_0184864_547_1524 | 325 |
| 106 | 3300046491 | Ga0495584_0170921 | Ga0495584_0170921_57_1034 | 325 |
| 107 | 3300046642 | Ga0495634_0135607 | Ga0495634_0135607_445_1422 | 325 |
| 108 | 3300047322 | Ga0495680_0106242 | Ga0495680_0106242_548_1525 | 325 |
| 109 | 3300047444 | Ga0495675_0106351 | Ga0495675_0106351_327_1304 | 325 |
| 110 | 3300047673 | Ga0495593_0018220 | Ga0495593_0018220_2342_3319 | 325 |
| 111 | iso_pu_bacteria | 2906626472 | 2906634097 | 325 |
| 112 | iso_pu_bacteria | 2937843397 | 2937846012 | 325 |
| 113 | iso_pu_bacteria | 8016583857 | 8016590062 | 325 |
| 114 | 3300005327 | Ga0070658_10010916 | Ga0070658_100109162 | 326 |
| 115 | 3300005336 | Ga0070680_100320974 | Ga0070680_1003209742 | 326 |
| 116 | 3300009093 | Ga0105240_10022848 | Ga0105240_100228483 | 326 |
| 117 | 3300013102 | Ga0157371_10265631 | Ga0157371_102656312 | 326 |
| 118 | 3300013105 | Ga0157369_10042862 | Ga0157369_100428624 | 326 |
| 119 | 3300020070 | Ga0206356_11403519 | Ga0206356_114035192 | 326 |
| 120 | 3300020082 | Ga0206353_10436796 | Ga0206353_104367962 | 326 |
| 121 | 3300025919 | Ga0207657_10051757 | Ga0207657_100517572 | 326 |
| 122 | 3300025949 | Ga0207667_10487137 | Ga0207667_104871372 | 326 |
| 123 | 3300026078 | Ga0207702_10057390 | Ga0207702_100573903 | 326 |
| 124 | 3300044901 | Ga0466960_0091707 | Ga0466960_0091707_167_1147 | 326 |
| 125 | 3300049571 | Ga0501034_0154547 | Ga0501034_0154547_1259_2239 | 326 |
| 126 | 3300049590 | Ga0501074_0070785 | Ga0501074_0070785_92_1075 | 326 |
| 127 | 3300049679 | Ga0501249_000109 | Ga0501249_000109_5141_6136 | 326 |
| 128 | 3300049742 | Ga0501080_0235787 | Ga0501080_0235787_234_1217 | 326 |
| 129 | 3300049823 | Ga0501044_0477102 | Ga0501044_0477102_107_1090 | 326 |
| 130 | iso_pu_bacteria | 2507262055 | 2507510606 | 326 |
| 131 | iso_pu_bacteria | 2508501009 | 2508544408 | 326 |
| 132 | iso_pu_bacteria | 2508501042 | 2508697451 | 326 |
| 133 | iso_pu_bacteria | 2511231028 | 2511396334 | 326 |
| 134 | iso_pu_bacteria | 2513237092 | 2513628817 | 326 |
| 135 | iso_pu_bacteria | 2513237094 | 2513640200 | 326 |
| 136 | iso_pu_bacteria | 2513237102 | 2513703830 | 326 |
| 137 | iso_pu_bacteria | 2513237104 | 2513715860 | 326 |
| 138 | iso_pu_bacteria | 2513237139 | 2513877762 | 326 |
| 139 | iso_pu_bacteria | 2513237161 | 2514015047 | 326 |
| 140 | iso_pu_bacteria | 2517093001 | 2517105518 | 326 |
| 141 | iso_pu_bacteria | 2524023205 | 2524437009 | 326 |
| 142 | iso_pu_bacteria | 2528768022 | 2528852288 | 326 |
| 143 | iso_pu_bacteria | 2617270735 | 2617350023 | 326 |
| 144 | iso_pu_bacteria | 2617270741 | 2617378702 | 326 |
| 145 | iso_pu_bacteria | 2744054633 | 2745076161 | 326 |
| 146 | iso_pu_bacteria | 2791355196 | 2793063371 | 326 |
| 147 | iso_pu_bacteria | 2802429603 | 2805917110 | 326 |
| 148 | iso_pu_bacteria | 2816332527 | 2818243555 | 326 |
| 149 | iso_pu_bacteria | 2824617872 | 2824621735 | 326 |
| 150 | iso_pu_bacteria | 2824626560 | 2824630796 | 326 |
| 151 | iso_pu_bacteria | 2824635225 | 2824637427 | 326 |
| 152 | iso_pu_bacteria | 2824644064 | 2824646324 | 326 |
| 153 | iso_pu_bacteria | 2824679649 | 2824682340 | 326 |
| 154 | iso_pu_bacteria | 2824704595 | 2824705694 | 326 |
| 155 | iso_pu_bacteria | 2824714736 | 2824717488 | 326 |
| 156 | iso_pu_bacteria | 2824723954 | 2824726716 | 326 |
| 157 | iso_pu_bacteria | 2824732956 | 2824733671 | 326 |
| 158 | iso_pu_bacteria | 2824746037 | 2824747971 | 326 |
| 159 | iso_pu_bacteria | 2824753945 | 2824756376 | 326 |
| 160 | iso_pu_bacteria | 2824763712 | 2824764061 | 326 |
| 161 | iso_pu_bacteria | 2824773399 | 2824776737 | 326 |
| 162 | iso_pu_bacteria | 2838122688 | 2838125394 | 326 |
| 163 | iso_pu_bacteria | 2841941048 | 2841941946 | 326 |
| 164 | iso_pu_bacteria | 2841949485 | 2841951380 | 326 |
| 165 | iso_pu_bacteria | 2841957949 | 2841958937 | 326 |
| 166 | iso_pu_bacteria | 2841966195 | 2841968621 | 326 |
| 167 | iso_pu_bacteria | 2841974524 | 2841976178 | 326 |
| 168 | iso_pu_bacteria | 2841983080 | 2841987543 | 326 |
| 169 | iso_pu_bacteria | 2842038055 | 2842045084 | 326 |
| 170 | iso_pu_bacteria | 2842045827 | 2842049255 | 326 |
| 171 | iso_pu_bacteria | 2844315083 | 2844317321 | 326 |
| 172 | iso_pu_bacteria | 2847930680 | 2847934026 | 326 |
| 173 | iso_pu_bacteria | 2847939898 | 2847944685 | 326 |
| 174 | iso_pu_bacteria | 2849076700 | 2849081088 | 326 |
| 175 | iso_pu_bacteria | 2874612657 | 2874612944 | 326 |
| 176 | iso_pu_bacteria | 2874620515 | 2874620669 | 326 |
| 177 | iso_pu_bacteria | 2874628541 | 2874634733 | 326 |
| 178 | iso_pu_bacteria | 2874645413 | 2874646885 | 326 |
| 179 | iso_pu_bacteria | 2876761206 | 2876769392 | 326 |
| 180 | iso_pu_bacteria | 2879083081 | 2879086885 | 326 |
| 181 | iso_pu_bacteria | 2879127579 | 2879129888 | 326 |
| 182 | iso_pu_bacteria | 2879142872 | 2879146213 | 326 |
| 183 | iso_pu_bacteria | 2881364244 | 2881369200 | 326 |
| 184 | iso_pu_bacteria | 2881665667 | 2881667633 | 326 |
| 185 | iso_pu_bacteria | 2885366525 | 2885367415 | 326 |
| 186 | iso_pu_bacteria | 2885409591 | 2885417653 | 326 |
| 187 | iso_pu_bacteria | 2888378607 | 2888382006 | 326 |
| 188 | iso_pu_bacteria | 2888388044 | 2888388643 | 326 |
| 189 | iso_pu_bacteria | 2903727486 | 2903733293 | 326 |
| 190 | iso_pu_bacteria | 2904666416 | 2904666592 | 326 |
| 191 | iso_pu_bacteria | 2904711408 | 2904720356 | 326 |
| 192 | iso_pu_bacteria | 2906602504 | 2906606259 | 326 |
| 193 | iso_pu_bacteria | 2906643746 | 2906647532 | 326 |
| 194 | iso_pu_bacteria | 2908775508 | 2908778263 | 326 |
| 195 | iso_pu_bacteria | 2922368715 | 2922371959 | 326 |
| 196 | iso_pu_bacteria | 2922393267 | 2922399300 | 326 |
| 197 | iso_pu_bacteria | 2929615660 | 2929616699 | 326 |
| 198 | iso_pu_bacteria | 2929624759 | 2929625443 | 326 |
| 199 | iso_pu_bacteria | 2932794094 | 2932801239 | 326 |
| 200 | iso_pu_bacteria | 2932801729 | 2932803633 | 326 |
| 201 | iso_pu_bacteria | 2932818245 | 2932824652 | 326 |
| 202 | iso_pu_bacteria | 2933577622 | 2933578018 | 326 |
| 203 | iso_pu_bacteria | 2935608549 | 2935610661 | 326 |
| 204 | iso_pu_bacteria | 2935638405 | 2935646702 | 326 |
| 205 | iso_pu_bacteria | 2935648319 | 2935652432 | 326 |
| 206 | iso_pu_bacteria | 2935656913 | 2935661014 | 326 |
| 207 | iso_pu_bacteria | 2935665750 | 2935672628 | 326 |
| 208 | iso_pu_bacteria | 2935694250 | 2935699574 | 326 |
| 209 | iso_pu_bacteria | 2935703347 | 2935707811 | 326 |
| 210 | iso_pu_bacteria | 2935760218 | 2935761718 | 326 |
| 211 | iso_pu_bacteria | 2935769743 | 2935770559 | 326 |
| 212 | iso_pu_bacteria | 2935777560 | 2935782792 | 326 |
| 213 | iso_pu_bacteria | 2935785616 | 2935787156 | 326 |
| 214 | iso_pu_bacteria | 2935793552 | 2935795204 | 326 |
| 215 | iso_pu_bacteria | 2935801545 | 2935810086 | 326 |
| 216 | iso_pu_bacteria | 2935819856 | 2935820158 | 326 |
| 217 | iso_pu_bacteria | 2935827899 | 2935835969 | 326 |
| 218 | iso_pu_bacteria | 2935837841 | 2935844907 | 326 |
| 219 | iso_pu_bacteria | 2935847175 | 2935849831 | 326 |
| 220 | iso_pu_bacteria | 2935864058 | 2935870739 | 326 |
| 221 | iso_pu_bacteria | 2935873716 | 2935881388 | 326 |
| 222 | iso_pu_bacteria | 2935883170 | 2935887904 | 326 |
| 223 | iso_pu_bacteria | 2935908558 | 2935914479 | 326 |
| 224 | iso_pu_bacteria | 2935916978 | 2935919029 | 326 |
| 225 | iso_pu_bacteria | 2935926038 | 2935932140 | 326 |
| 226 | iso_pu_bacteria | 2935934488 | 2935940738 | 326 |
| 227 | iso_pu_bacteria | 2935942939 | 2935948675 | 326 |
| 228 | iso_pu_bacteria | 2935951376 | 2935957218 | 326 |
| 229 | iso_pu_bacteria | 2935959822 | 2935963648 | 326 |
| 230 | iso_pu_bacteria | 2935967501 | 2935973810 | 326 |
| 231 | iso_pu_bacteria | 2935984226 | 2935988949 | 326 |
| 232 | iso_pu_bacteria | 2936002035 | 2936005447 | 326 |
| 233 | iso_pu_bacteria | 2936011229 | 2936015071 | 326 |
| 234 | iso_pu_bacteria | 2936019824 | 2936023216 | 326 |
| 235 | iso_pu_bacteria | 2936028420 | 2936032331 | 326 |
| 236 | iso_pu_bacteria | 2936046547 | 2936050192 | 326 |
| 237 | iso_pu_bacteria | 2936055302 | 2936061100 | 326 |
| 238 | iso_pu_bacteria | 2941531003 | 2941535144 | 326 |
| 239 | iso_pu_bacteria | 2941538514 | 2941546714 | 326 |
| 240 | iso_pu_bacteria | 3005483717 | 3005486318 | 326 |
| 241 | iso_pu_bacteria | 3005506211 | 3005512145 | 326 |
| 242 | iso_pu_bacteria | 3005594810 | 3005597018 | 326 |
| 243 | iso_pu_bacteria | 3005710791 | 3005713090 | 326 |
| 244 | iso_pu_bacteria | 3005718088 | 3005720450 | 326 |
| 245 | iso_pu_bacteria | 8016522445 | 8016523280 | 326 |
| 246 | iso_pu_bacteria | 8016539877 | 8016541045 | 326 |
| 247 | iso_pu_bacteria | 8016548790 | 8016552208 | 326 |
| 248 | iso_pu_bacteria | 8016557553 | 8016560588 | 326 |
| 249 | iso_pu_bacteria | 8016566248 | 8016566434 | 326 |
| 250 | iso_pu_bacteria | 8016575299 | 8016579184 | 326 |
| 251 | iso_pu_bacteria | 8016595262 | 8016598482 | 326 |
| 252 | iso_pu_bacteria | 8016603502 | 8016612654 | 326 |
| 253 | iso_pu_bacteria | 8016622563 | 8016628853 | 326 |
| 254 | iso_pu_bacteria | 8016630954 | 8016633380 | 326 |
| 255 | iso_pu_bacteria | 8019538911 | 8019542977 | 326 |
| 256 | iso_pu_bacteria | 8019547302 | 8019547776 | 326 |
| 257 | iso_pu_bacteria | 8019576017 | 8019580307 | 326 |
| 258 | iso_pu_bacteria | 8019586578 | 8019588025 | 326 |
| 259 | iso_pu_bacteria | 8019608314 | 8019615219 | 326 |
| 260 | iso_pu_bacteria | 8019638758 | 8019643170 | 326 |
| 261 | iso_pu_bacteria | 8019687851 | 8019687978 | 326 |
| 262 | iso_pu_bacteria | 8055742211 | 8055748345 | 326 |
| 263 | iso_pu_bacteria | 8056967851 | 8056971967 | 326 |
| 264 | 3300005434 | Ga0070709_10001919 | Ga0070709_100019192 | 327 |
| 265 | 3300005434 | Ga0070709_10003278 | Ga0070709_100032787 | 327 |
| 266 | 3300005435 | Ga0070714_100174978 | Ga0070714_1001749782 | 327 |
| 267 | 3300005437 | Ga0070710_10000965 | Ga0070710_100009656 | 327 |
| 268 | 3300005437 | Ga0070710_10010432 | Ga0070710_100104324 | 327 |
| 269 | 3300005439 | Ga0070711_100026368 | Ga0070711_1000263684 | 327 |
| 270 | 3300005455 | Ga0070663_100201757 | Ga0070663_1002017572 | 327 |
| 271 | 3300005471 | Ga0070698_100036085 | Ga0070698_1000360853 | 327 |
| 272 | 3300006173 | Ga0070716_100044926 | Ga0070716_1000449262 | 327 |
| 273 | 3300006175 | Ga0070712_100003519 | Ga0070712_1000035194 | 327 |
| 274 | 3300025295 | Ga0209564_1007718 | Ga0209564_10077182 | 327 |
| 275 | 3300025898 | Ga0207692_10004122 | Ga0207692_100041225 | 327 |
| 276 | 3300025906 | Ga0207699_10000561 | Ga0207699_100005612 | 327 |
| 277 | 3300025915 | Ga0207693_10003010 | Ga0207693_100030109 | 327 |
| 278 | 3300025915 | Ga0207693_10115668 | Ga0207693_101156684 | 327 |
| 279 | 3300025916 | Ga0207663_10034229 | Ga0207663_100342292 | 327 |
| 280 | 3300025919 | Ga0207657_10021590 | Ga0207657_100215902 | 327 |
| 281 | 3300025928 | Ga0207700_10136870 | Ga0207700_101368702 | 327 |
| 282 | 3300025929 | Ga0207664_10190589 | Ga0207664_101905892 | 327 |
| 283 | 3300025939 | Ga0207665_10050600 | Ga0207665_100506003 | 327 |
| 284 | 3300025939 | Ga0207665_10240123 | Ga0207665_102401232 | 327 |
| 285 | 3300026067 | Ga0207678_10030711 | Ga0207678_100307113 | 327 |
| 286 | 3300033544 | Ga0316215_1006327 | Ga0316215_10063272 | 327 |
| 287 | 3300037466 | Ga0395898_0046280 | Ga0395898_0046280_3214_4200 | 327 |
| 288 | 3300046460 | Ga0495638_0022968 | Ga0495638_0022968_1728_2711 | 327 |
| 289 | 3300046507 | Ga0495606_0156710 | Ga0495606_0156710_223_1206 | 327 |
| 290 | 3300046660 | Ga0495625_0066671 | Ga0495625_0066671_879_1862 | 327 |
| 291 | 3300046665 | Ga0495661_0023616 | Ga0495661_0023616_2238_3221 | 327 |
| 292 | 3300046674 | Ga0495588_0138150 | Ga0495588_0138150_175_1158 | 327 |
| 293 | 3300046691 | Ga0495670_0032726 | Ga0495670_0032726_1518_2501 | 327 |
| 294 | 3300047472 | Ga0495686_0066199 | Ga0495686_0066199_418_1401 | 327 |
| 295 | 3300048919 | Ga0496116_0110232 | Ga0496116_0110232_191_1174 | 327 |
| 296 | 3300048920 | Ga0496117_0064917 | Ga0496117_0064917_1306_2289 | 327 |
| 297 | 3300048920 | Ga0496117_0066703 | Ga0496117_0066703_27_1010 | 327 |
| 298 | 3300048920 | Ga0496117_0135207 | Ga0496117_0135207_204_1187 | 327 |
| 299 | 3300048921 | Ga0496118_0088336 | Ga0496118_0088336_966_1949 | 327 |
| 300 | 3300048921 | Ga0496118_0198990 | Ga0496118_0198990_55_1038 | 327 |
| 301 | 3300048923 | Ga0496120_0152667 | Ga0496120_0152667_46_1029 | 327 |
| 302 | 3300048924 | Ga0496121_0006808 | Ga0496121_0006808_2823_3806 | 327 |
| 303 | 3300048925 | Ga0496122_0106238 | Ga0496122_0106238_539_1522 | 327 |
| 304 | 3300048925 | Ga0496122_0130188 | Ga0496122_0130188_250_1233 | 327 |
| 305 | 3300048926 | Ga0496123_0050611 | Ga0496123_0050611_1613_2596 | 327 |
| 306 | 3300048927 | Ga0496124_0243128 | Ga0496124_0243128_164_1147 | 327 |
| 307 | 3300048928 | Ga0496125_0001999 | Ga0496125_0001999_23764_24747 | 327 |
| 308 | 3300048928 | Ga0496125_0062019 | Ga0496125_0062019_315_1298 | 327 |
| 309 | 3300048929 | Ga0496126_0042281 | Ga0496126_0042281_701_1684 | 327 |
| 310 | 3300048929 | Ga0496126_0322864 | Ga0496126_0322864_244_1230 | 327 |
| 311 | 3300049568 | Ga0501031_0002641 | Ga0501031_0002641_6621_7604 | 327 |
| 312 | 3300049568 | Ga0501031_0106017 | Ga0501031_0106017_94_1086 | 327 |
| 313 | 3300049569 | Ga0501032_0002207 | Ga0501032_0002207_10716_11699 | 327 |
| 314 | 3300049569 | Ga0501032_0050080 | Ga0501032_0050080_352_1344 | 327 |
| 315 | 3300049570 | Ga0501033_0000124 | Ga0501033_0000124_3666_4649 | 327 |
| 316 | 3300049571 | Ga0501034_0019549 | Ga0501034_0019549_5422_6405 | 327 |
| 317 | 3300049572 | Ga0501036_0000104 | Ga0501036_0000104_45935_46918 | 327 |
| 318 | 3300049573 | Ga0501037_0000247 | Ga0501037_0000247_5345_6328 | 327 |
| 319 | 3300049573 | Ga0501037_0032929 | Ga0501037_0032929_2136_3128 | 327 |
| 320 | 3300049574 | Ga0501038_0000041 | Ga0501038_0000041_69419_70402 | 327 |
| 321 | 3300049575 | Ga0501039_0000064 | Ga0501039_0000064_13493_14476 | 327 |
| 322 | 3300049580 | Ga0501046_0080151 | Ga0501046_0080151_417_1400 | 327 |
| 323 | 3300049581 | Ga0501047_0000392 | Ga0501047_0000392_36786_37769 | 327 |
| 324 | 3300049581 | Ga0501047_0051691 | Ga0501047_0051691_874_1866 | 327 |
| 325 | 3300049582 | Ga0501048_0009128 | Ga0501048_0009128_3136_4119 | 327 |
| 326 | 3300049584 | Ga0501068_0024106 | Ga0501068_0024106_2067_3050 | 327 |
| 327 | 3300049585 | Ga0501069_0015986 | Ga0501069_0015986_942_1925 | 327 |
| 328 | 3300049586 | Ga0501070_0000175 | Ga0501070_0000175_5329_6312 | 327 |
| 329 | 3300049586 | Ga0501070_0127455 | Ga0501070_0127455_730_1722 | 327 |
| 330 | 3300049586 | Ga0501070_0130813 | Ga0501070_0130813_827_1813 | 327 |
| 331 | 3300049589 | Ga0501073_0034325 | Ga0501073_0034325_1027_2010 | 327 |
| 332 | 3300049590 | Ga0501074_0005773 | Ga0501074_0005773_6776_7759 | 327 |
| 333 | 3300049742 | Ga0501080_0013998 | Ga0501080_0013998_4479_5462 | 327 |
| 334 | 3300049822 | Ga0501035_0000155 | Ga0501035_0000155_50629_51612 | 327 |
| 335 | 3300049823 | Ga0501044_0052450 | Ga0501044_0052450_1294_2277 | 327 |
| 336 | 3300049823 | Ga0501044_0188517 | Ga0501044_0188517_661_1644 | 327 |
| 337 | 3300050516 | nmdc:mga0sz30_117968_c1 | nmdc:mga0sz30_117968_c1_27_1010 | 327 |
| 338 | 3300050516 | nmdc:mga0sz30_87711_c1 | nmdc:mga0sz30_87711_c1_336_1319 | 327 |
| 339 | 3300053090 | Ga0500646_0023844 | Ga0500646_0023844_139_1122 | 327 |
| 340 | 3300053094 | Ga0500566_0002225 | Ga0500566_0002225_5084_6067 | 327 |
| 341 | 3300053104 | Ga0500556_0000089 | Ga0500556_0000089_5612_6595 | 327 |
| 342 | 3300053109 | Ga0500569_005744 | Ga0500569_005744_583_1566 | 327 |
| 343 | 3300053109 | Ga0500569_033619 | Ga0500569_033619_59_1042 | 327 |
| 344 | 3300053130 | Ga0500642_0000030 | Ga0500642_0000030_110568_111551 | 327 |
| 345 | 3300053131 | Ga0500652_001206 | Ga0500652_001206_6133_7116 | 327 |
| 346 | 3300053134 | Ga0500658_0027909 | Ga0500658_0027909_222_1205 | 327 |
| 347 | 3300053136 | Ga0500559_0000136 | Ga0500559_0000136_50914_51897 | 327 |
| 348 | 3300053145 | Ga0500586_000203 | Ga0500586_000203_3211_4206 | 327 |
| 349 | 3300053153 | Ga0500616_0000026 | Ga0500616_0000026_82493_83476 | 327 |
| 350 | 3300053156 | Ga0500622_0001149 | Ga0500622_0001149_15901_16884 | 327 |
| 351 | 3300005356 | Ga0070674_100195910 | Ga0070674_1001959102 | 328 |
| 352 | 3300005578 | Ga0068854_100104390 | Ga0068854_1001043902 | 328 |
| 353 | 3300005841 | Ga0068863_100056464 | Ga0068863_1000564644 | 328 |
| 354 | 3300005841 | Ga0068863_100056875 | Ga0068863_1000568753 | 328 |
| 355 | 3300005842 | Ga0068858_100048822 | Ga0068858_1000488224 | 328 |
| 356 | 3300005842 | Ga0068858_100412551 | Ga0068858_1004125512 | 328 |
| 357 | 3300005843 | Ga0068860_100315016 | Ga0068860_1003150162 | 328 |
| 358 | 3300005983 | Ga0081540_1024661 | Ga0081540_10246612 | 328 |
| 359 | 3300006178 | Ga0075367_10048505 | Ga0075367_100485052 | 328 |
| 360 | 3300009101 | Ga0105247_10039539 | Ga0105247_100395392 | 328 |
| 361 | 3300009545 | Ga0105237_10174254 | Ga0105237_101742542 | 328 |
| 362 | 3300010375 | Ga0105239_10052803 | Ga0105239_100528032 | 328 |
| 363 | 3300011119 | Ga0105246_10261077 | Ga0105246_102610772 | 328 |
| 364 | 3300013297 | Ga0157378_10152383 | Ga0157378_101523832 | 328 |
| 365 | 3300013306 | Ga0163162_10427355 | Ga0163162_104273551 | 328 |
| 366 | 3300014968 | Ga0157379_10230179 | Ga0157379_102301791 | 328 |
| 367 | 3300025261 | Ga0209233_1003000 | Ga0209233_10030002 | 328 |
| 368 | 3300025272 | Ga0209455_1005926 | Ga0209455_10059264 | 328 |
| 369 | 3300025925 | Ga0207650_10133886 | Ga0207650_101338862 | 328 |
| 370 | 3300025927 | Ga0207687_10097858 | Ga0207687_100978581 | 328 |
| 371 | 3300025981 | Ga0207640_10036570 | Ga0207640_100365702 | 328 |
| 372 | 3300026035 | Ga0207703_10368767 | Ga0207703_103687672 | 328 |
| 373 | 3300026088 | Ga0207641_10024136 | Ga0207641_100241364 | 328 |
| 374 | 3300026089 | Ga0207648_10113957 | Ga0207648_101139572 | 328 |
| 375 | 3300026118 | Ga0207675_100084324 | Ga0207675_1000843243 | 328 |
| 376 | 3300028556 | Ga0265337_1001859 | Ga0265337_10018594 | 328 |
| 377 | 3300028558 | Ga0265326_10005016 | Ga0265326_100050164 | 328 |
| 378 | 3300028563 | Ga0265319_1002640 | Ga0265319_10026404 | 328 |
| 379 | 3300028573 | Ga0265334_10000410 | Ga0265334_1000041018 | 328 |
| 380 | 3300028577 | Ga0265318_10005488 | Ga0265318_100054884 | 328 |
| 381 | 3300028653 | Ga0265323_10000658 | Ga0265323_100006588 | 328 |
| 382 | 3300028654 | Ga0265322_10006993 | Ga0265322_100069932 | 328 |
| 383 | 3300028666 | Ga0265336_10000063 | Ga0265336_1000006360 | 328 |
| 384 | 3300028800 | Ga0265338_10000154 | Ga0265338_1000015434 | 328 |
| 385 | 3300029957 | Ga0265324_10002963 | Ga0265324_100029636 | 328 |
| 386 | 3300030521 | Ga0307511_10089184 | Ga0307511_100891842 | 328 |
| 387 | 3300031616 | Ga0307508_10000025 | Ga0307508_1000002517 | 328 |
| 388 | 3300031730 | Ga0307516_10097063 | Ga0307516_100970632 | 328 |
| 389 | 3300031730 | Ga0307516_10111412 | Ga0307516_101114122 | 328 |
| 390 | 3300033179 | Ga0307507_10092444 | Ga0307507_100924442 | 328 |
| 391 | 3300037853 | Ga0436364_1007205 | Ga0436364_1007205_669_1655 | 328 |
| 392 | 3300039437 | Ga0436365_0556026 | Ga0436365_0556026_151_1137 | 328 |
| 393 | 3300044842 | Ga0466957_0026990 | Ga0466957_0026990_1171_2157 | 328 |
| 394 | 3300045049 | Ga0466959_0228406 | Ga0466959_0228406_239_1225 | 328 |
| 395 | 3300046507 | Ga0495606_0050544 | Ga0495606_0050544_667_1656 | 328 |
| 396 | 3300046524 | Ga0495648_0046159 | Ga0495648_0046159_776_1780 | 328 |
| 397 | 3300046692 | Ga0495671_0023365 | Ga0495671_0023365_1618_2622 | 328 |
| 398 | 3300048909 | Ga0496106_0008194 | Ga0496106_0008194_3960_4949 | 328 |
| 399 | 3300048920 | Ga0496117_0083776 | Ga0496117_0083776_331_1320 | 328 |
| 400 | 3300048921 | Ga0496118_0012281 | Ga0496118_0012281_2931_3917 | 328 |
| 401 | 3300048921 | Ga0496118_0050582 | Ga0496118_0050582_1535_2524 | 328 |
| 402 | 3300048924 | Ga0496121_0028079 | Ga0496121_0028079_515_1504 | 328 |
| 403 | 3300048924 | Ga0496121_0057700 | Ga0496121_0057700_997_1986 | 328 |
| 404 | 3300048927 | Ga0496124_0021977 | Ga0496124_0021977_829_1818 | 328 |
| 405 | 3300048927 | Ga0496124_0114609 | Ga0496124_0114609_346_1332 | 328 |
| 406 | 3300048928 | Ga0496125_0040960 | Ga0496125_0040960_936_1925 | 328 |
| 407 | 3300048928 | Ga0496125_0075096 | Ga0496125_0075096_795_1781 | 328 |
| 408 | 3300048928 | Ga0496125_0103437 | Ga0496125_0103437_1058_2044 | 328 |
| 409 | 3300048929 | Ga0496126_0036078 | Ga0496126_0036078_2409_3398 | 328 |
| 410 | 3300053111 | Ga0500572_000614 | Ga0500572_000614_2141_3130 | 328 |
| 411 | 3300053118 | Ga0500594_0006659 | Ga0500594_0006659_866_1870 | 328 |
| 412 | 3300053136 | Ga0500559_0002659 | Ga0500559_0002659_3193_4182 | 328 |
| 413 | 3300053136 | Ga0500559_0013191 | Ga0500559_0013191_2007_2996 | 328 |
| 414 | 3300053140 | Ga0500573_0015952 | Ga0500573_0015952_2585_3574 | 328 |
| 415 | 3300053163 | Ga0500639_029038 | Ga0500639_029038_322_1311 | 328 |
| 416 | 3300053163 | Ga0500639_086960 | Ga0500639_086960_210_1199 | 328 |
| 417 | 3300053177 | Ga0500636_0028276 | Ga0500636_0028276_577_1566 | 328 |
| 418 | 3300053177 | Ga0500636_0030053 | Ga0500636_0030053_1872_2858 | 328 |
| 419 | 3300053725 | Ga0500576_005569 | Ga0500576_005569_685_1674 | 328 |
| 420 | 3300053735 | Ga0500596_002967 | Ga0500596_002967_1890_2879 | 328 |
| 421 | 3300044658 | Ga0466972_0016158 | Ga0466972_0016158_1210_2199 | 329 |
| 422 | 3300048929 | Ga0496126_0192430 | Ga0496126_0192430_14_1006 | 329 |
| 423 | 3300049591 | Ga0501075_0169726 | Ga0501075_0169726_292_1284 | 329 |
| 424 | iso_pu_bacteria | 2891048133 | 2891049780 | 329 |
| 425 | 3300003215 | JGI25153J46596_10000161 | JGI25153J46596_1000016171 | 330 |
| 426 | 3300003215 | JGI25153J46596_10000354 | JGI25153J46596_1000035423 | 330 |
| 427 | 3300003354 | JGI25160J50197_1001256 | JGI25160J50197_100125611 | 330 |
| 428 | 3300003354 | JGI25160J50197_1002809 | JGI25160J50197_10028092 | 330 |
| 429 | 3300003775 | Ga0055524_1023787 | Ga0055524_10237872 | 330 |
| 430 | 3300003794 | Ga0055531_10013705 | Ga0055531_100137053 | 330 |
| 431 | 3300005262 | Ga0065165_1000244 | Ga0065165_100024488 | 330 |
| 432 | 3300005262 | Ga0065165_1000368 | Ga0065165_10003688 | 330 |
| 433 | 3300005262 | Ga0065165_1008246 | Ga0065165_10082463 | 330 |
| 434 | 3300005262 | Ga0065165_1009309 | Ga0065165_10093094 | 330 |
| 435 | 3300005338 | Ga0068868_100132456 | Ga0068868_1001324562 | 330 |
| 436 | 3300005455 | Ga0070663_100027527 | Ga0070663_1000275272 | 330 |
| 437 | 3300005455 | Ga0070663_100044284 | Ga0070663_1000442843 | 330 |
| 438 | 3300005457 | Ga0070662_100185209 | Ga0070662_1001852092 | 330 |
| 439 | 3300005471 | Ga0070698_100406963 | Ga0070698_1004069632 | 330 |
| 440 | 3300005548 | Ga0070665_100118650 | Ga0070665_1001186501 | 330 |
| 441 | 3300005563 | Ga0068855_100062155 | Ga0068855_1000621552 | 330 |
| 442 | 3300005578 | Ga0068854_100310020 | Ga0068854_1003100202 | 330 |
| 443 | 3300005614 | Ga0068856_100120925 | Ga0068856_1001209253 | 330 |
| 444 | 3300005614 | Ga0068856_100274604 | Ga0068856_1002746042 | 330 |
| 445 | 3300005614 | Ga0068856_100287558 | Ga0068856_1002875582 | 330 |
| 446 | 3300005616 | Ga0068852_100001503 | Ga0068852_1000015036 | 330 |
| 447 | 3300005616 | Ga0068852_100091652 | Ga0068852_1000916522 | 330 |
| 448 | 3300005617 | Ga0068859_100473627 | Ga0068859_1004736272 | 330 |
| 449 | 3300005841 | Ga0068863_100112064 | Ga0068863_1001120642 | 330 |
| 450 | 3300005842 | Ga0068858_100362146 | Ga0068858_1003621462 | 330 |
| 451 | 3300006038 | Ga0075365_10033031 | Ga0075365_100330312 | 330 |
| 452 | 3300006038 | Ga0075365_10064949 | Ga0075365_100649492 | 330 |
| 453 | 3300006042 | Ga0075368_10000322 | Ga0075368_1000032210 | 330 |
| 454 | 3300006175 | Ga0070712_100093869 | Ga0070712_1000938692 | 330 |
| 455 | 3300006178 | Ga0075367_10004226 | Ga0075367_100042262 | 330 |
| 456 | 3300006186 | Ga0075369_10021636 | Ga0075369_100216362 | 330 |
| 457 | 3300006195 | Ga0075366_10002088 | Ga0075366_100020889 | 330 |
| 458 | 3300006353 | Ga0075370_10003222 | Ga0075370_100032227 | 330 |
| 459 | 3300006353 | Ga0075370_10035300 | Ga0075370_100353003 | 330 |
| 460 | 3300006931 | Ga0097620_100473652 | Ga0097620_1004736522 | 330 |
| 461 | 3300006942 | Ga0099824_1033450 | Ga0099824_10334502 | 330 |
| 462 | 3300009093 | Ga0105240_10008478 | Ga0105240_100084785 | 330 |
| 463 | 3300009098 | Ga0105245_10029654 | Ga0105245_100296544 | 330 |
| 464 | 3300009101 | Ga0105247_10067229 | Ga0105247_100672292 | 330 |
| 465 | 3300009174 | Ga0105241_10020161 | Ga0105241_100201614 | 330 |
| 466 | 3300009174 | Ga0105241_10024560 | Ga0105241_100245603 | 330 |
| 467 | 3300009174 | Ga0105241_10069727 | Ga0105241_100697272 | 330 |
| 468 | 3300009177 | Ga0105248_10105236 | Ga0105248_101052363 | 330 |
| 469 | 3300009545 | Ga0105237_10000892 | Ga0105237_1000089217 | 330 |
| 470 | 3300009545 | Ga0105237_10007390 | Ga0105237_1000739010 | 330 |
| 471 | 3300010159 | Ga0099796_10019942 | Ga0099796_100199422 | 330 |
| 472 | 3300010375 | Ga0105239_10007059 | Ga0105239_100070594 | 330 |
| 473 | 3300010375 | Ga0105239_10010770 | Ga0105239_100107706 | 330 |
| 474 | 3300010375 | Ga0105239_10076576 | Ga0105239_100765762 | 330 |
| 475 | 3300010375 | Ga0105239_10095032 | Ga0105239_100950323 | 330 |
| 476 | 3300010375 | Ga0105239_10128843 | Ga0105239_101288432 | 330 |
| 477 | 3300010375 | Ga0105239_10379505 | Ga0105239_103795052 | 330 |
| 478 | 3300011119 | Ga0105246_10003773 | Ga0105246_100037737 | 330 |
| 479 | 3300011119 | Ga0105246_10115871 | Ga0105246_101158712 | 330 |
| 480 | 3300013296 | Ga0157374_10013038 | Ga0157374_100130386 | 330 |
| 481 | 3300013296 | Ga0157374_10021625 | Ga0157374_100216255 | 330 |
| 482 | 3300013306 | Ga0163162_10322055 | Ga0163162_103220552 | 330 |
| 483 | 3300013306 | Ga0163162_10368787 | Ga0163162_103687873 | 330 |
| 484 | 3300013308 | Ga0157375_10021276 | Ga0157375_100212766 | 330 |
| 485 | 3300014325 | Ga0163163_10005130 | Ga0163163_100051304 | 330 |
| 486 | 3300021324 | Ga0214545_1000028 | Ga0214545_1000028110 | 330 |
| 487 | 3300021327 | Ga0214543_1000044 | Ga0214543_100004454 | 330 |
| 488 | 3300025230 | Ga0209563_101020 | Ga0209563_1010204 | 330 |
| 489 | 3300025245 | Ga0207425_1002884 | Ga0207425_10028843 | 330 |
| 490 | 3300025253 | Ga0209677_106052 | Ga0209677_1060522 | 330 |
| 491 | 3300025254 | Ga0209148_1000224 | Ga0209148_100022428 | 330 |
| 492 | 3300025261 | Ga0209233_1004722 | Ga0209233_10047222 | 330 |
| 493 | 3300025261 | Ga0209233_1012100 | Ga0209233_10121003 | 330 |
| 494 | 3300025272 | Ga0209455_1000635 | Ga0209455_10006356 | 330 |
| 495 | 3300025295 | Ga0209564_1002670 | Ga0209564_10026708 | 330 |
| 496 | 3300025297 | Ga0209758_1000075 | Ga0209758_100007579 | 330 |
| 497 | 3300025297 | Ga0209758_1000087 | Ga0209758_1000087151 | 330 |
| 498 | 3300025297 | Ga0209758_1001472 | Ga0209758_10014728 | 330 |
| 499 | 3300025297 | Ga0209758_1003696 | Ga0209758_10036962 | 330 |
| 500 | 3300025297 | Ga0209758_1006857 | Ga0209758_10068577 | 330 |
| 501 | 3300025297 | Ga0209758_1019189 | Ga0209758_10191893 | 330 |
| 502 | 3300025299 | Ga0209256_1009007 | Ga0209256_10090072 | 330 |
| 503 | 3300025302 | Ga0207426_1000160 | Ga0207426_10001602 | 330 |
| 504 | 3300025302 | Ga0207426_1000289 | Ga0207426_1000289107 | 330 |
| 505 | 3300025302 | Ga0207426_1006711 | Ga0207426_10067115 | 330 |
| 506 | 3300025302 | Ga0207426_1025821 | Ga0207426_10258212 | 330 |
| 507 | 3300025304 | Ga0209257_1000382 | Ga0209257_100038276 | 330 |
| 508 | 3300025304 | Ga0209257_1010148 | Ga0209257_10101482 | 330 |
| 509 | 3300025904 | Ga0207647_10006477 | Ga0207647_100064777 | 330 |
| 510 | 3300025911 | Ga0207654_10049575 | Ga0207654_100495753 | 330 |
| 511 | 3300025913 | Ga0207695_10000029 | Ga0207695_10000029503 | 330 |
| 512 | 3300025914 | Ga0207671_10005341 | Ga0207671_100053418 | 330 |
| 513 | 3300025914 | Ga0207671_10030419 | Ga0207671_100304194 | 330 |
| 514 | 3300025915 | Ga0207693_10181939 | Ga0207693_101819392 | 330 |
| 515 | 3300025915 | Ga0207693_10321853 | Ga0207693_103218531 | 330 |
| 516 | 3300025916 | Ga0207663_10242542 | Ga0207663_102425421 | 330 |
| 517 | 3300025924 | Ga0207694_10118890 | Ga0207694_101188902 | 330 |
| 518 | 3300025931 | Ga0207644_10082189 | Ga0207644_100821893 | 330 |
| 519 | 3300025932 | Ga0207690_10271961 | Ga0207690_102719612 | 330 |
| 520 | 3300025933 | Ga0207706_10085276 | Ga0207706_100852763 | 330 |
| 521 | 3300025941 | Ga0207711_10032173 | Ga0207711_100321733 | 330 |
| 522 | 3300025944 | Ga0207661_10109003 | Ga0207661_101090032 | 330 |
| 523 | 3300025972 | Ga0207668_10136606 | Ga0207668_101366062 | 330 |
| 524 | 3300025981 | Ga0207640_10400497 | Ga0207640_104004971 | 330 |
| 525 | 3300025986 | Ga0207658_10024166 | Ga0207658_100241662 | 330 |
| 526 | 3300026023 | Ga0207677_10038119 | Ga0207677_100381192 | 330 |
| 527 | 3300026041 | Ga0207639_10526952 | Ga0207639_105269521 | 330 |
| 528 | 3300026067 | Ga0207678_10043585 | Ga0207678_100435854 | 330 |
| 529 | 3300026067 | Ga0207678_10064794 | Ga0207678_100647943 | 330 |
| 530 | 3300026078 | Ga0207702_10001454 | Ga0207702_1000145414 | 330 |
| 531 | 3300026078 | Ga0207702_10028517 | Ga0207702_100285173 | 330 |
| 532 | 3300026078 | Ga0207702_10350173 | Ga0207702_103501731 | 330 |
| 533 | 3300026121 | Ga0207683_10464040 | Ga0207683_104640401 | 330 |
| 534 | 3300026142 | Ga0207698_10045053 | Ga0207698_100450532 | 330 |
| 535 | 3300026142 | Ga0207698_10147244 | Ga0207698_101472442 | 330 |
| 536 | 3300026142 | Ga0207698_10258035 | Ga0207698_102580352 | 330 |
| 537 | 3300027296 | Ga0209389_1000137 | Ga0209389_100013753 | 330 |
| 538 | 3300027296 | Ga0209389_1000353 | Ga0209389_100035312 | 330 |
| 539 | 3300027357 | Ga0209589_1003439 | Ga0209589_100343912 | 330 |
| 540 | 3300027361 | Ga0209489_100192 | Ga0209489_10019239 | 330 |
| 541 | 3300027361 | Ga0209489_107326 | Ga0209489_1073268 | 330 |
| 542 | 3300031235 | Ga0265330_10054307 | Ga0265330_100543072 | 330 |
| 543 | 3300031238 | Ga0265332_10007749 | Ga0265332_100077492 | 330 |
| 544 | 3300031241 | Ga0265325_10020842 | Ga0265325_100208422 | 330 |
| 545 | 3300031250 | Ga0265331_10117920 | Ga0265331_101179202 | 330 |
| 546 | 3300031711 | Ga0265314_10005071 | Ga0265314_100050719 | 330 |
| 547 | 3300033180 | Ga0307510_10024769 | Ga0307510_100247695 | 330 |
| 548 | 3300033180 | Ga0307510_10044327 | Ga0307510_100443274 | 330 |
| 549 | 3300033180 | Ga0307510_10094433 | Ga0307510_100944333 | 330 |
| 550 | 3300035119 | Ga0373956_0082558 | Ga0373956_0082558_85_1080 | 330 |
| 551 | 3300035170 | Ga0373943_0002145 | Ga0373943_0002145_3011_4006 | 330 |
| 552 | 3300035171 | Ga0373946_0001257 | Ga0373946_0001257_1065_2060 | 330 |
| 553 | 3300035172 | Ga0373955_0002673 | Ga0373955_0002673_763_1758 | 330 |
| 554 | 3300035410 | Ga0373924_0005844 | Ga0373924_0005844_1666_2661 | 330 |
| 555 | 3300035691 | Ga0373931_0007479 | Ga0373931_0007479_974_1969 | 330 |
| 556 | 3300035692 | Ga0373935_0000494 | Ga0373935_0000494_4960_5955 | 330 |
| 557 | 3300035695 | Ga0373927_0002352 | Ga0373927_0002352_359_1354 | 330 |
| 558 | 3300035725 | Ga0373947_0055656 | Ga0373947_0055656_219_1214 | 330 |
| 559 | 3300037068 | Ga0373925_0007140 | Ga0373925_0007140_5870_6865 | 330 |
| 560 | 3300037418 | Ga0395900_0000943 | Ga0395900_0000943_28734_29726 | 330 |
| 561 | 3300037466 | Ga0395898_0002974 | Ga0395898_0002974_9432_10424 | 330 |
| 562 | 3300037471 | Ga0395905_0021852 | Ga0395905_0021852_3675_4670 | 330 |
| 563 | 3300037471 | Ga0395905_0062455 | Ga0395905_0062455_1201_2193 | 330 |
| 564 | 3300037471 | Ga0395905_0088532 | Ga0395905_0088532_489_1481 | 330 |
| 565 | 3300038443 | Ga0395901_0001973 | Ga0395901_0001973_9544_10536 | 330 |
| 566 | 3300044658 | Ga0466972_0025155 | Ga0466972_0025155_773_1765 | 330 |
| 567 | 3300044658 | Ga0466972_0026707 | Ga0466972_0026707_387_1379 | 330 |
| 568 | 3300044693 | Ga0466961_0000029 | Ga0466961_0000029_62186_63178 | 330 |
| 569 | 3300044706 | Ga0466964_0012459 | Ga0466964_0012459_2211_3203 | 330 |
| 570 | 3300044735 | Ga0466968_0032351 | Ga0466968_0032351_351_1343 | 330 |
| 571 | 3300045049 | Ga0466959_0000533 | Ga0466959_0000533_2015_3007 | 330 |
| 572 | 3300046455 | Ga0495603_0000237 | Ga0495603_0000237_21124_22119 | 330 |
| 573 | 3300046459 | Ga0495629_0000772 | Ga0495629_0000772_12080_13075 | 330 |
| 574 | 3300046460 | Ga0495638_0006370 | Ga0495638_0006370_5677_6669 | 330 |
| 575 | 3300046461 | Ga0495641_0004443 | Ga0495641_0004443_3649_4644 | 330 |
| 576 | 3300046462 | Ga0495651_0081569 | Ga0495651_0081569_101_1093 | 330 |
| 577 | 3300046472 | Ga0495580_0001324 | Ga0495580_0001324_15890_16885 | 330 |
| 578 | 3300046473 | Ga0495582_0000209 | Ga0495582_0000209_17730_18725 | 330 |
| 579 | 3300046475 | Ga0495639_0000387 | Ga0495639_0000387_3531_4526 | 330 |
| 580 | 3300046477 | Ga0495664_0017088 | Ga0495664_0017088_2888_3883 | 330 |
| 581 | 3300046477 | Ga0495664_0019150 | Ga0495664_0019150_2490_3482 | 330 |
| 582 | 3300046477 | Ga0495664_0116664 | Ga0495664_0116664_288_1283 | 330 |
| 583 | 3300046499 | Ga0495594_0000342 | Ga0495594_0000342_13906_14901 | 330 |
| 584 | 3300046507 | Ga0495606_0047231 | Ga0495606_0047231_1566_2558 | 330 |
| 585 | 3300046511 | Ga0495608_0032019 | Ga0495608_0032019_1735_2727 | 330 |
| 586 | 3300046511 | Ga0495608_0046562 | Ga0495608_0046562_1402_2394 | 330 |
| 587 | 3300046514 | Ga0495618_0134916 | Ga0495618_0134916_290_1285 | 330 |
| 588 | 3300046516 | Ga0495628_0064005 | Ga0495628_0064005_1088_2080 | 330 |
| 589 | 3300046522 | Ga0495643_0010018 | Ga0495643_0010018_1019_2011 | 330 |
| 590 | 3300046531 | Ga0495665_0000280 | Ga0495665_0000280_10849_11844 | 330 |
| 591 | 3300046533 | Ga0495640_0001578 | Ga0495640_0001578_5866_6861 | 330 |
| 592 | 3300046536 | Ga0495587_0059147 | Ga0495587_0059147_203_1195 | 330 |
| 593 | 3300046543 | Ga0495645_0042873 | Ga0495645_0042873_2169_3161 | 330 |
| 594 | 3300046557 | Ga0495622_0004227 | Ga0495622_0004227_5081_6073 | 330 |
| 595 | 3300046557 | Ga0495622_0004573 | Ga0495622_0004573_790_1785 | 330 |
| 596 | 3300046559 | Ga0495667_0042094 | Ga0495667_0042094_947_1942 | 330 |
| 597 | 3300046642 | Ga0495634_0000865 | Ga0495634_0000865_16055_17050 | 330 |
| 598 | 3300046663 | Ga0495635_0003213 | Ga0495635_0003213_3359_4351 | 330 |
| 599 | 3300046663 | Ga0495635_0017357 | Ga0495635_0017357_844_1836 | 330 |
| 600 | 3300046674 | Ga0495588_0030385 | Ga0495588_0030385_399_1394 | 330 |
| 601 | 3300046674 | Ga0495588_0123030 | Ga0495588_0123030_303_1295 | 330 |
| 602 | 3300046675 | Ga0495657_0011035 | Ga0495657_0011035_2224_3216 | 330 |
| 603 | 3300046675 | Ga0495657_0029981 | Ga0495657_0029981_1621_2613 | 330 |
| 604 | 3300046689 | Ga0495613_0003086 | Ga0495613_0003086_6486_7481 | 330 |
| 605 | 3300046689 | Ga0495613_0280465 | Ga0495613_0280465_115_1107 | 330 |
| 606 | 3300046690 | Ga0495624_0001082 | Ga0495624_0001082_9051_10046 | 330 |
| 607 | 3300047315 | Ga0495581_0022904 | Ga0495581_0022904_726_1721 | 330 |
| 608 | 3300047315 | Ga0495581_0035677 | Ga0495581_0035677_12_1004 | 330 |
| 609 | 3300047317 | Ga0495604_0016851 | Ga0495604_0016851_171_1163 | 330 |
| 610 | 3300047319 | Ga0495674_0004372 | Ga0495674_0004372_7499_8494 | 330 |
| 611 | 3300047319 | Ga0495674_0024884 | Ga0495674_0024884_3733_4725 | 330 |
| 612 | 3300047321 | Ga0495676_0009743 | Ga0495676_0009743_78_1073 | 330 |
| 613 | 3300047321 | Ga0495676_0179397 | Ga0495676_0179397_424_1416 | 330 |
| 614 | 3300047323 | Ga0495683_0007012 | Ga0495683_0007012_4109_5101 | 330 |
| 615 | 3300047443 | Ga0495687_011591 | Ga0495687_011591_1119_2111 | 330 |
| 616 | 3300047471 | Ga0495684_0005777 | Ga0495684_0005777_8195_9190 | 330 |
| 617 | 3300047472 | Ga0495686_0052830 | Ga0495686_0052830_284_1276 | 330 |
| 618 | 3300047673 | Ga0495593_0000238 | Ga0495593_0000238_11972_12967 | 330 |
| 619 | 3300048089 | Ga0495614_0027859 | Ga0495614_0027859_392_1387 | 330 |
| 620 | 3300048904 | Ga0496101_0018685 | Ga0496101_0018685_1735_2727 | 330 |
| 621 | 3300048904 | Ga0496101_0253962 | Ga0496101_0253962_154_1146 | 330 |
| 622 | 3300048905 | Ga0496102_0001874 | Ga0496102_0001874_12568_13560 | 330 |
| 623 | 3300048905 | Ga0496102_0408515 | Ga0496102_0408515_74_1066 | 330 |
| 624 | 3300048906 | Ga0496103_0002168 | Ga0496103_0002168_1608_2600 | 330 |
| 625 | 3300048906 | Ga0496103_0117414 | Ga0496103_0117414_228_1220 | 330 |
| 626 | 3300048907 | Ga0496104_0004135 | Ga0496104_0004135_1065_2057 | 330 |
| 627 | 3300048907 | Ga0496104_0019755 | Ga0496104_0019755_112_1104 | 330 |
| 628 | 3300048907 | Ga0496104_0022321 | Ga0496104_0022321_1720_2712 | 330 |
| 629 | 3300048908 | Ga0496105_0006240 | Ga0496105_0006240_284_1276 | 330 |
| 630 | 3300048909 | Ga0496106_0058907 | Ga0496106_0058907_1281_2273 | 330 |
| 631 | 3300048910 | Ga0496107_0068287 | Ga0496107_0068287_892_1884 | 330 |
| 632 | 3300048911 | Ga0496108_0123258 | Ga0496108_0123258_111_1106 | 330 |
| 633 | 3300048912 | Ga0496109_0070568 | Ga0496109_0070568_386_1378 | 330 |
| 634 | 3300048912 | Ga0496109_0511656 | Ga0496109_0511656_121_1116 | 330 |
| 635 | 3300048913 | Ga0496110_0021529 | Ga0496110_0021529_1340_2332 | 330 |
| 636 | 3300048913 | Ga0496110_0053113 | Ga0496110_0053113_703_1698 | 330 |
| 637 | 3300048914 | Ga0496111_0076159 | Ga0496111_0076159_1149_2141 | 330 |
| 638 | 3300048915 | Ga0496112_0006808 | Ga0496112_0006808_873_1865 | 330 |
| 639 | 3300048915 | Ga0496112_0029058 | Ga0496112_0029058_2850_3845 | 330 |
| 640 | 3300048915 | Ga0496112_0043753 | Ga0496112_0043753_1676_2671 | 330 |
| 641 | 3300048915 | Ga0496112_0169163 | Ga0496112_0169163_637_1629 | 330 |
| 642 | 3300048916 | Ga0496113_0211644 | Ga0496113_0211644_384_1376 | 330 |
| 643 | 3300048918 | Ga0496115_0007927 | Ga0496115_0007927_816_1808 | 330 |
| 644 | 3300048918 | Ga0496115_0071326 | Ga0496115_0071326_98_1090 | 330 |
| 645 | 3300048919 | Ga0496116_0037607 | Ga0496116_0037607_1307_2299 | 330 |
| 646 | 3300048920 | Ga0496117_0124629 | Ga0496117_0124629_331_1323 | 330 |
| 647 | 3300048922 | Ga0496119_0014153 | Ga0496119_0014153_122_1114 | 330 |
| 648 | 3300048923 | Ga0496120_0019887 | Ga0496120_0019887_1257_2249 | 330 |
| 649 | 3300048924 | Ga0496121_0099694 | Ga0496121_0099694_584_1576 | 330 |
| 650 | 3300048924 | Ga0496121_0207651 | Ga0496121_0207651_153_1145 | 330 |
| 651 | 3300048929 | Ga0496126_0251548 | Ga0496126_0251548_206_1198 | 330 |
| 652 | 3300050490 | nmdc:mga03n38_9307_c1 | nmdc:mga03n38_9307_c1_355_1347 | 330 |
| 653 | 3300050492 | nmdc:mga0yw44_2009_c1 | nmdc:mga0yw44_2009_c1_4578_5570 | 330 |
| 654 | 3300050492 | nmdc:mga0yw44_26139_c1 | nmdc:mga0yw44_26139_c1_162_1154 | 330 |
| 655 | 3300050492 | nmdc:mga0yw44_33015_c1 | nmdc:mga0yw44_33015_c1_189_1181 | 330 |
| 656 | 3300050492 | nmdc:mga0yw44_723_c1 | nmdc:mga0yw44_723_c1_1261_2253 | 330 |
| 657 | 3300053077 | Ga0495601_0024808 | Ga0495601_0024808_2181_3176 | 330 |
| 658 | 3300053077 | Ga0495601_0070957 | Ga0495601_0070957_907_1902 | 330 |
| 659 | 3300053077 | Ga0495601_0110795 | Ga0495601_0110795_652_1647 | 330 |
| 660 | 3300053080 | Ga0500635_0019411 | Ga0500635_0019411_122_1114 | 330 |
| 661 | 3300053085 | Ga0495619_0350524 | Ga0495619_0350524_12_1007 | 330 |
| 662 | 3300053086 | Ga0500578_0033112 | Ga0500578_0033112_716_1708 | 330 |
| 663 | 3300053086 | Ga0500578_0058889 | Ga0500578_0058889_1420_2412 | 330 |
| 664 | 3300053087 | Ga0500643_000037 | Ga0500643_000037_111896_112888 | 330 |
| 665 | 3300053092 | Ga0500583_0059845 | Ga0500583_0059845_422_1414 | 330 |
| 666 | 3300053094 | Ga0500566_0000166 | Ga0500566_0000166_11730_12722 | 330 |
| 667 | 3300053103 | Ga0500555_000550 | Ga0500555_000550_3584_4576 | 330 |
| 668 | 3300053108 | Ga0500562_002316 | Ga0500562_002316_3014_4006 | 330 |
| 669 | 3300053109 | Ga0500569_000281 | Ga0500569_000281_3616_4608 | 330 |
| 670 | 3300053109 | Ga0500569_070348 | Ga0500569_070348_47_1039 | 330 |
| 671 | 3300053111 | Ga0500572_009367 | Ga0500572_009367_507_1499 | 330 |
| 672 | 3300053119 | Ga0500595_014345 | Ga0500595_014345_1950_2942 | 330 |
| 673 | 3300053139 | Ga0500568_0005713 | Ga0500568_0005713_4459_5451 | 330 |
| 674 | 3300053153 | Ga0500616_0019257 | Ga0500616_0019257_2352_3344 | 330 |
| 675 | 3300053155 | Ga0500620_000914 | Ga0500620_000914_3131_4123 | 330 |
| 676 | 3300053156 | Ga0500622_0001752 | Ga0500622_0001752_7279_8271 | 330 |
| 677 | 3300053161 | Ga0500634_0093229 | Ga0500634_0093229_23_1015 | 330 |
| 678 | 3300053177 | Ga0500636_0004341 | Ga0500636_0004341_5731_6723 | 330 |
| 679 | 3300053731 | Ga0500609_000505 | Ga0500609_000505_2979_3971 | 330 |
| 680 | 3300053737 | Ga0500601_000014 | Ga0500601_000014_30570_31562 | 330 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5mog-assembly1.cif.gz_C | oryza sativa phytoene desaturase inhibited by norflurazon | 0.8911 | 2 | 36 |
| 3bly-assembly1.cif.gz_A | pyranose 2-oxidase from trametes multicolor, e542k/l537w | 0.8879 | 5 | 35 |
| 6xtf-assembly1.cif.gz_B | crystal structure a thioredoxin reductase from gloeobacter violaceus bound to its electron donor | 0.8838 | 5 | 36 |
| 4mop-assembly1.cif.gz_D | pyranose 2-oxidase v546c mutant with 3-fluorinated galactose | 0.8829 | 5 | 35 |
| 3k4l-assembly1.cif.gz_A | pyranose 2-oxidase f454n mutant in complex with 2fg | 0.8815 | 5 | 35 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4kuhA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9581 | 5 | 200 | 3.40.50.720 |
| af_A0A0R0JSV2_33_153_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9571 | 91 | 199 | 3.40.50.720 |
| 2wtbA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.952 | 5 | 197 | 3.40.50.720 |
| 4kuhA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9481 | 5 | 200 | 3.40.50.720 |
| af_Q54VB8_19_206_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9451 | 3 | 199 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6M1LHE8-F1-model_v4 | L-gulonate 3-dehydrogenase (EC 1.1.1.45) (L-gulonate 3-dehydrogenase) | 0.9799 | 2 | 330 |
GO:0006631
GO:0008691 GO:0009056 GO:0050104 GO:0070403 |
| AF-A0A7C3N468-F1-model_v4 | L-gulonate 3-dehydrogenase (EC 1.1.1.45) (L-gulonate 3-dehydrogenase) | 0.9784 | 6 | 320 |
GO:0006631
GO:0009056 GO:0050104 GO:0070403 |
| AF-B4ELK6-F1-model_v4 | L-gulonate 3-dehydrogenase (EC 1.1.1.45) (L-gulonate 3-dehydrogenase) | 0.9732 | 5 | 329 |
GO:0006631
GO:0009056 GO:0016020 GO:0050104 GO:0070403 |
| AF-A0A2V7HX34-F1-model_v4 | 3-hydroxyacyl-CoA dehydrogenase | 0.9718 | 150 | 320 |
GO:0006631
GO:0009056 GO:0050104 GO:0070403 |
| AF-A0A7S2V1P9-F1-model_v4 | 3-hydroxyacyl-CoA dehydrogenase NAD binding domain-containing protein | 0.9717 | 95 | 170 |
GO:0003857
GO:0005777 GO:0006635 GO:0016829 GO:0016853 GO:0070403 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar