F474779
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 680 | 484 | 504 | 252 |
Family's Representative Sequence
| Representative Sequence | 3300025901|Ga0207688_10036235|Ga0207688_100362351 |
| Length | 280 |
| Sequence | MIFDYVAYLVLALLIVGFLVSAIRVLREYERGIVFTLGRFTGVKGPGLIILIPFVQQMVRVDLRVIVQDVPPQDVISRDNVSVKVNAVIYFRIVDPERAIIKVENYMAATSQLAQTTLRSVLGKHELDEMLAERDRLNADIQQILDQQTDAWGIKVANVEIKHIDLNENMIRAIAKQAEAERLRRAKVINAEGEQQAAEKLVEAGRLLAAEPQAMQLRYFAALHDIASERSSTIIFPLPTDLLAHLGGASERQTVAAVGASDQQDRGQEPGVPSLGAKRA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501050 | Microvirga lupini Lut6 | Isolate | Nodule |
| 2 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 3 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 4 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 5 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 6 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 7 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 8 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 9 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 10 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 11 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 12 | 2513237351 | Mesorhizobium alhagi CCNWXJ12-2 | Isolate | Nodule |
| 13 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 14 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 15 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 16 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 17 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 18 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 19 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 20 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 21 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 22 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 23 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 24 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 25 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 26 | 2773857925 | Microvirga vignae BR3299 | Isolate | Unclassified |
| 27 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 28 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 29 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 30 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 31 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 32 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 33 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 34 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 35 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 36 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 37 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 38 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 39 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 40 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 41 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 42 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 43 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 44 | 2835312727 | Microvirga calopogonii CCBAU 65841 | Isolate | Nodule |
| 45 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 46 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 47 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 48 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 49 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 50 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 51 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 52 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 53 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 54 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 55 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 56 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 57 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 58 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 59 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 60 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 61 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 62 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 63 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 64 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 65 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 66 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 67 | 2882456835 | Microvirga sp. KLBC 81 | Isolate | Unclassified |
| 68 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 69 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 70 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 71 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 72 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 73 | 2889790730 | Chelativorans xinjiangense lm93 | Isolate | Rhizosphere |
| 74 | 2889914905 | Chelativorans alearense UJN715 | Isolate | Rhizosphere |
| 75 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 76 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 77 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 78 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 79 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 80 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 81 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 82 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 83 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 84 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 85 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 86 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 87 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 88 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 89 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 90 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 91 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 92 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 93 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 94 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 95 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 96 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 97 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 98 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 99 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 100 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 101 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 102 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 103 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 104 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 105 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 106 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 107 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 108 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 109 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 110 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 111 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 112 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 113 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 114 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 115 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 116 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 117 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 118 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 119 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 120 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 121 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 122 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 123 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 124 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 125 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 126 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 127 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 128 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 129 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 130 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 131 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 132 | 2937843397 | Mesorhizobium xinjiangense lm94 | Isolate | Rhizosphere |
| 133 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 134 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 135 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 136 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 137 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 138 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 139 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 140 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 141 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 142 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 143 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 144 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 145 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 146 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 147 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 148 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 149 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 150 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 151 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 152 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 153 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 154 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 155 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 156 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 157 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 158 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 159 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 160 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 161 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 162 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 163 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 164 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 165 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 166 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 167 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 168 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 169 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 170 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 171 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 172 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 173 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 174 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 175 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 176 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 177 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 178 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 179 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 180 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 181 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 182 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 183 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 184 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 185 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 186 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 187 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 188 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 189 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 190 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 191 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 192 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 193 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 194 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 195 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 196 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 197 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 198 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 199 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 200 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 201 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 202 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 203 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 204 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 205 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 206 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 207 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 208 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 209 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 210 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 211 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 212 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 213 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 214 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 215 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 216 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 217 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 218 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 219 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 220 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 221 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 223 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 224 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 226 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 227 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 228 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 229 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 230 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 231 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 232 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 233 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 234 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 235 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 236 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 237 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 238 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 239 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 240 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 241 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 242 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 243 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 244 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 245 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 246 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 247 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 248 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 249 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 250 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 295 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 296 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 297 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 298 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 300 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 301 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 302 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 303 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 304 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 305 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 306 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 307 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 308 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 309 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 310 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 311 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 312 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 313 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 314 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 315 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 316 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 317 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 318 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 319 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 320 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 321 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 322 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 323 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 324 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 325 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 326 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 327 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 328 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 329 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 330 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 331 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 332 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 333 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 334 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 335 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 336 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 337 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 338 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 339 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 340 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 341 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 342 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 343 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 344 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 345 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 346 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 347 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 402 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 403 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 404 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 405 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 406 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 407 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 408 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 409 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 410 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 411 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 412 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 413 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 414 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 415 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 416 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 417 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 418 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 419 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 420 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 421 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 422 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 423 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 424 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 425 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 426 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 427 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 428 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 429 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 430 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 431 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 432 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 433 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 434 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 435 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 436 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 437 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 438 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 439 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 440 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 441 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 442 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 443 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 444 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 445 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 446 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 447 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 452 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 453 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 454 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 455 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 456 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 457 | 643348564 | Methylobacterium nodulans ORS 2060 | Isolate | Nodule |
| 458 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 459 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 460 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 461 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 462 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 463 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 464 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 465 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 466 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 467 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 468 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 469 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 470 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 471 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 472 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 473 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 474 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 475 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 476 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 477 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 478 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 479 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 480 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 481 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 482 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 483 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 484 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 74.37 |
| Metatranscriptomes | 0.3 |
| Isolates | 25.33 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.91 |
| Nodule | 17.21 |
| Rhizoplane | 4.41 |
| Rhizosphere | 65 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.47 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10003072 | 3300001979 | Bacteria | 7382 |
| 2 | JGI24744J21845_10008185 | 3300002077 | Bacteria | 2159 |
| 3 | JGI25406J46586_10000700 | 3300003203 | Bacteria | 15651 |
| 4 | Ga0070658_10015872 | 3300005327 | Bacteria | 6022 |
| 5 | Ga0070676_10188375 | 3300005328 | Bacteria | 1345 |
| 6 | Ga0070670_100053420 | 3300005331 | Bacteria | 3470 |
| 7 | Ga0068869_100242150 | 3300005334 | Bacteria | 1437 |
| 8 | Ga0070680_100104495 | 3300005336 | Bacteria | 2354 |
| 9 | Ga0070682_100113635 | 3300005337 | Bacteria | 1808 |
| 10 | Ga0070660_100026898 | 3300005339 | Bacteria | 4287 |
| 11 | Ga0070660_100447876 | 3300005339 | Bacteria | 1071 |
| 12 | Ga0070668_100066136 | 3300005347 | Bacteria | 2804 |
| 13 | Ga0070668_100091258 | 3300005347 | Bacteria | 2401 |
| 14 | Ga0070669_100246002 | 3300005353 | Bacteria | 1422 |
| 15 | Ga0070675_100170274 | 3300005354 | Bacteria | 1877 |
| 16 | Ga0070674_100033619 | 3300005356 | Bacteria | 3415 |
| 17 | Ga0070659_100144582 | 3300005366 | Bacteria | 1937 |
| 18 | Ga0070659_100213127 | 3300005366 | Bacteria | 1592 |
| 19 | Ga0070659_100379906 | 3300005366 | Bacteria | 1190 |
| 20 | Ga0070709_10224267 | 3300005434 | Bacteria | 1342 |
| 21 | Ga0070714_100342940 | 3300005435 | Bacteria | 1402 |
| 22 | Ga0070714_100352874 | 3300005435 | Bacteria | 1382 |
| 23 | Ga0070714_100368100 | 3300005435 | Bacteria | 1353 |
| 24 | Ga0070713_100071323 | 3300005436 | Bacteria | 2935 |
| 25 | Ga0070713_100115785 | 3300005436 | Bacteria | 2343 |
| 26 | Ga0070710_10144539 | 3300005437 | Bacteria | 1461 |
| 27 | Ga0070710_10245401 | 3300005437 | Bacteria | 1149 |
| 28 | Ga0070711_100018137 | 3300005439 | Bacteria | 4489 |
| 29 | Ga0070711_100315846 | 3300005439 | Bacteria | 1247 |
| 30 | Ga0070700_100132162 | 3300005441 | Bacteria | 1686 |
| 31 | Ga0070708_100331226 | 3300005445 | Bacteria | 1434 |
| 32 | Ga0070708_100342723 | 3300005445 | Bacteria | 1408 |
| 33 | Ga0070663_100005493 | 3300005455 | Bacteria | 7536 |
| 34 | Ga0070663_100134995 | 3300005455 | Bacteria | 1878 |
| 35 | Ga0070678_100042215 | 3300005456 | Bacteria | 3240 |
| 36 | Ga0070678_100204750 | 3300005456 | Bacteria | 1631 |
| 37 | Ga0070662_100116580 | 3300005457 | Bacteria | 2041 |
| 38 | Ga0070662_100138831 | 3300005457 | Bacteria | 1881 |
| 39 | Ga0070681_10111785 | 3300005458 | Bacteria | 2671 |
| 40 | Ga0070681_10332899 | 3300005458 | Bacteria | 1428 |
| 41 | Ga0068867_100156792 | 3300005459 | Bacteria | 1793 |
| 42 | Ga0068867_100323153 | 3300005459 | Bacteria | 1279 |
| 43 | Ga0070685_10175952 | 3300005466 | Bacteria | 1374 |
| 44 | Ga0070706_100405438 | 3300005467 | Bacteria | 1269 |
| 45 | Ga0070706_100582837 | 3300005467 | Bacteria | 1040 |
| 46 | Ga0070707_100213467 | 3300005468 | Bacteria | 1881 |
| 47 | Ga0070699_100088571 | 3300005518 | Bacteria | 2703 |
| 48 | Ga0070699_100453019 | 3300005518 | Bacteria | 1163 |
| 49 | Ga0070679_100061096 | 3300005530 | Bacteria | 3756 |
| 50 | Ga0070697_100090264 | 3300005536 | Bacteria | 2532 |
| 51 | Ga0070697_100480900 | 3300005536 | Bacteria | 1084 |
| 52 | Ga0068853_100210834 | 3300005539 | Bacteria | 1770 |
| 53 | Ga0070672_100136130 | 3300005543 | Bacteria | 2023 |
| 54 | Ga0070672_100645907 | 3300005543 | Bacteria | 924 |
| 55 | Ga0070696_100176538 | 3300005546 | Bacteria | 1583 |
| 56 | Ga0070696_100273903 | 3300005546 | Bacteria | 1284 |
| 57 | Ga0070693_100040363 | 3300005547 | Bacteria | 2620 |
| 58 | Ga0070693_100276388 | 3300005547 | Bacteria | 1123 |
| 59 | Ga0070665_100157518 | 3300005548 | Bacteria | 2273 |
| 60 | Ga0068855_100115059 | 3300005563 | Bacteria | 3084 |
| 61 | Ga0068855_100156405 | 3300005563 | Bacteria | 2589 |
| 62 | Ga0070664_100481794 | 3300005564 | Bacteria | 1142 |
| 63 | Ga0068857_100026472 | 3300005577 | Bacteria | 5113 |
| 64 | Ga0068854_100117861 | 3300005578 | Bacteria | 2011 |
| 65 | Ga0068856_100148323 | 3300005614 | Bacteria | 2353 |
| 66 | Ga0068856_100150136 | 3300005614 | Bacteria | 2339 |
| 67 | Ga0070702_100097968 | 3300005615 | Bacteria | 1793 |
| 68 | Ga0068852_100002547 | 3300005616 | Bacteria | 12557 |
| 69 | Ga0068852_100737554 | 3300005616 | Bacteria | 997 |
| 70 | Ga0068864_100242978 | 3300005618 | Bacteria | 1668 |
| 71 | Ga0068866_10296037 | 3300005718 | Bacteria | 1009 |
| 72 | Ga0068861_100114761 | 3300005719 | Bacteria | 2163 |
| 73 | Ga0068861_100849576 | 3300005719 | Bacteria | 860 |
| 74 | Ga0068870_10142706 | 3300005840 | Bacteria | 1403 |
| 75 | Ga0068863_100081050 | 3300005841 | Bacteria | 3074 |
| 76 | Ga0068858_100005442 | 3300005842 | Bacteria | 12465 |
| 77 | Ga0081455_10001280 | 3300005937 | Bacteria | 31292 |
| 78 | Ga0081455_10005009 | 3300005937 | Bacteria | 14652 |
| 79 | Ga0081455_10006109 | 3300005937 | Bacteria | 13011 |
| 80 | Ga0081455_10009321 | 3300005937 | Bacteria | 10104 |
| 81 | Ga0081455_10021388 | 3300005937 | Bacteria | 6068 |
| 82 | Ga0081455_10023945 | 3300005937 | Bacteria | 5668 |
| 83 | Ga0081455_10039797 | 3300005937 | Bacteria | 4151 |
| 84 | Ga0081455_10054744 | 3300005937 | Bacteria | 3398 |
| 85 | Ga0081538_10006867 | 3300005981 | Bacteria | 9911 |
| 86 | Ga0081538_10011456 | 3300005981 | Bacteria | 7181 |
| 87 | Ga0081540_1002273 | 3300005983 | Bacteria | 15792 |
| 88 | Ga0081540_1008687 | 3300005983 | Bacteria | 7074 |
| 89 | Ga0081540_1024602 | 3300005983 | Bacteria | 3491 |
| 90 | Ga0081540_1034330 | 3300005983 | Bacteria | 2738 |
| 91 | Ga0081539_10000726 | 3300005985 | Bacteria | 66051 |
| 92 | Ga0081539_10009085 | 3300005985 | Bacteria | 8419 |
| 93 | Ga0081539_10045148 | 3300005985 | Bacteria | 2537 |
| 94 | Ga0081539_10079199 | 3300005985 | Bacteria | 1732 |
| 95 | Ga0070717_10015837 | 3300006028 | Bacteria | 5830 |
| 96 | Ga0070717_10045837 | 3300006028 | Bacteria | 3576 |
| 97 | Ga0070717_10076324 | 3300006028 | Bacteria | 2804 |
| 98 | Ga0070717_10355896 | 3300006028 | Bacteria | 1310 |
| 99 | Ga0075368_10021110 | 3300006042 | Bacteria | 2471 |
| 100 | Ga0075368_10035880 | 3300006042 | Bacteria | 1936 |
| 101 | Ga0075364_10051210 | 3300006051 | Bacteria | 2696 |
| 102 | Ga0075432_10075381 | 3300006058 | Bacteria | 1217 |
| 103 | Ga0070715_10005685 | 3300006163 | Bacteria | 4181 |
| 104 | Ga0070715_10216608 | 3300006163 | Bacteria | 982 |
| 105 | Ga0070716_100047588 | 3300006173 | Bacteria | 2420 |
| 106 | Ga0070712_100275363 | 3300006175 | Bacteria | 1354 |
| 107 | Ga0075369_10069968 | 3300006186 | Bacteria | 1543 |
| 108 | Ga0075427_10015903 | 3300006194 | Bacteria | 1165 |
| 109 | Ga0075428_100111593 | 3300006844 | Bacteria | 2979 |
| 110 | Ga0075428_100258470 | 3300006844 | Bacteria | 1875 |
| 111 | Ga0075428_100774821 | 3300006844 | Bacteria | 1020 |
| 112 | Ga0075430_100020556 | 3300006846 | Bacteria | 5615 |
| 113 | Ga0075430_100026312 | 3300006846 | Bacteria | 4951 |
| 114 | Ga0075430_100460557 | 3300006846 | Bacteria | 1049 |
| 115 | Ga0075431_100138817 | 3300006847 | Bacteria | 2506 |
| 116 | Ga0075431_100411366 | 3300006847 | Bacteria | 1353 |
| 117 | Ga0075433_10081818 | 3300006852 | Bacteria | 2847 |
| 118 | Ga0075433_10210483 | 3300006852 | Bacteria | 1728 |
| 119 | Ga0075433_10390914 | 3300006852 | Bacteria | 1227 |
| 120 | Ga0075434_100064983 | 3300006871 | Bacteria | 3633 |
| 121 | Ga0075434_100165178 | 3300006871 | Bacteria | 2233 |
| 122 | Ga0075434_100266547 | 3300006871 | Bacteria | 1732 |
| 123 | Ga0075434_100613705 | 3300006871 | Bacteria | 1107 |
| 124 | Ga0075429_100372927 | 3300006880 | Bacteria | 1249 |
| 125 | Ga0068865_100149854 | 3300006881 | Bacteria | 1769 |
| 126 | Ga0075436_100048089 | 3300006914 | Bacteria | 2943 |
| 127 | Ga0075435_100251182 | 3300007076 | Bacteria | 1505 |
| 128 | Ga0075435_100558670 | 3300007076 | Bacteria | 992 |
| 129 | Ga0099794_10016238 | 3300007265 | Bacteria | 3298 |
| 130 | Ga0099794_10076766 | 3300007265 | Bacteria | 1643 |
| 131 | Ga0099795_10069163 | 3300007788 | Bacteria | 1328 |
| 132 | Ga0105250_10075635 | 3300009092 | Bacteria | 1362 |
| 133 | Ga0105240_10100746 | 3300009093 | Bacteria | 3514 |
| 134 | Ga0105240_10466306 | 3300009093 | Bacteria | 1410 |
| 135 | Ga0105240_11126833 | 3300009093 | Bacteria | 834 |
| 136 | Ga0111539_10026889 | 3300009094 | Bacteria | 7029 |
| 137 | Ga0111539_10205363 | 3300009094 | Bacteria | 2296 |
| 138 | Ga0111539_10354998 | 3300009094 | Bacteria | 1706 |
| 139 | Ga0111539_10534941 | 3300009094 | Bacteria | 1365 |
| 140 | Ga0111539_10998127 | 3300009094 | Bacteria | 973 |
| 141 | Ga0105245_10039196 | 3300009098 | Bacteria | 4217 |
| 142 | Ga0105245_10160101 | 3300009098 | Bacteria | 2135 |
| 143 | Ga0105247_10025455 | 3300009101 | Bacteria | 3569 |
| 144 | Ga0114129_10079273 | 3300009147 | Bacteria | 4567 |
| 145 | Ga0114129_10339316 | 3300009147 | Bacteria | 1993 |
| 146 | Ga0114129_10557592 | 3300009147 | Bacteria | 1489 |
| 147 | Ga0105243_10376316 | 3300009148 | Bacteria | 1312 |
| 148 | Ga0105241_10041599 | 3300009174 | Bacteria | 3473 |
| 149 | Ga0105242_10328590 | 3300009176 | Bacteria | 1405 |
| 150 | Ga0105248_10050893 | 3300009177 | Bacteria | 4648 |
| 151 | Ga0105238_10034956 | 3300009551 | Bacteria | 5112 |
| 152 | Ga0105238_10556681 | 3300009551 | Bacteria | 1151 |
| 153 | Ga0105249_10080019 | 3300009553 | Bacteria | 3035 |
| 154 | Ga0105249_10214559 | 3300009553 | Bacteria | 1891 |
| 155 | Ga0105239_10142225 | 3300010375 | Bacteria | 2674 |
| 156 | Ga0105239_10341529 | 3300010375 | Bacteria | 1690 |
| 157 | Ga0105239_10518452 | 3300010375 | Bacteria | 1356 |
| 158 | Ga0105239_10837993 | 3300010375 | Bacteria | 1054 |
| 159 | Ga0105246_10069752 | 3300011119 | Bacteria | 2470 |
| 160 | Ga0157370_10062738 | 3300013104 | Bacteria | 3523 |
| 161 | Ga0157369_10022574 | 3300013105 | Bacteria | 7019 |
| 162 | Ga0157369_10247236 | 3300013105 | Bacteria | 1862 |
| 163 | Ga0157374_10200656 | 3300013296 | Bacteria | 1953 |
| 164 | Ga0163162_10096698 | 3300013306 | Bacteria | 3041 |
| 165 | Ga0163162_10401571 | 3300013306 | Bacteria | 1503 |
| 166 | Ga0163162_10585663 | 3300013306 | Bacteria | 1242 |
| 167 | Ga0157375_10087997 | 3300013308 | Bacteria | 3160 |
| 168 | Ga0163163_10499371 | 3300014325 | Bacteria | 1278 |
| 169 | Ga0157380_10068265 | 3300014326 | Bacteria | 2865 |
| 170 | Ga0157376_10095030 | 3300014969 | Bacteria | 2591 |
| 171 | Ga0163161_10146394 | 3300017792 | Bacteria | 1792 |
| 172 | Ga0213873_10040091 | 3300021358 | Bacteria | 1202 |
| 173 | Ga0213876_10002788 | 3300021384 | Bacteria | 10179 |
| 174 | Ga0213876_10004257 | 3300021384 | Bacteria | 8025 |
| 175 | Ga0213876_10187571 | 3300021384 | Bacteria | 1100 |
| 176 | Ga0213875_10090328 | 3300021388 | Bacteria | 1428 |
| 177 | Ga0213875_10212032 | 3300021388 | Bacteria | 912 |
| 178 | Ga0213871_10007597 | 3300021441 | Bacteria | 2353 |
| 179 | Ga0224712_10007228 | 3300022467 | Bacteria | 3221 |
| 180 | Ga0228598_1039499 | 3300024227 | Bacteria | 931 |
| 181 | Ga0209025_1001512 | 3300025294 | Bacteria | 29864 |
| 182 | Ga0209758_1009660 | 3300025297 | Bacteria | 5943 |
| 183 | Ga0207653_10008693 | 3300025885 | Bacteria | 3167 |
| 184 | Ga0207642_10046969 | 3300025899 | Bacteria | 1927 |
| 185 | Ga0207642_10063153 | 3300025899 | Bacteria | 1731 |
| 186 | Ga0207710_10016666 | 3300025900 | Bacteria | 3110 |
| 187 | Ga0207688_10036235 | 3300025901 | Bacteria | 2735 |
| 188 | Ga0207685_10131304 | 3300025905 | Bacteria | 1112 |
| 189 | Ga0207699_10007096 | 3300025906 | Bacteria | 5461 |
| 190 | Ga0207645_10097199 | 3300025907 | Bacteria | 1898 |
| 191 | Ga0207645_10105252 | 3300025907 | Bacteria | 1823 |
| 192 | Ga0207705_10117987 | 3300025909 | Bacteria | 1966 |
| 193 | Ga0207684_10192680 | 3300025910 | Bacteria | 1758 |
| 194 | Ga0207707_10041441 | 3300025912 | Bacteria | 4021 |
| 195 | Ga0207707_10106512 | 3300025912 | Bacteria | 2451 |
| 196 | Ga0207695_10667258 | 3300025913 | Bacteria | 920 |
| 197 | Ga0207693_10027049 | 3300025915 | Bacteria | 4537 |
| 198 | Ga0207693_10232883 | 3300025915 | Bacteria | 1446 |
| 199 | Ga0207663_10103814 | 3300025916 | Bacteria | 1915 |
| 200 | Ga0207657_10038674 | 3300025919 | Bacteria | 4245 |
| 201 | Ga0207652_10561702 | 3300025921 | Bacteria | 1025 |
| 202 | Ga0207652_10606977 | 3300025921 | Bacteria | 981 |
| 203 | Ga0207681_10560419 | 3300025923 | Bacteria | 941 |
| 204 | Ga0207694_10033748 | 3300025924 | Bacteria | 3921 |
| 205 | Ga0207650_10405622 | 3300025925 | Bacteria | 1129 |
| 206 | Ga0207659_10093113 | 3300025926 | Bacteria | 2255 |
| 207 | Ga0207687_10037457 | 3300025927 | Bacteria | 3309 |
| 208 | Ga0207687_10055615 | 3300025927 | Bacteria | 2773 |
| 209 | Ga0207700_10041513 | 3300025928 | Bacteria | 3366 |
| 210 | Ga0207664_10648637 | 3300025929 | Bacteria | 949 |
| 211 | Ga0207644_10109090 | 3300025931 | Bacteria | 2090 |
| 212 | Ga0207690_10347421 | 3300025932 | Bacteria | 1172 |
| 213 | Ga0207690_10441147 | 3300025932 | Bacteria | 1045 |
| 214 | Ga0207706_10124568 | 3300025933 | Bacteria | 2267 |
| 215 | Ga0207706_10131987 | 3300025933 | Bacteria | 2197 |
| 216 | Ga0207686_10033881 | 3300025934 | Bacteria | 3051 |
| 217 | Ga0207709_10055777 | 3300025935 | Bacteria | 2443 |
| 218 | Ga0207709_10103794 | 3300025935 | Bacteria | 1885 |
| 219 | Ga0207670_10213155 | 3300025936 | Bacteria | 1474 |
| 220 | Ga0207669_10096029 | 3300025937 | Bacteria | 1944 |
| 221 | Ga0207669_10205587 | 3300025937 | Bacteria | 1433 |
| 222 | Ga0207665_10020165 | 3300025939 | Bacteria | 4380 |
| 223 | Ga0207691_10085044 | 3300025940 | Bacteria | 2839 |
| 224 | Ga0207711_10019309 | 3300025941 | Bacteria | 5676 |
| 225 | Ga0207689_10110996 | 3300025942 | Bacteria | 2253 |
| 226 | Ga0207667_10098162 | 3300025949 | Bacteria | 3023 |
| 227 | Ga0207667_10691756 | 3300025949 | Bacteria | 1023 |
| 228 | Ga0207651_10050713 | 3300025960 | Bacteria | 2820 |
| 229 | Ga0207668_10044494 | 3300025972 | Bacteria | 3020 |
| 230 | Ga0207668_10204720 | 3300025972 | Bacteria | 1574 |
| 231 | Ga0207658_10121741 | 3300025986 | Bacteria | 2082 |
| 232 | Ga0207703_10053258 | 3300026035 | Bacteria | 3288 |
| 233 | Ga0207678_10054273 | 3300026067 | Bacteria | 3451 |
| 234 | Ga0207678_10231130 | 3300026067 | Bacteria | 1583 |
| 235 | Ga0207708_10055030 | 3300026075 | Bacteria | 3033 |
| 236 | Ga0207702_10067383 | 3300026078 | Bacteria | 3072 |
| 237 | Ga0207648_10049071 | 3300026089 | Bacteria | 3695 |
| 238 | Ga0207648_10241638 | 3300026089 | Bacteria | 1608 |
| 239 | Ga0207648_10521231 | 3300026089 | Bacteria | 1089 |
| 240 | Ga0207676_10007871 | 3300026095 | Bacteria | 7579 |
| 241 | Ga0207674_10002930 | 3300026116 | Bacteria | 21206 |
| 242 | Ga0207674_10034187 | 3300026116 | Bacteria | 5318 |
| 243 | Ga0207674_10049920 | 3300026116 | Bacteria | 4277 |
| 244 | Ga0207675_100104366 | 3300026118 | Bacteria | 2671 |
| 245 | Ga0207675_100253913 | 3300026118 | Bacteria | 1702 |
| 246 | Ga0207683_10029574 | 3300026121 | Bacteria | 4743 |
| 247 | Ga0207683_10072136 | 3300026121 | Bacteria | 3054 |
| 248 | Ga0207698_10122647 | 3300026142 | Bacteria | 2203 |
| 249 | Ga0207428_10010236 | 3300027907 | Bacteria | 8383 |
| 250 | Ga0207428_10259419 | 3300027907 | Bacteria | 1295 |
| 251 | Ga0268266_10035315 | 3300028379 | Bacteria | 4252 |
| 252 | Ga0268266_10045599 | 3300028379 | Bacteria | 3750 |
| 253 | Ga0268265_10011432 | 3300028380 | Bacteria | 6001 |
| 254 | Ga0268265_10266262 | 3300028380 | Bacteria | 1526 |
| 255 | Ga0268265_10683839 | 3300028380 | Bacteria | 989 |
| 256 | Ga0268264_10166108 | 3300028381 | Bacteria | 1992 |
| 257 | Ga0265338_10074974 | 3300028800 | Bacteria | 2873 |
| 258 | Ga0265763_1005432 | 3300030763 | Bacteria | 1069 |
| 259 | Ga0265325_10113443 | 3300031241 | Bacteria | 1314 |
| 260 | Ga0265339_10005488 | 3300031249 | Bacteria | 8447 |
| 261 | Ga0307509_10162799 | 3300031507 | Bacteria | 2125 |
| 262 | Ga0307408_100230427 | 3300031548 | Bacteria | 1517 |
| 263 | Ga0265313_10000131 | 3300031595 | Bacteria | 75926 |
| 264 | Ga0307410_10053728 | 3300031852 | Bacteria | 2727 |
| 265 | Ga0307412_10186646 | 3300031911 | Bacteria | 1564 |
| 266 | Ga0307416_100038721 | 3300032002 | Bacteria | 3681 |
| 267 | Ga0307416_100056299 | 3300032002 | Bacteria | 3173 |
| 268 | Ga0307414_10127418 | 3300032004 | Bacteria | 1970 |
| 269 | Ga0307411_10024645 | 3300032005 | Bacteria | 3590 |
| 270 | Ga0307415_100098440 | 3300032126 | Bacteria | 2138 |
| 271 | Ga0307510_10007185 | 3300033180 | Bacteria | 13262 |
| 272 | Ga0373923_0011341 | 3300035111 | Bacteria | 3266 |
| 273 | Ga0373954_0008901 | 3300035118 | Bacteria | 4417 |
| 274 | Ga0373956_0003850 | 3300035119 | Bacteria | 6039 |
| 275 | Ga0373956_0073741 | 3300035119 | Bacteria | 1560 |
| 276 | Ga0373957_0039020 | 3300035120 | Bacteria | 1780 |
| 277 | Ga0373943_0066594 | 3300035170 | Bacteria | 1814 |
| 278 | Ga0373946_0146888 | 3300035171 | Bacteria | 1097 |
| 279 | Ga0373946_0151036 | 3300035171 | Bacteria | 1084 |
| 280 | Ga0373924_0007927 | 3300035410 | Bacteria | 3844 |
| 281 | Ga0373935_0060235 | 3300035692 | Bacteria | 2428 |
| 282 | Ga0373927_0036463 | 3300035695 | Bacteria | 3198 |
| 283 | Ga0373927_0051140 | 3300035695 | Bacteria | 2672 |
| 284 | Ga0373927_0229552 | 3300035695 | Bacteria | 1219 |
| 285 | Ga0373947_0064742 | 3300035725 | Bacteria | 2229 |
| 286 | Ga0373937_0502307 | 3300036401 | Bacteria | 1152 |
| 287 | Ga0316582_0183176 | 3300036647 | Bacteria | 1425 |
| 288 | Ga0373925_0101705 | 3300037068 | Bacteria | 2210 |
| 289 | Ga0373925_0183120 | 3300037068 | Bacteria | 1659 |
| 290 | Ga0373925_0197210 | 3300037068 | Bacteria | 1600 |
| 291 | Ga0395899_0089324 | 3300037312 | Bacteria | 2235 |
| 292 | Ga0395899_0119669 | 3300037312 | Bacteria | 1887 |
| 293 | Ga0395900_0015669 | 3300037418 | Bacteria | 7728 |
| 294 | Ga0395900_0237034 | 3300037418 | Bacteria | 1832 |
| 295 | Ga0395898_0060757 | 3300037466 | Bacteria | 3672 |
| 296 | Ga0395898_0158887 | 3300037466 | Bacteria | 2162 |
| 297 | Ga0395905_0006632 | 3300037471 | Bacteria | 11604 |
| 298 | Ga0395905_0045589 | 3300037471 | Bacteria | 4112 |
| 299 | Ga0395905_0067708 | 3300037471 | Bacteria | 3344 |
| 300 | Ga0395905_0074713 | 3300037471 | Bacteria | 3177 |
| 301 | Ga0395905_0162212 | 3300037471 | Bacteria | 2101 |
| 302 | Ga0395905_0414824 | 3300037471 | Bacteria | 1242 |
| 303 | Ga0395905_0594625 | 3300037471 | Bacteria | 1008 |
| 304 | Ga0436364_0329188 | 3300037853 | Bacteria | 16674 |
| 305 | Ga0436364_0817427 | 3300037853 | Bacteria | 1033 |
| 306 | Ga0395901_0006908 | 3300038443 | Bacteria | 11467 |
| 307 | Ga0395901_0043447 | 3300038443 | Bacteria | 4662 |
| 308 | Ga0395901_0067661 | 3300038443 | Bacteria | 3720 |
| 309 | Ga0395901_0072012 | 3300038443 | Bacteria | 3602 |
| 310 | Ga0395901_0658513 | 3300038443 | Bacteria | 1049 |
| 311 | Ga0400486_22289 | 3300038742 | Bacteria | 3166 |
| 312 | Ga0400487_25960 | 3300039110 | Bacteria | 3122 |
| 313 | Ga0436365_0190362 | 3300039437 | Bacteria | 40496 |
| 314 | Ga0436365_0260170 | 3300039437 | Bacteria | 52235 |
| 315 | Ga0436365_0275343 | 3300039437 | Bacteria | 3434 |
| 316 | Ga0436360_0693057 | 3300039438 | Bacteria | 5079 |
| 317 | Ga0436360_1279071 | 3300039438 | Bacteria | 4959 |
| 318 | Ga0436361_0424425 | 3300039447 | Bacteria | 14085 |
| 319 | Ga0436361_1149293 | 3300039447 | Bacteria | 6067 |
| 320 | Ga0436363_0809548 | 3300039450 | Bacteria | 8310 |
| 321 | Ga0436363_1207525 | 3300039450 | Bacteria | 1128 |
| 322 | Ga0436363_1583481 | 3300039450 | Bacteria | 855 |
| 323 | Ga0436362_0204855 | 3300039453 | Bacteria | 17349 |
| 324 | Ga0436362_0584849 | 3300039453 | Bacteria | 5582 |
| 325 | Ga0466972_0004633 | 3300044658 | Bacteria | 6885 |
| 326 | Ga0466964_0045186 | 3300044706 | Bacteria | 1792 |
| 327 | Ga0466968_0000249 | 3300044735 | Bacteria | 17055 |
| 328 | Ga0466960_0005567 | 3300044901 | Bacteria | 4994 |
| 329 | Ga0466959_0068177 | 3300045049 | Bacteria | 2578 |
| 330 | Ga0466958_0021589 | 3300045836 | Bacteria | 3765 |
| 331 | Ga0495617_031525 | 3300046452 | Bacteria | 1780 |
| 332 | Ga0495592_0025015 | 3300046454 | Bacteria | 4535 |
| 333 | Ga0495592_0089342 | 3300046454 | Bacteria | 2213 |
| 334 | Ga0495603_0015346 | 3300046455 | Bacteria | 4635 |
| 335 | Ga0495603_0082720 | 3300046455 | Bacteria | 1880 |
| 336 | Ga0495629_0139925 | 3300046459 | Bacteria | 1684 |
| 337 | Ga0495629_0383454 | 3300046459 | Bacteria | 956 |
| 338 | Ga0495638_0090618 | 3300046460 | Bacteria | 1843 |
| 339 | Ga0495651_0070783 | 3300046462 | Bacteria | 2653 |
| 340 | Ga0495651_0211293 | 3300046462 | Bacteria | 1350 |
| 341 | Ga0495653_0045571 | 3300046463 | Bacteria | 3400 |
| 342 | Ga0495582_0038974 | 3300046473 | Bacteria | 2616 |
| 343 | Ga0495605_0026193 | 3300046474 | Bacteria | 3032 |
| 344 | Ga0495639_0007249 | 3300046475 | Bacteria | 4761 |
| 345 | Ga0495662_0029090 | 3300046476 | Bacteria | 2668 |
| 346 | Ga0495662_0058245 | 3300046476 | Bacteria | 1866 |
| 347 | Ga0495664_0003009 | 3300046477 | Bacteria | 9117 |
| 348 | Ga0495585_0053855 | 3300046492 | Bacteria | 2226 |
| 349 | Ga0495594_0018386 | 3300046499 | Bacteria | 3701 |
| 350 | Ga0495594_0155476 | 3300046499 | Bacteria | 1299 |
| 351 | Ga0495608_0014617 | 3300046511 | Bacteria | 5445 |
| 352 | Ga0495616_0088471 | 3300046513 | Bacteria | 1470 |
| 353 | Ga0495616_0104350 | 3300046513 | Bacteria | 1325 |
| 354 | Ga0495618_0060818 | 3300046514 | Bacteria | 2395 |
| 355 | Ga0495628_0038018 | 3300046516 | Bacteria | 3856 |
| 356 | Ga0495628_0270418 | 3300046516 | Bacteria | 1264 |
| 357 | Ga0495631_0036628 | 3300046518 | Bacteria | 2190 |
| 358 | Ga0495632_0050219 | 3300046519 | Bacteria | 2058 |
| 359 | Ga0495644_0028601 | 3300046523 | Bacteria | 2109 |
| 360 | Ga0495663_0012675 | 3300046525 | Bacteria | 2351 |
| 361 | Ga0495663_0017939 | 3300046525 | Bacteria | 2012 |
| 362 | Ga0495652_0082365 | 3300046529 | Bacteria | 2652 |
| 363 | Ga0495640_0067610 | 3300046533 | Bacteria | 2406 |
| 364 | Ga0495640_0101687 | 3300046533 | Bacteria | 1886 |
| 365 | Ga0495587_0010482 | 3300046536 | Bacteria | 5896 |
| 366 | Ga0495587_0040791 | 3300046536 | Bacteria | 2772 |
| 367 | Ga0495598_0003339 | 3300046537 | Bacteria | 3400 |
| 368 | Ga0495609_0061763 | 3300046538 | Bacteria | 1655 |
| 369 | Ga0495621_0009097 | 3300046539 | Bacteria | 3004 |
| 370 | Ga0495597_0032596 | 3300046542 | Bacteria | 2364 |
| 371 | Ga0495633_0015543 | 3300046558 | Bacteria | 3946 |
| 372 | Ga0495633_0018591 | 3300046558 | Bacteria | 3527 |
| 373 | Ga0495667_0019300 | 3300046559 | Bacteria | 4600 |
| 374 | Ga0495667_0217629 | 3300046559 | Bacteria | 1219 |
| 375 | Ga0495611_0041739 | 3300046648 | Bacteria | 2047 |
| 376 | Ga0495659_0012707 | 3300046664 | Bacteria | 2732 |
| 377 | Ga0495659_0029639 | 3300046664 | Bacteria | 1900 |
| 378 | Ga0495588_0005748 | 3300046674 | Bacteria | 5538 |
| 379 | Ga0495657_0055781 | 3300046675 | Bacteria | 2635 |
| 380 | Ga0495599_0058233 | 3300046678 | Bacteria | 2417 |
| 381 | Ga0495646_0018676 | 3300046680 | Bacteria | 4391 |
| 382 | Ga0495646_0149104 | 3300046680 | Bacteria | 1302 |
| 383 | Ga0495658_0245788 | 3300046683 | Bacteria | 1124 |
| 384 | Ga0495669_0206654 | 3300046684 | Bacteria | 939 |
| 385 | Ga0495613_0121305 | 3300046689 | Bacteria | 1877 |
| 386 | Ga0495624_0208383 | 3300046690 | Bacteria | 1186 |
| 387 | Ga0495670_0071256 | 3300046691 | Bacteria | 1759 |
| 388 | Ga0495670_0085672 | 3300046691 | Bacteria | 1608 |
| 389 | Ga0495671_0069501 | 3300046692 | Bacteria | 1731 |
| 390 | Ga0495600_0074802 | 3300046809 | Bacteria | 2212 |
| 391 | Ga0495604_0038094 | 3300047317 | Bacteria | 3783 |
| 392 | Ga0495604_0124365 | 3300047317 | Bacteria | 1862 |
| 393 | Ga0495674_0046602 | 3300047319 | Bacteria | 3847 |
| 394 | Ga0495674_0066194 | 3300047319 | Bacteria | 3136 |
| 395 | Ga0495676_0383016 | 3300047321 | Bacteria | 935 |
| 396 | Ga0495680_0095227 | 3300047322 | Bacteria | 2226 |
| 397 | Ga0495680_0111549 | 3300047322 | Bacteria | 2026 |
| 398 | Ga0495675_0010585 | 3300047444 | Bacteria | 5764 |
| 399 | Ga0495685_045710 | 3300047447 | Bacteria | 1491 |
| 400 | Ga0495673_0019696 | 3300047469 | Bacteria | 3377 |
| 401 | Ga0495681_0115801 | 3300047470 | Bacteria | 1156 |
| 402 | Ga0495593_0043449 | 3300047673 | Bacteria | 2408 |
| 403 | Ga0495602_0000790 | 3300048088 | Bacteria | 30230 |
| 404 | Ga0495602_0088196 | 3300048088 | Bacteria | 2583 |
| 405 | Ga0496100_0017551 | 3300048903 | Bacteria | 4228 |
| 406 | Ga0496101_0226083 | 3300048904 | Bacteria | 1454 |
| 407 | Ga0496102_0000315 | 3300048905 | Bacteria | 60883 |
| 408 | Ga0496102_0536368 | 3300048905 | Bacteria | 1093 |
| 409 | Ga0496102_0705165 | 3300048905 | Bacteria | 932 |
| 410 | Ga0496102_0901346 | 3300048905 | Bacteria | 806 |
| 411 | Ga0496103_0000993 | 3300048906 | Bacteria | 19978 |
| 412 | Ga0496103_0125360 | 3300048906 | Bacteria | 1638 |
| 413 | Ga0496103_0344169 | 3300048906 | Bacteria | 959 |
| 414 | Ga0496103_0354842 | 3300048906 | Bacteria | 943 |
| 415 | Ga0496106_0316307 | 3300048909 | Bacteria | 1253 |
| 416 | Ga0496106_0335967 | 3300048909 | Bacteria | 1213 |
| 417 | Ga0496106_0412930 | 3300048909 | Bacteria | 1085 |
| 418 | Ga0496106_0414611 | 3300048909 | Bacteria | 1082 |
| 419 | Ga0496107_0409947 | 3300048910 | Bacteria | 1008 |
| 420 | Ga0496107_0464553 | 3300048910 | Bacteria | 940 |
| 421 | Ga0496109_0231384 | 3300048912 | Bacteria | 1739 |
| 422 | Ga0496110_0069131 | 3300048913 | Bacteria | 3127 |
| 423 | Ga0496110_0218051 | 3300048913 | Bacteria | 1735 |
| 424 | Ga0496110_0301931 | 3300048913 | Bacteria | 1458 |
| 425 | Ga0496110_0840833 | 3300048913 | Bacteria | 823 |
| 426 | Ga0496112_0018656 | 3300048915 | Bacteria | 6538 |
| 427 | Ga0496112_0069562 | 3300048915 | Bacteria | 3477 |
| 428 | Ga0496112_0105612 | 3300048915 | Bacteria | 2786 |
| 429 | Ga0496112_0276153 | 3300048915 | Bacteria | 1628 |
| 430 | Ga0496113_0115003 | 3300048916 | Bacteria | 2098 |
| 431 | Ga0496114_0066602 | 3300048917 | Bacteria | 3020 |
| 432 | Ga0496114_0225236 | 3300048917 | Bacteria | 1647 |
| 433 | Ga0496116_0008674 | 3300048919 | Bacteria | 8786 |
| 434 | Ga0496117_0000484 | 3300048920 | Bacteria | 65863 |
| 435 | Ga0496118_0000486 | 3300048921 | Bacteria | 65791 |
| 436 | Ga0496121_0105369 | 3300048924 | Bacteria | 2164 |
| 437 | Ga0496121_0158281 | 3300048924 | Bacteria | 1659 |
| 438 | Ga0496125_0277370 | 3300048928 | Bacteria | 1041 |
| 439 | Ga0496126_0335736 | 3300048929 | Bacteria | 1239 |
| 440 | Ga0501031_0027978 | 3300049568 | Bacteria | 3674 |
| 441 | Ga0501034_0109550 | 3300049571 | Bacteria | 2753 |
| 442 | Ga0501036_0030453 | 3300049572 | Bacteria | 4558 |
| 443 | Ga0501038_0295820 | 3300049574 | Bacteria | 1271 |
| 444 | Ga0501040_0094175 | 3300049576 | Bacteria | 2084 |
| 445 | Ga0501042_0115887 | 3300049578 | Bacteria | 1929 |
| 446 | Ga0501046_0070768 | 3300049580 | Bacteria | 2712 |
| 447 | Ga0501047_0055051 | 3300049581 | Bacteria | 3847 |
| 448 | Ga0501067_0172892 | 3300049583 | Bacteria | 1203 |
| 449 | Ga0501070_0069624 | 3300049586 | Bacteria | 2913 |
| 450 | Ga0501074_0226463 | 3300049590 | Bacteria | 1331 |
| 451 | Ga0501076_0536684 | 3300049592 | Bacteria | 964 |
| 452 | Ga0501223_000017 | 3300049663 | Bacteria | 68157 |
| 453 | Ga0501238_008161 | 3300049671 | Bacteria | 1372 |
| 454 | Ga0501225_0000004 | 3300049705 | Bacteria | 140738 |
| 455 | Ga0501080_0342317 | 3300049742 | Bacteria | 1351 |
| 456 | Ga0501081_0109533 | 3300049743 | Bacteria | 1959 |
| 457 | Ga0501035_0079116 | 3300049822 | Bacteria | 2904 |
| 458 | nmdc:mga0yw44_30952_c1 | 3300050492 | Bacteria | 3108 |
| 459 | nmdc:mga05p37_19478_c1 | 3300050507 | Bacteria | 8209 |
| 460 | nmdc:mga05p37_247082_c1 | 3300050507 | Bacteria | 2142 |
| 461 | nmdc:mga05p37_391108_c1 | 3300050507 | Bacteria | 1626 |
| 462 | nmdc:mga05p37_85770_c1 | 3300050507 | Bacteria | 3881 |
| 463 | nmdc:mga05p37_91304_c1 | 3300050507 | Bacteria | 3753 |
| 464 | nmdc:mga09592_152585_c1 | 3300050508 | Bacteria | 1993 |
| 465 | nmdc:mga09592_8478_c1 | 3300050508 | Bacteria | 8359 |
| 466 | nmdc:mga0qj67_116748_c1 | 3300050509 | Bacteria | 2157 |
| 467 | nmdc:mga0qj67_170393_c1 | 3300050509 | Bacteria | 1767 |
| 468 | nmdc:mga0qj67_274908_c1 | 3300050509 | Bacteria | 1365 |
| 469 | nmdc:mga0qj67_63050_c1 | 3300050509 | Bacteria | 2947 |
| 470 | nmdc:mga0qj67_97785_c1 | 3300050509 | Bacteria | 2364 |
| 471 | nmdc:mga06r32_110797_c1 | 3300050510 | Bacteria | 2701 |
| 472 | nmdc:mga06r32_135902_c1 | 3300050510 | Bacteria | 2433 |
| 473 | nmdc:mga06r32_228062_c1 | 3300050510 | Bacteria | 1851 |
| 474 | nmdc:mga08y16_1039751_c1 | 3300050511 | Bacteria | 797 |
| 475 | nmdc:mga08y16_127245_c1 | 3300050511 | Bacteria | 2650 |
| 476 | nmdc:mga08y16_14183_c1 | 3300050511 | Bacteria | 8386 |
| 477 | nmdc:mga0n895_112627_c1 | 3300050512 | Bacteria | 2738 |
| 478 | nmdc:mga0n895_230407_c1 | 3300050512 | Bacteria | 1880 |
| 479 | nmdc:mga0n895_5196_c1 | 3300050512 | Bacteria | 10834 |
| 480 | nmdc:mga0n895_59117_c1 | 3300050512 | Bacteria | 3782 |
| 481 | nmdc:mga0rr50_168696_c1 | 3300050513 | Bacteria | 1782 |
| 482 | nmdc:mga0rr50_382725_c1 | 3300050513 | Bacteria | 1187 |
| 483 | nmdc:mga0rr50_437155_c1 | 3300050513 | Bacteria | 1108 |
| 484 | nmdc:mga08x19_215382_c1 | 3300050514 | Bacteria | 1319 |
| 485 | nmdc:mga08x19_376017_c1 | 3300050514 | Bacteria | 994 |
| 486 | nmdc:mga08x19_84541_c1 | 3300050514 | Bacteria | 2087 |
| 487 | nmdc:mga0a205_100988_c1 | 3300050515 | Bacteria | 2783 |
| 488 | nmdc:mga0a205_120792_c1 | 3300050515 | Bacteria | 2519 |
| 489 | nmdc:mga0a205_141741_c1 | 3300050515 | Bacteria | 2304 |
| 490 | nmdc:mga0a205_87149_c1 | 3300050515 | Bacteria | 3016 |
| 491 | nmdc:mga0sz30_65455_c1 | 3300050516 | Bacteria | 1558 |
| 492 | Ga0495601_0003666 | 3300053077 | Bacteria | 8829 |
| 493 | Ga0495601_0116559 | 3300053077 | Bacteria | 1732 |
| 494 | Ga0495612_0002987 | 3300053078 | Bacteria | 7016 |
| 495 | Ga0495612_0012385 | 3300053078 | Bacteria | 3438 |
| 496 | Ga0495595_0025381 | 3300053084 | Bacteria | 2626 |
| 497 | Ga0495619_0018387 | 3300053085 | Bacteria | 4434 |
| 498 | Ga0495619_0022453 | 3300053085 | Bacteria | 4039 |
| 499 | Ga0500592_013992 | 3300053116 | Bacteria | 1286 |
| 500 | Ga0500595_002626 | 3300053119 | Bacteria | 8752 |
| 501 | Ga0500590_019375 | 3300053148 | Bacteria | 3526 |
| 502 | Ga0500616_0006401 | 3300053153 | Bacteria | 7719 |
| 503 | Ga0500645_011715 | 3300053730 | Bacteria | 2853 |
| 504 | Ga0501084_0106019 | 3300054114 | Bacteria | 2361 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049574 | Ga0501038_0295820 | Ga0501038_0295820_567_1259 | 223 |
| 2 | 3300046648 | Ga0495611_0041739 | Ga0495611_0041739_1317_2033 | 232 |
| 3 | 3300009094 | Ga0111539_10534941 | Ga0111539_105349411 | 233 |
| 4 | 3300006844 | Ga0075428_100258470 | Ga0075428_1002584702 | 234 |
| 5 | 3300006846 | Ga0075430_100460557 | Ga0075430_1004605572 | 234 |
| 6 | 3300006847 | Ga0075431_100138817 | Ga0075431_1001388171 | 234 |
| 7 | 3300006852 | Ga0075433_10081818 | Ga0075433_100818183 | 234 |
| 8 | 3300006871 | Ga0075434_100613705 | Ga0075434_1006137051 | 234 |
| 9 | 3300006914 | Ga0075436_100048089 | Ga0075436_1000480892 | 234 |
| 10 | 3300007076 | Ga0075435_100251182 | Ga0075435_1002511822 | 234 |
| 11 | 3300009094 | Ga0111539_10998127 | Ga0111539_109981271 | 234 |
| 12 | 3300027907 | Ga0207428_10259419 | Ga0207428_102594191 | 234 |
| 13 | 3300037418 | Ga0395900_0015669 | Ga0395900_0015669_1717_2457 | 234 |
| 14 | 3300037471 | Ga0395905_0067708 | Ga0395905_0067708_896_1636 | 234 |
| 15 | 3300038443 | Ga0395901_0072012 | Ga0395901_0072012_1154_1894 | 234 |
| 16 | 3300048905 | Ga0496102_0901346 | Ga0496102_0901346_14_754 | 234 |
| 17 | 3300048909 | Ga0496106_0412930 | Ga0496106_0412930_124_864 | 234 |
| 18 | 3300048910 | Ga0496107_0464553 | Ga0496107_0464553_33_773 | 234 |
| 19 | 3300050507 | nmdc:mga05p37_91304_c1 | nmdc:mga05p37_91304_c1_663_1403 | 234 |
| 20 | 3300050508 | nmdc:mga09592_152585_c1 | nmdc:mga09592_152585_c1_1181_1921 | 234 |
| 21 | 3300050510 | nmdc:mga06r32_228062_c1 | nmdc:mga06r32_228062_c1_183_923 | 234 |
| 22 | 3300050511 | nmdc:mga08y16_127245_c1 | nmdc:mga08y16_127245_c1_1151_1891 | 234 |
| 23 | 3300050512 | nmdc:mga0n895_112627_c1 | nmdc:mga0n895_112627_c1_374_1114 | 234 |
| 24 | 3300050513 | nmdc:mga0rr50_382725_c1 | nmdc:mga0rr50_382725_c1_201_941 | 234 |
| 25 | 3300050515 | nmdc:mga0a205_141741_c1 | nmdc:mga0a205_141741_c1_1490_2230 | 234 |
| 26 | 3300006163 | Ga0070715_10216608 | Ga0070715_102166081 | 236 |
| 27 | 3300006175 | Ga0070712_100275363 | Ga0070712_1002753632 | 236 |
| 28 | 3300025905 | Ga0207685_10131304 | Ga0207685_101313041 | 236 |
| 29 | 3300028800 | Ga0265338_10074974 | Ga0265338_100749743 | 236 |
| 30 | 3300031241 | Ga0265325_10113443 | Ga0265325_101134432 | 236 |
| 31 | 3300031249 | Ga0265339_10005488 | Ga0265339_100054885 | 236 |
| 32 | 3300031595 | Ga0265313_10000131 | Ga0265313_100001313 | 236 |
| 33 | 3300005435 | Ga0070714_100342940 | Ga0070714_1003429402 | 237 |
| 34 | 3300005937 | Ga0081455_10009321 | Ga0081455_1000932111 | 237 |
| 35 | 3300005937 | Ga0081455_10021388 | Ga0081455_100213882 | 237 |
| 36 | 3300006852 | Ga0075433_10210483 | Ga0075433_102104831 | 237 |
| 37 | 3300009094 | Ga0111539_10205363 | Ga0111539_102053632 | 237 |
| 38 | 3300021388 | Ga0213875_10212032 | Ga0213875_102120321 | 237 |
| 39 | 3300037853 | Ga0436364_0817427 | Ga0436364_0817427_69_824 | 237 |
| 40 | 3300045049 | Ga0466959_0068177 | Ga0466959_0068177_26_784 | 237 |
| 41 | 3300045836 | Ga0466958_0021589 | Ga0466958_0021589_2945_3703 | 237 |
| 42 | 3300049583 | Ga0501067_0172892 | Ga0501067_0172892_263_1027 | 237 |
| 43 | 3300050511 | nmdc:mga08y16_1039751_c1 | nmdc:mga08y16_1039751_c1_10_756 | 237 |
| 44 | 3300050515 | nmdc:mga0a205_120792_c1 | nmdc:mga0a205_120792_c1_972_1718 | 237 |
| 45 | 3300005435 | Ga0070714_100368100 | Ga0070714_1003681002 | 238 |
| 46 | 3300005437 | Ga0070710_10245401 | Ga0070710_102454012 | 238 |
| 47 | 3300005937 | Ga0081455_10006109 | Ga0081455_1000610914 | 238 |
| 48 | 3300006028 | Ga0070717_10355896 | Ga0070717_103558962 | 238 |
| 49 | 3300048909 | Ga0496106_0414611 | Ga0496106_0414611_22_762 | 238 |
| 50 | 3300006844 | Ga0075428_100774821 | Ga0075428_1007748212 | 239 |
| 51 | 3300006846 | Ga0075430_100026312 | Ga0075430_1000263126 | 239 |
| 52 | 3300024227 | Ga0228598_1039499 | Ga0228598_10394992 | 239 |
| 53 | 3300037312 | Ga0395899_0089324 | Ga0395899_0089324_965_1738 | 239 |
| 54 | 3300037471 | Ga0395905_0414824 | Ga0395905_0414824_267_1025 | 239 |
| 55 | 3300038443 | Ga0395901_0006908 | Ga0395901_0006908_1436_2209 | 239 |
| 56 | 3300048905 | Ga0496102_0536368 | Ga0496102_0536368_87_854 | 239 |
| 57 | 3300048909 | Ga0496106_0335967 | Ga0496106_0335967_122_889 | 239 |
| 58 | 3300050509 | nmdc:mga0qj67_97785_c1 | nmdc:mga0qj67_97785_c1_593_1336 | 239 |
| 59 | 3300050510 | nmdc:mga06r32_135902_c1 | nmdc:mga06r32_135902_c1_783_1526 | 239 |
| 60 | iso_pu_bacteria | 2840764183 | 2840765746 | 239 |
| 61 | 3300005366 | Ga0070659_100379906 | Ga0070659_1003799062 | 240 |
| 62 | 3300005467 | Ga0070706_100405438 | Ga0070706_1004054382 | 240 |
| 63 | 3300005564 | Ga0070664_100481794 | Ga0070664_1004817941 | 240 |
| 64 | 3300009093 | Ga0105240_10100746 | Ga0105240_101007462 | 240 |
| 65 | 3300013105 | Ga0157369_10022574 | Ga0157369_100225748 | 240 |
| 66 | 3300022467 | Ga0224712_10007228 | Ga0224712_100072283 | 240 |
| 67 | 3300025912 | Ga0207707_10041441 | Ga0207707_100414413 | 240 |
| 68 | 3300046476 | Ga0495662_0029090 | Ga0495662_0029090_1536_2291 | 240 |
| 69 | 3300047469 | Ga0495673_0019696 | Ga0495673_0019696_870_1634 | 240 |
| 70 | iso_pu_bacteria | 2513237094 | 2513637959 | 240 |
| 71 | iso_pu_bacteria | 2513237098 | 2513674521 | 240 |
| 72 | iso_pu_bacteria | 2844315083 | 2844318339 | 240 |
| 73 | iso_pu_bacteria | 2874620515 | 2874627849 | 240 |
| 74 | iso_pu_bacteria | 2903727486 | 2903729286 | 240 |
| 75 | iso_pu_bacteria | 2903768456 | 2903769397 | 240 |
| 76 | iso_pu_bacteria | 2904666416 | 2904672831 | 240 |
| 77 | iso_pu_bacteria | 2904690495 | 2904698037 | 240 |
| 78 | iso_pu_bacteria | 2906602504 | 2906609418 | 240 |
| 79 | iso_pu_bacteria | 2906626472 | 2906628717 | 240 |
| 80 | iso_pu_bacteria | 2922361189 | 2922367902 | 240 |
| 81 | iso_pu_bacteria | 2922393267 | 2922395590 | 240 |
| 82 | iso_pu_bacteria | 2932794094 | 2932796459 | 240 |
| 83 | iso_pu_bacteria | 2932801729 | 2932808920 | 240 |
| 84 | iso_pu_bacteria | 2935769743 | 2935774067 | 240 |
| 85 | iso_pu_bacteria | 2935777560 | 2935780589 | 240 |
| 86 | iso_pu_bacteria | 2935785616 | 2935789563 | 240 |
| 87 | iso_pu_bacteria | 2935793552 | 2935797340 | 240 |
| 88 | iso_pu_bacteria | 2935883170 | 2935886632 | 240 |
| 89 | iso_pu_bacteria | 2935959822 | 2935960500 | 240 |
| 90 | iso_pu_bacteria | 2941531003 | 2941534094 | 240 |
| 91 | iso_pu_bacteria | 3005594810 | 3005598431 | 240 |
| 92 | iso_pu_bacteria | 3005718088 | 3005721596 | 240 |
| 93 | iso_pu_bacteria | 643348564 | 643601060 | 240 |
| 94 | iso_pu_bacteria | 8016522445 | 8016530428 | 240 |
| 95 | iso_pu_bacteria | 8016530956 | 8016535699 | 240 |
| 96 | iso_pu_bacteria | 8016557553 | 8016561630 | 240 |
| 97 | iso_pu_bacteria | 8016566248 | 8016574035 | 240 |
| 98 | iso_pu_bacteria | 8016575299 | 8016578150 | 240 |
| 99 | iso_pu_bacteria | 8016583857 | 8016592815 | 240 |
| 100 | iso_pu_bacteria | 8016595262 | 8016599468 | 240 |
| 101 | iso_pu_bacteria | 8016603502 | 8016611521 | 240 |
| 102 | iso_pu_bacteria | 8019530166 | 8019535423 | 240 |
| 103 | iso_pu_bacteria | 8019538911 | 8019544080 | 240 |
| 104 | iso_pu_bacteria | 8019648815 | 8019657468 | 240 |
| 105 | iso_pu_bacteria | 8056967851 | 8056972698 | 240 |
| 106 | 3300005445 | Ga0070708_100331226 | Ga0070708_1003312262 | 241 |
| 107 | 3300006847 | Ga0075431_100411366 | Ga0075431_1004113661 | 241 |
| 108 | 3300007788 | Ga0099795_10069163 | Ga0099795_100691632 | 241 |
| 109 | 3300009147 | Ga0114129_10339316 | Ga0114129_103393162 | 241 |
| 110 | 3300010375 | Ga0105239_10518452 | Ga0105239_105184522 | 241 |
| 111 | 3300025931 | Ga0207644_10109090 | Ga0207644_101090902 | 241 |
| 112 | 3300037312 | Ga0395899_0119669 | Ga0395899_0119669_167_916 | 241 |
| 113 | 3300037418 | Ga0395900_0237034 | Ga0395900_0237034_963_1736 | 241 |
| 114 | 3300037466 | Ga0395898_0060757 | Ga0395898_0060757_1805_2566 | 241 |
| 115 | 3300037466 | Ga0395898_0158887 | Ga0395898_0158887_996_1745 | 241 |
| 116 | 3300037471 | Ga0395905_0006632 | Ga0395905_0006632_6706_7455 | 241 |
| 117 | 3300037471 | Ga0395905_0045589 | Ga0395905_0045589_1282_2031 | 241 |
| 118 | 3300038443 | Ga0395901_0067661 | Ga0395901_0067661_1822_2571 | 241 |
| 119 | 3300038443 | Ga0395901_0658513 | Ga0395901_0658513_87_848 | 241 |
| 120 | 3300048904 | Ga0496101_0226083 | Ga0496101_0226083_65_814 | 241 |
| 121 | 3300048913 | Ga0496110_0218051 | Ga0496110_0218051_337_1098 | 241 |
| 122 | 3300048915 | Ga0496112_0069562 | Ga0496112_0069562_1999_2748 | 241 |
| 123 | 3300048916 | Ga0496113_0115003 | Ga0496113_0115003_1049_1798 | 241 |
| 124 | 3300050507 | nmdc:mga05p37_247082_c1 | nmdc:mga05p37_247082_c1_266_1027 | 241 |
| 125 | iso_pu_bacteria | 2508501128 | 2509147380 | 241 |
| 126 | iso_pu_bacteria | 2513237092 | 2513628244 | 241 |
| 127 | iso_pu_bacteria | 2513237095 | 2513646606 | 241 |
| 128 | iso_pu_bacteria | 2513237096 | 2513655211 | 241 |
| 129 | iso_pu_bacteria | 2513237137 | 2513861462 | 241 |
| 130 | iso_pu_bacteria | 2513237139 | 2513876418 | 241 |
| 131 | iso_pu_bacteria | 2513237145 | 2513915765 | 241 |
| 132 | iso_pu_bacteria | 2513237161 | 2514010755 | 241 |
| 133 | iso_pu_bacteria | 2517093001 | 2517102050 | 241 |
| 134 | iso_pu_bacteria | 2517572143 | 2517894928 | 241 |
| 135 | iso_pu_bacteria | 2524023205 | 2524436511 | 241 |
| 136 | iso_pu_bacteria | 2524023210 | 2524463758 | 241 |
| 137 | iso_pu_bacteria | 2524023228 | 2524534699 | 241 |
| 138 | iso_pu_bacteria | 2528768022 | 2528851518 | 241 |
| 139 | iso_pu_bacteria | 2602042107 | 2603857893 | 241 |
| 140 | iso_pu_bacteria | 2617270735 | 2617352269 | 241 |
| 141 | iso_pu_bacteria | 2617270741 | 2617376514 | 241 |
| 142 | iso_pu_bacteria | 2667528175 | 2671123038 | 241 |
| 143 | iso_pu_bacteria | 2728368998 | 2728748812 | 241 |
| 144 | iso_pu_bacteria | 2738543024 | 2739308937 | 241 |
| 145 | iso_pu_bacteria | 2744054633 | 2745077115 | 241 |
| 146 | iso_pu_bacteria | 2791355197 | 2793072023 | 241 |
| 147 | iso_pu_bacteria | 2791355199 | 2793079728 | 241 |
| 148 | iso_pu_bacteria | 2802429603 | 2805919698 | 241 |
| 149 | iso_pu_bacteria | 2816332527 | 2818240201 | 241 |
| 150 | iso_pu_bacteria | 2824600985 | 2824604235 | 241 |
| 151 | iso_pu_bacteria | 2824609381 | 2824617465 | 241 |
| 152 | iso_pu_bacteria | 2824653114 | 2824660058 | 241 |
| 153 | iso_pu_bacteria | 2824661429 | 2824666626 | 241 |
| 154 | iso_pu_bacteria | 2824671348 | 2824677018 | 241 |
| 155 | iso_pu_bacteria | 2824679649 | 2824686349 | 241 |
| 156 | iso_pu_bacteria | 2824687955 | 2824694924 | 241 |
| 157 | iso_pu_bacteria | 2824696289 | 2824702887 | 241 |
| 158 | iso_pu_bacteria | 2824704595 | 2824712180 | 241 |
| 159 | iso_pu_bacteria | 2824732956 | 2824739540 | 241 |
| 160 | iso_pu_bacteria | 2824746037 | 2824753522 | 241 |
| 161 | iso_pu_bacteria | 2824753945 | 2824760173 | 241 |
| 162 | iso_pu_bacteria | 2824763712 | 2824767162 | 241 |
| 163 | iso_pu_bacteria | 2824773399 | 2824780628 | 241 |
| 164 | iso_pu_bacteria | 2838122688 | 2838126589 | 241 |
| 165 | iso_pu_bacteria | 2841941048 | 2841947242 | 241 |
| 166 | iso_pu_bacteria | 2841949485 | 2841950687 | 241 |
| 167 | iso_pu_bacteria | 2841957949 | 2841964377 | 241 |
| 168 | iso_pu_bacteria | 2841966195 | 2841967004 | 241 |
| 169 | iso_pu_bacteria | 2841974524 | 2841975748 | 241 |
| 170 | iso_pu_bacteria | 2841983080 | 2841990116 | 241 |
| 171 | iso_pu_bacteria | 2847930680 | 2847935217 | 241 |
| 172 | iso_pu_bacteria | 2847939898 | 2847945821 | 241 |
| 173 | iso_pu_bacteria | 2857524615 | 2857527266 | 241 |
| 174 | iso_pu_bacteria | 2874612657 | 2874612804 | 241 |
| 175 | iso_pu_bacteria | 2874628541 | 2874636300 | 241 |
| 176 | iso_pu_bacteria | 2876761206 | 2876770782 | 241 |
| 177 | iso_pu_bacteria | 2876808645 | 2876813224 | 241 |
| 178 | iso_pu_bacteria | 2879083081 | 2879089121 | 241 |
| 179 | iso_pu_bacteria | 2879099564 | 2879102917 | 241 |
| 180 | iso_pu_bacteria | 2879110137 | 2879110383 | 241 |
| 181 | iso_pu_bacteria | 2881364244 | 2881366660 | 241 |
| 182 | iso_pu_bacteria | 2881665667 | 2881669584 | 241 |
| 183 | iso_pu_bacteria | 2885374607 | 2885375354 | 241 |
| 184 | iso_pu_bacteria | 2885409591 | 2885412736 | 241 |
| 185 | iso_pu_bacteria | 2888378607 | 2888383278 | 241 |
| 186 | iso_pu_bacteria | 2888419890 | 2888423658 | 241 |
| 187 | iso_pu_bacteria | 2889033259 | 2889040807 | 241 |
| 188 | iso_pu_bacteria | 2903748898 | 2903756539 | 241 |
| 189 | iso_pu_bacteria | 2904699407 | 2904700161 | 241 |
| 190 | iso_pu_bacteria | 2904711408 | 2904717121 | 241 |
| 191 | iso_pu_bacteria | 2906610324 | 2906611663 | 241 |
| 192 | iso_pu_bacteria | 2906635258 | 2906639642 | 241 |
| 193 | iso_pu_bacteria | 2906643746 | 2906645919 | 241 |
| 194 | iso_pu_bacteria | 2906660503 | 2906660615 | 241 |
| 195 | iso_pu_bacteria | 2908739725 | 2908745249 | 241 |
| 196 | iso_pu_bacteria | 2908756301 | 2908763075 | 241 |
| 197 | iso_pu_bacteria | 2908775508 | 2908779381 | 241 |
| 198 | iso_pu_bacteria | 2919073203 | 2919078383 | 241 |
| 199 | iso_pu_bacteria | 2922368715 | 2922373440 | 241 |
| 200 | iso_pu_bacteria | 2922386360 | 2922392209 | 241 |
| 201 | iso_pu_bacteria | 2922425934 | 2922427683 | 241 |
| 202 | iso_pu_bacteria | 2929615660 | 2929617187 | 241 |
| 203 | iso_pu_bacteria | 2929624759 | 2929626891 | 241 |
| 204 | iso_pu_bacteria | 2932784394 | 2932793211 | 241 |
| 205 | iso_pu_bacteria | 2932809354 | 2932813050 | 241 |
| 206 | iso_pu_bacteria | 2932818245 | 2932821099 | 241 |
| 207 | iso_pu_bacteria | 2932828146 | 2932836793 | 241 |
| 208 | iso_pu_bacteria | 2933577622 | 2933579144 | 241 |
| 209 | iso_pu_bacteria | 2935616580 | 2935621558 | 241 |
| 210 | iso_pu_bacteria | 2935630451 | 2935632366 | 241 |
| 211 | iso_pu_bacteria | 2935638405 | 2935645491 | 241 |
| 212 | iso_pu_bacteria | 2935665750 | 2935667609 | 241 |
| 213 | iso_pu_bacteria | 2935675223 | 2935681771 | 241 |
| 214 | iso_pu_bacteria | 2935684952 | 2935688357 | 241 |
| 215 | iso_pu_bacteria | 2935694250 | 2935699040 | 241 |
| 216 | iso_pu_bacteria | 2935703347 | 2935706421 | 241 |
| 217 | iso_pu_bacteria | 2935713505 | 2935715376 | 241 |
| 218 | iso_pu_bacteria | 2935722832 | 2935726060 | 241 |
| 219 | iso_pu_bacteria | 2935732158 | 2935734195 | 241 |
| 220 | iso_pu_bacteria | 2935741537 | 2935743574 | 241 |
| 221 | iso_pu_bacteria | 2935750917 | 2935754389 | 241 |
| 222 | iso_pu_bacteria | 2935760218 | 2935768495 | 241 |
| 223 | iso_pu_bacteria | 2935801545 | 2935806584 | 241 |
| 224 | iso_pu_bacteria | 2935810662 | 2935813176 | 241 |
| 225 | iso_pu_bacteria | 2935827899 | 2935830829 | 241 |
| 226 | iso_pu_bacteria | 2935837841 | 2935840855 | 241 |
| 227 | iso_pu_bacteria | 2935855204 | 2935859805 | 241 |
| 228 | iso_pu_bacteria | 2935864058 | 2935869122 | 241 |
| 229 | iso_pu_bacteria | 2935873716 | 2935880685 | 241 |
| 230 | iso_pu_bacteria | 2935992306 | 2936000961 | 241 |
| 231 | iso_pu_bacteria | 2936002035 | 2936010175 | 241 |
| 232 | iso_pu_bacteria | 2936037263 | 2936043728 | 241 |
| 233 | iso_pu_bacteria | 2940556831 | 2940560235 | 241 |
| 234 | iso_pu_bacteria | 2941507105 | 2941508313 | 241 |
| 235 | iso_pu_bacteria | 2941515067 | 2941515181 | 241 |
| 236 | iso_pu_bacteria | 2941523033 | 2941524244 | 241 |
| 237 | iso_pu_bacteria | 2941538514 | 2941541014 | 241 |
| 238 | iso_pu_bacteria | 3005474847 | 3005477398 | 241 |
| 239 | iso_pu_bacteria | 3005483717 | 3005489424 | 241 |
| 240 | iso_pu_bacteria | 3005587118 | 3005588562 | 241 |
| 241 | iso_pu_bacteria | 8006933436 | 8006933837 | 241 |
| 242 | iso_pu_bacteria | 8006973647 | 8006983509 | 241 |
| 243 | iso_pu_bacteria | 8006984368 | 8006990525 | 241 |
| 244 | iso_pu_bacteria | 8016511872 | 8016514238 | 241 |
| 245 | iso_pu_bacteria | 8017057580 | 8017062186 | 241 |
| 246 | iso_pu_bacteria | 8019555841 | 8019559767 | 241 |
| 247 | iso_pu_bacteria | 8019565922 | 8019569876 | 241 |
| 248 | iso_pu_bacteria | 8019576017 | 8019581636 | 241 |
| 249 | iso_pu_bacteria | 8019586578 | 8019589269 | 241 |
| 250 | iso_pu_bacteria | 8019597564 | 8019601962 | 241 |
| 251 | iso_pu_bacteria | 8019608314 | 8019616588 | 241 |
| 252 | iso_pu_bacteria | 8055742211 | 8055747198 | 241 |
| 253 | iso_pu_bacteria | 8056673599 | 8056680653 | 241 |
| 254 | iso_pu_bacteria | 8056681323 | 8056685649 | 241 |
| 255 | iso_pu_bacteria | 8056689827 | 8056695323 | 241 |
| 256 | 3300005347 | Ga0070668_100091258 | Ga0070668_1000912583 | 242 |
| 257 | 3300005468 | Ga0070707_100213467 | Ga0070707_1002134673 | 242 |
| 258 | 3300005518 | Ga0070699_100088571 | Ga0070699_1000885713 | 242 |
| 259 | 3300005548 | Ga0070665_100157518 | Ga0070665_1001575182 | 242 |
| 260 | 3300005577 | Ga0068857_100026472 | Ga0068857_1000264723 | 242 |
| 261 | 3300005578 | Ga0068854_100117861 | Ga0068854_1001178613 | 242 |
| 262 | 3300005985 | Ga0081539_10009085 | Ga0081539_100090852 | 242 |
| 263 | 3300006028 | Ga0070717_10076324 | Ga0070717_100763244 | 242 |
| 264 | 3300006844 | Ga0075428_100111593 | Ga0075428_1001115932 | 242 |
| 265 | 3300009093 | Ga0105240_11126833 | Ga0105240_111268331 | 242 |
| 266 | 3300013105 | Ga0157369_10247236 | Ga0157369_102472362 | 242 |
| 267 | 3300025907 | Ga0207645_10105252 | Ga0207645_101052522 | 242 |
| 268 | 3300025923 | Ga0207681_10560419 | Ga0207681_105604191 | 242 |
| 269 | 3300025925 | Ga0207650_10405622 | Ga0207650_104056222 | 242 |
| 270 | 3300025937 | Ga0207669_10205587 | Ga0207669_102055872 | 242 |
| 271 | 3300026116 | Ga0207674_10034187 | Ga0207674_100341872 | 242 |
| 272 | 3300038742 | Ga0400486_22289 | Ga0400486_22289_1315_2067 | 242 |
| 273 | 3300039110 | Ga0400487_25960 | Ga0400487_25960_10_762 | 242 |
| 274 | 3300047447 | Ga0495685_045710 | Ga0495685_045710_514_1278 | 242 |
| 275 | 3300047470 | Ga0495681_0115801 | Ga0495681_0115801_89_853 | 242 |
| 276 | 3300049576 | Ga0501040_0094175 | Ga0501040_0094175_1140_1907 | 242 |
| 277 | 3300049590 | Ga0501074_0226463 | Ga0501074_0226463_81_848 | 242 |
| 278 | 3300049592 | Ga0501076_0536684 | Ga0501076_0536684_178_945 | 242 |
| 279 | 3300049663 | Ga0501223_000017 | Ga0501223_000017_20085_20846 | 242 |
| 280 | 3300049705 | Ga0501225_0000004 | Ga0501225_0000004_28044_28805 | 242 |
| 281 | 3300054114 | Ga0501084_0106019 | Ga0501084_0106019_423_1190 | 242 |
| 282 | 3300005339 | Ga0070660_100026898 | Ga0070660_1000268984 | 243 |
| 283 | 3300005458 | Ga0070681_10332899 | Ga0070681_103328993 | 243 |
| 284 | 3300005530 | Ga0070679_100061096 | Ga0070679_1000610966 | 243 |
| 285 | 3300005937 | Ga0081455_10001280 | Ga0081455_1000128015 | 243 |
| 286 | 3300006028 | Ga0070717_10045837 | Ga0070717_100458374 | 243 |
| 287 | 3300013104 | Ga0157370_10062738 | Ga0157370_100627382 | 243 |
| 288 | 3300021384 | Ga0213876_10187571 | Ga0213876_101875712 | 243 |
| 289 | 3300025919 | Ga0207657_10038674 | Ga0207657_100386744 | 243 |
| 290 | 3300025921 | Ga0207652_10561702 | Ga0207652_105617021 | 243 |
| 291 | 3300035119 | Ga0373956_0073741 | Ga0373956_0073741_254_1009 | 243 |
| 292 | 3300035171 | Ga0373946_0146888 | Ga0373946_0146888_68_823 | 243 |
| 293 | 3300035695 | Ga0373927_0051140 | Ga0373927_0051140_353_1108 | 243 |
| 294 | 3300035725 | Ga0373947_0064742 | Ga0373947_0064742_1028_1783 | 243 |
| 295 | 3300036401 | Ga0373937_0502307 | Ga0373937_0502307_205_960 | 243 |
| 296 | 3300037068 | Ga0373925_0183120 | Ga0373925_0183120_534_1289 | 243 |
| 297 | 3300039437 | Ga0436365_0275343 | Ga0436365_0275343_2548_3303 | 243 |
| 298 | 3300039438 | Ga0436360_1279071 | Ga0436360_1279071_810_1574 | 243 |
| 299 | 3300046454 | Ga0495592_0089342 | Ga0495592_0089342_1408_2163 | 243 |
| 300 | 3300046459 | Ga0495629_0139925 | Ga0495629_0139925_321_1076 | 243 |
| 301 | 3300046462 | Ga0495651_0070783 | Ga0495651_0070783_226_981 | 243 |
| 302 | 3300046463 | Ga0495653_0045571 | Ga0495653_0045571_1070_1825 | 243 |
| 303 | 3300046473 | Ga0495582_0038974 | Ga0495582_0038974_1479_2234 | 243 |
| 304 | 3300046499 | Ga0495594_0155476 | Ga0495594_0155476_474_1229 | 243 |
| 305 | 3300046514 | Ga0495618_0060818 | Ga0495618_0060818_1619_2374 | 243 |
| 306 | 3300046516 | Ga0495628_0270418 | Ga0495628_0270418_390_1145 | 243 |
| 307 | 3300046529 | Ga0495652_0082365 | Ga0495652_0082365_1827_2582 | 243 |
| 308 | 3300046533 | Ga0495640_0067610 | Ga0495640_0067610_1276_2031 | 243 |
| 309 | 3300046536 | Ga0495587_0040791 | Ga0495587_0040791_88_843 | 243 |
| 310 | 3300046559 | Ga0495667_0217629 | Ga0495667_0217629_194_949 | 243 |
| 311 | 3300046680 | Ga0495646_0149104 | Ga0495646_0149104_343_1098 | 243 |
| 312 | 3300046683 | Ga0495658_0245788 | Ga0495658_0245788_306_1061 | 243 |
| 313 | 3300046689 | Ga0495613_0121305 | Ga0495613_0121305_71_826 | 243 |
| 314 | 3300046690 | Ga0495624_0208383 | Ga0495624_0208383_159_914 | 243 |
| 315 | 3300047317 | Ga0495604_0124365 | Ga0495604_0124365_320_1075 | 243 |
| 316 | 3300047319 | Ga0495674_0066194 | Ga0495674_0066194_2072_2827 | 243 |
| 317 | 3300047321 | Ga0495676_0383016 | Ga0495676_0383016_98_853 | 243 |
| 318 | 3300047322 | Ga0495680_0095227 | Ga0495680_0095227_1168_1923 | 243 |
| 319 | 3300047673 | Ga0495593_0043449 | Ga0495593_0043449_1104_1859 | 243 |
| 320 | 3300048088 | Ga0495602_0088196 | Ga0495602_0088196_284_1039 | 243 |
| 321 | 3300048915 | Ga0496112_0018656 | Ga0496112_0018656_2873_3628 | 243 |
| 322 | 3300053077 | Ga0495601_0116559 | Ga0495601_0116559_564_1319 | 243 |
| 323 | 3300053078 | Ga0495612_0012385 | Ga0495612_0012385_2312_3067 | 243 |
| 324 | 3300053084 | Ga0495595_0025381 | Ga0495595_0025381_1496_2251 | 243 |
| 325 | 3300053085 | Ga0495619_0018387 | Ga0495619_0018387_228_983 | 243 |
| 326 | 3300005327 | Ga0070658_10015872 | Ga0070658_100158722 | 244 |
| 327 | 3300005366 | Ga0070659_100144582 | Ga0070659_1001445822 | 244 |
| 328 | 3300005455 | Ga0070663_100005493 | Ga0070663_1000054931 | 244 |
| 329 | 3300005536 | Ga0070697_100480900 | Ga0070697_1004809002 | 244 |
| 330 | 3300005618 | Ga0068864_100242978 | Ga0068864_1002429782 | 244 |
| 331 | 3300005985 | Ga0081539_10079199 | Ga0081539_100791991 | 244 |
| 332 | 3300021358 | Ga0213873_10040091 | Ga0213873_100400912 | 244 |
| 333 | 3300021384 | Ga0213876_10002788 | Ga0213876_100027881 | 244 |
| 334 | 3300021384 | Ga0213876_10004257 | Ga0213876_100042578 | 244 |
| 335 | 3300021388 | Ga0213875_10090328 | Ga0213875_100903282 | 244 |
| 336 | 3300025909 | Ga0207705_10117987 | Ga0207705_101179873 | 244 |
| 337 | 3300035695 | Ga0373927_0229552 | Ga0373927_0229552_310_1071 | 244 |
| 338 | 3300037853 | Ga0436364_0329188 | Ga0436364_0329188_8420_9184 | 244 |
| 339 | 3300039437 | Ga0436365_0190362 | Ga0436365_0190362_15725_16489 | 244 |
| 340 | 3300039437 | Ga0436365_0260170 | Ga0436365_0260170_19296_20060 | 244 |
| 341 | 3300039450 | Ga0436363_0809548 | Ga0436363_0809548_2453_3217 | 244 |
| 342 | 3300039453 | Ga0436362_0204855 | Ga0436362_0204855_8822_9586 | 244 |
| 343 | 3300046455 | Ga0495603_0082720 | Ga0495603_0082720_732_1493 | 244 |
| 344 | 3300048912 | Ga0496109_0231384 | Ga0496109_0231384_75_833 | 244 |
| 345 | 3300048917 | Ga0496114_0066602 | Ga0496114_0066602_1581_2345 | 244 |
| 346 | 3300049586 | Ga0501070_0069624 | Ga0501070_0069624_195_956 | 244 |
| 347 | 3300049671 | Ga0501238_008161 | Ga0501238_008161_160_984 | 244 |
| 348 | 3300050512 | nmdc:mga0n895_59117_c1 | nmdc:mga0n895_59117_c1_1634_2395 | 244 |
| 349 | 3300050515 | nmdc:mga0a205_87149_c1 | nmdc:mga0a205_87149_c1_70_828 | 244 |
| 350 | iso_pu_bacteria | 2513237351 | 2514588027 | 244 |
| 351 | 3300002077 | JGI24744J21845_10008185 | JGI24744J21845_100081852 | 245 |
| 352 | 3300003203 | JGI25406J46586_10000700 | JGI25406J46586_1000070014 | 245 |
| 353 | 3300005328 | Ga0070676_10188375 | Ga0070676_101883752 | 245 |
| 354 | 3300005331 | Ga0070670_100053420 | Ga0070670_1000534202 | 245 |
| 355 | 3300005334 | Ga0068869_100242150 | Ga0068869_1002421502 | 245 |
| 356 | 3300005336 | Ga0070680_100104495 | Ga0070680_1001044952 | 245 |
| 357 | 3300005337 | Ga0070682_100113635 | Ga0070682_1001136351 | 245 |
| 358 | 3300005339 | Ga0070660_100447876 | Ga0070660_1004478762 | 245 |
| 359 | 3300005347 | Ga0070668_100066136 | Ga0070668_1000661362 | 245 |
| 360 | 3300005353 | Ga0070669_100246002 | Ga0070669_1002460022 | 245 |
| 361 | 3300005354 | Ga0070675_100170274 | Ga0070675_1001702742 | 245 |
| 362 | 3300005356 | Ga0070674_100033619 | Ga0070674_1000336193 | 245 |
| 363 | 3300005439 | Ga0070711_100315846 | Ga0070711_1003158462 | 245 |
| 364 | 3300005441 | Ga0070700_100132162 | Ga0070700_1001321622 | 245 |
| 365 | 3300005445 | Ga0070708_100342723 | Ga0070708_1003427232 | 245 |
| 366 | 3300005455 | Ga0070663_100134995 | Ga0070663_1001349952 | 245 |
| 367 | 3300005456 | Ga0070678_100042215 | Ga0070678_1000422152 | 245 |
| 368 | 3300005456 | Ga0070678_100204750 | Ga0070678_1002047501 | 245 |
| 369 | 3300005457 | Ga0070662_100116580 | Ga0070662_1001165803 | 245 |
| 370 | 3300005457 | Ga0070662_100138831 | Ga0070662_1001388313 | 245 |
| 371 | 3300005459 | Ga0068867_100156792 | Ga0068867_1001567922 | 245 |
| 372 | 3300005459 | Ga0068867_100323153 | Ga0068867_1003231532 | 245 |
| 373 | 3300005466 | Ga0070685_10175952 | Ga0070685_101759522 | 245 |
| 374 | 3300005467 | Ga0070706_100582837 | Ga0070706_1005828371 | 245 |
| 375 | 3300005518 | Ga0070699_100453019 | Ga0070699_1004530192 | 245 |
| 376 | 3300005539 | Ga0068853_100210834 | Ga0068853_1002108342 | 245 |
| 377 | 3300005543 | Ga0070672_100136130 | Ga0070672_1001361302 | 245 |
| 378 | 3300005543 | Ga0070672_100645907 | Ga0070672_1006459072 | 245 |
| 379 | 3300005546 | Ga0070696_100176538 | Ga0070696_1001765381 | 245 |
| 380 | 3300005547 | Ga0070693_100040363 | Ga0070693_1000403632 | 245 |
| 381 | 3300005563 | Ga0068855_100115059 | Ga0068855_1001150592 | 245 |
| 382 | 3300005614 | Ga0068856_100148323 | Ga0068856_1001483233 | 245 |
| 383 | 3300005615 | Ga0070702_100097968 | Ga0070702_1000979683 | 245 |
| 384 | 3300005616 | Ga0068852_100737554 | Ga0068852_1007375541 | 245 |
| 385 | 3300005718 | Ga0068866_10296037 | Ga0068866_102960372 | 245 |
| 386 | 3300005719 | Ga0068861_100114761 | Ga0068861_1001147612 | 245 |
| 387 | 3300005719 | Ga0068861_100849576 | Ga0068861_1008495761 | 245 |
| 388 | 3300005840 | Ga0068870_10142706 | Ga0068870_101427062 | 245 |
| 389 | 3300005841 | Ga0068863_100081050 | Ga0068863_1000810503 | 245 |
| 390 | 3300005937 | Ga0081455_10005009 | Ga0081455_1000500910 | 245 |
| 391 | 3300005981 | Ga0081538_10006867 | Ga0081538_100068672 | 245 |
| 392 | 3300005981 | Ga0081538_10011456 | Ga0081538_100114568 | 245 |
| 393 | 3300005983 | Ga0081540_1002273 | Ga0081540_100227310 | 245 |
| 394 | 3300005983 | Ga0081540_1024602 | Ga0081540_10246023 | 245 |
| 395 | 3300005983 | Ga0081540_1034330 | Ga0081540_10343302 | 245 |
| 396 | 3300005985 | Ga0081539_10000726 | Ga0081539_1000072670 | 245 |
| 397 | 3300005985 | Ga0081539_10045148 | Ga0081539_100451481 | 245 |
| 398 | 3300006042 | Ga0075368_10021110 | Ga0075368_100211102 | 245 |
| 399 | 3300006042 | Ga0075368_10035880 | Ga0075368_100358802 | 245 |
| 400 | 3300006051 | Ga0075364_10051210 | Ga0075364_100512103 | 245 |
| 401 | 3300006173 | Ga0070716_100047588 | Ga0070716_1000475881 | 245 |
| 402 | 3300006186 | Ga0075369_10069968 | Ga0075369_100699683 | 245 |
| 403 | 3300006871 | Ga0075434_100165178 | Ga0075434_1001651782 | 245 |
| 404 | 3300006881 | Ga0068865_100149854 | Ga0068865_1001498542 | 245 |
| 405 | 3300007265 | Ga0099794_10076766 | Ga0099794_100767661 | 245 |
| 406 | 3300009092 | Ga0105250_10075635 | Ga0105250_100756352 | 245 |
| 407 | 3300009093 | Ga0105240_10466306 | Ga0105240_104663062 | 245 |
| 408 | 3300009094 | Ga0111539_10354998 | Ga0111539_103549982 | 245 |
| 409 | 3300009098 | Ga0105245_10039196 | Ga0105245_100391965 | 245 |
| 410 | 3300009098 | Ga0105245_10160101 | Ga0105245_101601012 | 245 |
| 411 | 3300009101 | Ga0105247_10025455 | Ga0105247_100254553 | 245 |
| 412 | 3300009147 | Ga0114129_10079273 | Ga0114129_100792732 | 245 |
| 413 | 3300009148 | Ga0105243_10376316 | Ga0105243_103763162 | 245 |
| 414 | 3300009174 | Ga0105241_10041599 | Ga0105241_100415992 | 245 |
| 415 | 3300009176 | Ga0105242_10328590 | Ga0105242_103285902 | 245 |
| 416 | 3300009177 | Ga0105248_10050893 | Ga0105248_100508934 | 245 |
| 417 | 3300009551 | Ga0105238_10034956 | Ga0105238_100349563 | 245 |
| 418 | 3300009553 | Ga0105249_10214559 | Ga0105249_102145592 | 245 |
| 419 | 3300010375 | Ga0105239_10142225 | Ga0105239_101422252 | 245 |
| 420 | 3300010375 | Ga0105239_10341529 | Ga0105239_103415293 | 245 |
| 421 | 3300011119 | Ga0105246_10069752 | Ga0105246_100697522 | 245 |
| 422 | 3300013296 | Ga0157374_10200656 | Ga0157374_102006563 | 245 |
| 423 | 3300013306 | Ga0163162_10096698 | Ga0163162_100966982 | 245 |
| 424 | 3300013306 | Ga0163162_10401571 | Ga0163162_104015711 | 245 |
| 425 | 3300013306 | Ga0163162_10585663 | Ga0163162_105856631 | 245 |
| 426 | 3300013308 | Ga0157375_10087997 | Ga0157375_100879973 | 245 |
| 427 | 3300014326 | Ga0157380_10068265 | Ga0157380_100682652 | 245 |
| 428 | 3300014969 | Ga0157376_10095030 | Ga0157376_100950302 | 245 |
| 429 | 3300017792 | Ga0163161_10146394 | Ga0163161_101463942 | 245 |
| 430 | 3300025899 | Ga0207642_10046969 | Ga0207642_100469692 | 245 |
| 431 | 3300025899 | Ga0207642_10063153 | Ga0207642_100631532 | 245 |
| 432 | 3300025900 | Ga0207710_10016666 | Ga0207710_100166662 | 245 |
| 433 | 3300025907 | Ga0207645_10097199 | Ga0207645_100971992 | 245 |
| 434 | 3300025913 | Ga0207695_10667258 | Ga0207695_106672581 | 245 |
| 435 | 3300025921 | Ga0207652_10606977 | Ga0207652_106069771 | 245 |
| 436 | 3300025924 | Ga0207694_10033748 | Ga0207694_100337483 | 245 |
| 437 | 3300025926 | Ga0207659_10093113 | Ga0207659_100931132 | 245 |
| 438 | 3300025927 | Ga0207687_10037457 | Ga0207687_100374572 | 245 |
| 439 | 3300025927 | Ga0207687_10055615 | Ga0207687_100556152 | 245 |
| 440 | 3300025932 | Ga0207690_10347421 | Ga0207690_103474212 | 245 |
| 441 | 3300025933 | Ga0207706_10124568 | Ga0207706_101245682 | 245 |
| 442 | 3300025933 | Ga0207706_10131987 | Ga0207706_101319873 | 245 |
| 443 | 3300025934 | Ga0207686_10033881 | Ga0207686_100338812 | 245 |
| 444 | 3300025935 | Ga0207709_10055777 | Ga0207709_100557775 | 245 |
| 445 | 3300025936 | Ga0207670_10213155 | Ga0207670_102131552 | 245 |
| 446 | 3300025937 | Ga0207669_10096029 | Ga0207669_100960293 | 245 |
| 447 | 3300025940 | Ga0207691_10085044 | Ga0207691_100850443 | 245 |
| 448 | 3300025941 | Ga0207711_10019309 | Ga0207711_100193097 | 245 |
| 449 | 3300025942 | Ga0207689_10110996 | Ga0207689_101109962 | 245 |
| 450 | 3300025949 | Ga0207667_10691756 | Ga0207667_106917562 | 245 |
| 451 | 3300025960 | Ga0207651_10050713 | Ga0207651_100507132 | 245 |
| 452 | 3300025972 | Ga0207668_10044494 | Ga0207668_100444942 | 245 |
| 453 | 3300025986 | Ga0207658_10121741 | Ga0207658_101217412 | 245 |
| 454 | 3300026067 | Ga0207678_10054273 | Ga0207678_100542733 | 245 |
| 455 | 3300026067 | Ga0207678_10231130 | Ga0207678_102311302 | 245 |
| 456 | 3300026075 | Ga0207708_10055030 | Ga0207708_100550302 | 245 |
| 457 | 3300026089 | Ga0207648_10049071 | Ga0207648_100490713 | 245 |
| 458 | 3300026089 | Ga0207648_10241638 | Ga0207648_102416382 | 245 |
| 459 | 3300026089 | Ga0207648_10521231 | Ga0207648_105212311 | 245 |
| 460 | 3300026095 | Ga0207676_10007871 | Ga0207676_100078717 | 245 |
| 461 | 3300026116 | Ga0207674_10049920 | Ga0207674_100499202 | 245 |
| 462 | 3300026118 | Ga0207675_100104366 | Ga0207675_1001043662 | 245 |
| 463 | 3300026118 | Ga0207675_100253913 | Ga0207675_1002539131 | 245 |
| 464 | 3300026121 | Ga0207683_10029574 | Ga0207683_100295743 | 245 |
| 465 | 3300026121 | Ga0207683_10072136 | Ga0207683_100721362 | 245 |
| 466 | 3300028379 | Ga0268266_10045599 | Ga0268266_100455993 | 245 |
| 467 | 3300028380 | Ga0268265_10011432 | Ga0268265_100114323 | 245 |
| 468 | 3300028380 | Ga0268265_10266262 | Ga0268265_102662622 | 245 |
| 469 | 3300028380 | Ga0268265_10683839 | Ga0268265_106838392 | 245 |
| 470 | 3300030763 | Ga0265763_1005432 | Ga0265763_10054321 | 245 |
| 471 | 3300031507 | Ga0307509_10162799 | Ga0307509_101627992 | 245 |
| 472 | 3300031548 | Ga0307408_100230427 | Ga0307408_1002304272 | 245 |
| 473 | 3300032002 | Ga0307416_100056299 | Ga0307416_1000562993 | 245 |
| 474 | 3300033180 | Ga0307510_10007185 | Ga0307510_100071852 | 245 |
| 475 | 3300035171 | Ga0373946_0151036 | Ga0373946_0151036_247_1011 | 245 |
| 476 | 3300037471 | Ga0395905_0162212 | Ga0395905_0162212_1231_1995 | 245 |
| 477 | 3300039450 | Ga0436363_1207525 | Ga0436363_1207525_11_772 | 245 |
| 478 | 3300039450 | Ga0436363_1583481 | Ga0436363_1583481_19_780 | 245 |
| 479 | 3300044658 | Ga0466972_0004633 | Ga0466972_0004633_2003_2764 | 245 |
| 480 | 3300044706 | Ga0466964_0045186 | Ga0466964_0045186_308_1069 | 245 |
| 481 | 3300044735 | Ga0466968_0000249 | Ga0466968_0000249_5409_6170 | 245 |
| 482 | 3300044901 | Ga0466960_0005567 | Ga0466960_0005567_1945_2706 | 245 |
| 483 | 3300046452 | Ga0495617_031525 | Ga0495617_031525_676_1440 | 245 |
| 484 | 3300046455 | Ga0495603_0015346 | Ga0495603_0015346_2754_3518 | 245 |
| 485 | 3300046460 | Ga0495638_0090618 | Ga0495638_0090618_680_1444 | 245 |
| 486 | 3300046474 | Ga0495605_0026193 | Ga0495605_0026193_893_1657 | 245 |
| 487 | 3300046475 | Ga0495639_0007249 | Ga0495639_0007249_3556_4320 | 245 |
| 488 | 3300046492 | Ga0495585_0053855 | Ga0495585_0053855_67_831 | 245 |
| 489 | 3300046499 | Ga0495594_0018386 | Ga0495594_0018386_1174_1938 | 245 |
| 490 | 3300046513 | Ga0495616_0088471 | Ga0495616_0088471_50_814 | 245 |
| 491 | 3300046513 | Ga0495616_0104350 | Ga0495616_0104350_29_793 | 245 |
| 492 | 3300046519 | Ga0495632_0050219 | Ga0495632_0050219_1157_1921 | 245 |
| 493 | 3300046523 | Ga0495644_0028601 | Ga0495644_0028601_852_1616 | 245 |
| 494 | 3300046525 | Ga0495663_0012675 | Ga0495663_0012675_214_978 | 245 |
| 495 | 3300046525 | Ga0495663_0017939 | Ga0495663_0017939_169_933 | 245 |
| 496 | 3300046537 | Ga0495598_0003339 | Ga0495598_0003339_453_1217 | 245 |
| 497 | 3300046538 | Ga0495609_0061763 | Ga0495609_0061763_761_1525 | 245 |
| 498 | 3300046539 | Ga0495621_0009097 | Ga0495621_0009097_1415_2179 | 245 |
| 499 | 3300046542 | Ga0495597_0032596 | Ga0495597_0032596_1474_2238 | 245 |
| 500 | 3300046558 | Ga0495633_0015543 | Ga0495633_0015543_1250_2014 | 245 |
| 501 | 3300046558 | Ga0495633_0018591 | Ga0495633_0018591_1818_2582 | 245 |
| 502 | 3300046664 | Ga0495659_0012707 | Ga0495659_0012707_1416_2180 | 245 |
| 503 | 3300046664 | Ga0495659_0029639 | Ga0495659_0029639_765_1529 | 245 |
| 504 | 3300046674 | Ga0495588_0005748 | Ga0495588_0005748_2120_2884 | 245 |
| 505 | 3300046684 | Ga0495669_0206654 | Ga0495669_0206654_99_863 | 245 |
| 506 | 3300046691 | Ga0495670_0071256 | Ga0495670_0071256_643_1407 | 245 |
| 507 | 3300046691 | Ga0495670_0085672 | Ga0495670_0085672_629_1393 | 245 |
| 508 | 3300046692 | Ga0495671_0069501 | Ga0495671_0069501_646_1410 | 245 |
| 509 | 3300048906 | Ga0496103_0125360 | Ga0496103_0125360_695_1459 | 245 |
| 510 | 3300048906 | Ga0496103_0354842 | Ga0496103_0354842_116_880 | 245 |
| 511 | 3300048913 | Ga0496110_0069131 | Ga0496110_0069131_1836_2600 | 245 |
| 512 | 3300048915 | Ga0496112_0105612 | Ga0496112_0105612_187_951 | 245 |
| 513 | 3300048917 | Ga0496114_0225236 | Ga0496114_0225236_474_1238 | 245 |
| 514 | 3300048924 | Ga0496121_0105369 | Ga0496121_0105369_1336_2100 | 245 |
| 515 | 3300048924 | Ga0496121_0158281 | Ga0496121_0158281_108_872 | 245 |
| 516 | 3300048928 | Ga0496125_0277370 | Ga0496125_0277370_107_871 | 245 |
| 517 | 3300048929 | Ga0496126_0335736 | Ga0496126_0335736_287_1051 | 245 |
| 518 | 3300049581 | Ga0501047_0055051 | Ga0501047_0055051_214_978 | 245 |
| 519 | 3300049822 | Ga0501035_0079116 | Ga0501035_0079116_1971_2735 | 245 |
| 520 | 3300050492 | nmdc:mga0yw44_30952_c1 | nmdc:mga0yw44_30952_c1_153_917 | 245 |
| 521 | 3300050509 | nmdc:mga0qj67_274908_c1 | nmdc:mga0qj67_274908_c1_447_1211 | 245 |
| 522 | 3300050514 | nmdc:mga08x19_215382_c1 | nmdc:mga08x19_215382_c1_38_799 | 245 |
| 523 | 3300050514 | nmdc:mga08x19_376017_c1 | nmdc:mga08x19_376017_c1_61_825 | 245 |
| 524 | 3300050514 | nmdc:mga08x19_84541_c1 | nmdc:mga08x19_84541_c1_1298_2044 | 245 |
| 525 | 3300050515 | nmdc:mga0a205_100988_c1 | nmdc:mga0a205_100988_c1_471_1235 | 245 |
| 526 | 3300053116 | Ga0500592_013992 | Ga0500592_013992_362_1126 | 245 |
| 527 | 3300053119 | Ga0500595_002626 | Ga0500595_002626_1807_2571 | 245 |
| 528 | 3300053148 | Ga0500590_019375 | Ga0500590_019375_2553_3317 | 245 |
| 529 | 3300053153 | Ga0500616_0006401 | Ga0500616_0006401_3064_3828 | 245 |
| 530 | 3300053730 | Ga0500645_011715 | Ga0500645_011715_693_1457 | 245 |
| 531 | iso_pu_bacteria | 2508501050 | 2508733972 | 245 |
| 532 | iso_pu_bacteria | 2889790730 | 2889794434 | 245 |
| 533 | iso_pu_bacteria | 2889914905 | 2889914945 | 245 |
| 534 | 3300005435 | Ga0070714_100352874 | Ga0070714_1003528742 | 246 |
| 535 | 3300005436 | Ga0070713_100071323 | Ga0070713_1000713233 | 246 |
| 536 | 3300005437 | Ga0070710_10144539 | Ga0070710_101445391 | 246 |
| 537 | 3300005458 | Ga0070681_10111785 | Ga0070681_101117852 | 246 |
| 538 | 3300005536 | Ga0070697_100090264 | Ga0070697_1000902642 | 246 |
| 539 | 3300005546 | Ga0070696_100273903 | Ga0070696_1002739031 | 246 |
| 540 | 3300005547 | Ga0070693_100276388 | Ga0070693_1002763882 | 246 |
| 541 | 3300005614 | Ga0068856_100150136 | Ga0068856_1001501363 | 246 |
| 542 | 3300005616 | Ga0068852_100002547 | Ga0068852_10000254716 | 246 |
| 543 | 3300005937 | Ga0081455_10023945 | Ga0081455_100239452 | 246 |
| 544 | 3300005937 | Ga0081455_10039797 | Ga0081455_100397972 | 246 |
| 545 | 3300005937 | Ga0081455_10054744 | Ga0081455_100547441 | 246 |
| 546 | 3300005983 | Ga0081540_1008687 | Ga0081540_10086878 | 246 |
| 547 | 3300006028 | Ga0070717_10015837 | Ga0070717_100158377 | 246 |
| 548 | 3300006058 | Ga0075432_10075381 | Ga0075432_100753811 | 246 |
| 549 | 3300006163 | Ga0070715_10005685 | Ga0070715_100056852 | 246 |
| 550 | 3300006194 | Ga0075427_10015903 | Ga0075427_100159031 | 246 |
| 551 | 3300006846 | Ga0075430_100020556 | Ga0075430_1000205563 | 246 |
| 552 | 3300006852 | Ga0075433_10390914 | Ga0075433_103909142 | 246 |
| 553 | 3300006871 | Ga0075434_100064983 | Ga0075434_1000649834 | 246 |
| 554 | 3300006871 | Ga0075434_100266547 | Ga0075434_1002665471 | 246 |
| 555 | 3300006880 | Ga0075429_100372927 | Ga0075429_1003729271 | 246 |
| 556 | 3300007076 | Ga0075435_100558670 | Ga0075435_1005586702 | 246 |
| 557 | 3300007265 | Ga0099794_10016238 | Ga0099794_100162383 | 246 |
| 558 | 3300009094 | Ga0111539_10026889 | Ga0111539_100268895 | 246 |
| 559 | 3300009147 | Ga0114129_10557592 | Ga0114129_105575922 | 246 |
| 560 | 3300009553 | Ga0105249_10080019 | Ga0105249_100800192 | 246 |
| 561 | 3300010375 | Ga0105239_10837993 | Ga0105239_108379932 | 246 |
| 562 | 3300025294 | Ga0209025_1001512 | Ga0209025_100151216 | 246 |
| 563 | 3300025297 | Ga0209758_1009660 | Ga0209758_10096603 | 246 |
| 564 | 3300025885 | Ga0207653_10008693 | Ga0207653_100086933 | 246 |
| 565 | 3300025906 | Ga0207699_10007096 | Ga0207699_100070964 | 246 |
| 566 | 3300025910 | Ga0207684_10192680 | Ga0207684_101926802 | 246 |
| 567 | 3300025912 | Ga0207707_10106512 | Ga0207707_101065122 | 246 |
| 568 | 3300025915 | Ga0207693_10027049 | Ga0207693_100270493 | 246 |
| 569 | 3300025915 | Ga0207693_10232883 | Ga0207693_102328831 | 246 |
| 570 | 3300025916 | Ga0207663_10103814 | Ga0207663_101038142 | 246 |
| 571 | 3300025928 | Ga0207700_10041513 | Ga0207700_100415134 | 246 |
| 572 | 3300025929 | Ga0207664_10648637 | Ga0207664_106486371 | 246 |
| 573 | 3300025939 | Ga0207665_10020165 | Ga0207665_100201654 | 246 |
| 574 | 3300026078 | Ga0207702_10067383 | Ga0207702_100673832 | 246 |
| 575 | 3300027907 | Ga0207428_10010236 | Ga0207428_100102365 | 246 |
| 576 | 3300035170 | Ga0373943_0066594 | Ga0373943_0066594_441_1214 | 246 |
| 577 | 3300037068 | Ga0373925_0197210 | Ga0373925_0197210_350_1123 | 246 |
| 578 | 3300039447 | Ga0436361_0424425 | Ga0436361_0424425_12891_13655 | 246 |
| 579 | 3300048903 | Ga0496100_0017551 | Ga0496100_0017551_763_1527 | 246 |
| 580 | 3300048905 | Ga0496102_0705165 | Ga0496102_0705165_150_917 | 246 |
| 581 | 3300048906 | Ga0496103_0344169 | Ga0496103_0344169_73_837 | 246 |
| 582 | 3300048909 | Ga0496106_0316307 | Ga0496106_0316307_359_1126 | 246 |
| 583 | 3300048910 | Ga0496107_0409947 | Ga0496107_0409947_225_992 | 246 |
| 584 | 3300048913 | Ga0496110_0301931 | Ga0496110_0301931_113_877 | 246 |
| 585 | 3300048913 | Ga0496110_0840833 | Ga0496110_0840833_32_799 | 246 |
| 586 | 3300048915 | Ga0496112_0276153 | Ga0496112_0276153_209_976 | 246 |
| 587 | 3300050507 | nmdc:mga05p37_19478_c1 | nmdc:mga05p37_19478_c1_1820_2584 | 246 |
| 588 | 3300050507 | nmdc:mga05p37_391108_c1 | nmdc:mga05p37_391108_c1_539_1303 | 246 |
| 589 | 3300050507 | nmdc:mga05p37_85770_c1 | nmdc:mga05p37_85770_c1_2114_2878 | 246 |
| 590 | 3300050508 | nmdc:mga09592_8478_c1 | nmdc:mga09592_8478_c1_4599_5363 | 246 |
| 591 | 3300050509 | nmdc:mga0qj67_116748_c1 | nmdc:mga0qj67_116748_c1_465_1229 | 246 |
| 592 | 3300050509 | nmdc:mga0qj67_63050_c1 | nmdc:mga0qj67_63050_c1_1361_2125 | 246 |
| 593 | 3300050510 | nmdc:mga06r32_110797_c1 | nmdc:mga06r32_110797_c1_1816_2580 | 246 |
| 594 | 3300050511 | nmdc:mga08y16_14183_c1 | nmdc:mga08y16_14183_c1_4593_5357 | 246 |
| 595 | 3300050512 | nmdc:mga0n895_230407_c1 | nmdc:mga0n895_230407_c1_252_1016 | 246 |
| 596 | 3300050512 | nmdc:mga0n895_5196_c1 | nmdc:mga0n895_5196_c1_4569_5333 | 246 |
| 597 | 3300050513 | nmdc:mga0rr50_168696_c1 | nmdc:mga0rr50_168696_c1_83_847 | 246 |
| 598 | 3300050513 | nmdc:mga0rr50_437155_c1 | nmdc:mga0rr50_437155_c1_192_956 | 246 |
| 599 | 3300050516 | nmdc:mga0sz30_65455_c1 | nmdc:mga0sz30_65455_c1_603_1367 | 246 |
| 600 | iso_pu_bacteria | 2773857925 | 2774868893 | 246 |
| 601 | iso_pu_bacteria | 2835312727 | 2835315279 | 246 |
| 602 | iso_pu_bacteria | 2882456835 | 2882458125 | 246 |
| 603 | 3300036647 | Ga0316582_0183176 | Ga0316582_0183176_293_1063 | 247 |
| 604 | 3300049571 | Ga0501034_0109550 | Ga0501034_0109550_422_1192 | 247 |
| 605 | 3300050509 | nmdc:mga0qj67_170393_c1 | nmdc:mga0qj67_170393_c1_577_1347 | 247 |
| 606 | iso_pu_bacteria | 2937843397 | 2937844304 | 247 |
| 607 | 3300021441 | Ga0213871_10007597 | Ga0213871_100075972 | 248 |
| 608 | 3300037471 | Ga0395905_0074713 | Ga0395905_0074713_398_1234 | 248 |
| 609 | 3300039438 | Ga0436360_0693057 | Ga0436360_0693057_1666_2445 | 248 |
| 610 | 3300039447 | Ga0436361_1149293 | Ga0436361_1149293_1781_2560 | 248 |
| 611 | 3300039453 | Ga0436362_0584849 | Ga0436362_0584849_1889_2668 | 248 |
| 612 | 3300046518 | Ga0495631_0036628 | Ga0495631_0036628_1216_1989 | 248 |
| 613 | 3300049568 | Ga0501031_0027978 | Ga0501031_0027978_115_906 | 248 |
| 614 | 3300049572 | Ga0501036_0030453 | Ga0501036_0030453_3247_4038 | 248 |
| 615 | 3300049578 | Ga0501042_0115887 | Ga0501042_0115887_1034_1825 | 248 |
| 616 | 3300049580 | Ga0501046_0070768 | Ga0501046_0070768_1371_2162 | 248 |
| 617 | 3300049742 | Ga0501080_0342317 | Ga0501080_0342317_31_822 | 248 |
| 618 | 3300049743 | Ga0501081_0109533 | Ga0501081_0109533_895_1686 | 248 |
| 619 | 3300005434 | Ga0070709_10224267 | Ga0070709_102242672 | 249 |
| 620 | 3300005436 | Ga0070713_100115785 | Ga0070713_1001157853 | 249 |
| 621 | 3300005439 | Ga0070711_100018137 | Ga0070711_1000181373 | 249 |
| 622 | 3300009551 | Ga0105238_10556681 | Ga0105238_105566811 | 249 |
| 623 | 3300014325 | Ga0163163_10499371 | Ga0163163_104993712 | 249 |
| 624 | 3300028379 | Ga0268266_10035315 | Ga0268266_100353152 | 249 |
| 625 | 3300035111 | Ga0373923_0011341 | Ga0373923_0011341_24_803 | 249 |
| 626 | 3300035118 | Ga0373954_0008901 | Ga0373954_0008901_2200_2979 | 249 |
| 627 | 3300035119 | Ga0373956_0003850 | Ga0373956_0003850_3335_4114 | 249 |
| 628 | 3300035120 | Ga0373957_0039020 | Ga0373957_0039020_685_1464 | 249 |
| 629 | 3300035410 | Ga0373924_0007927 | Ga0373924_0007927_360_1139 | 249 |
| 630 | 3300035692 | Ga0373935_0060235 | Ga0373935_0060235_1169_1948 | 249 |
| 631 | 3300035695 | Ga0373927_0036463 | Ga0373927_0036463_1191_1970 | 249 |
| 632 | 3300037068 | Ga0373925_0101705 | Ga0373925_0101705_665_1444 | 249 |
| 633 | 3300038443 | Ga0395901_0043447 | Ga0395901_0043447_445_1230 | 249 |
| 634 | 3300046454 | Ga0495592_0025015 | Ga0495592_0025015_2328_3107 | 249 |
| 635 | 3300046459 | Ga0495629_0383454 | Ga0495629_0383454_145_924 | 249 |
| 636 | 3300046462 | Ga0495651_0211293 | Ga0495651_0211293_382_1161 | 249 |
| 637 | 3300046476 | Ga0495662_0058245 | Ga0495662_0058245_409_1188 | 249 |
| 638 | 3300046477 | Ga0495664_0003009 | Ga0495664_0003009_3371_4150 | 249 |
| 639 | 3300046511 | Ga0495608_0014617 | Ga0495608_0014617_3164_3943 | 249 |
| 640 | 3300046516 | Ga0495628_0038018 | Ga0495628_0038018_2262_3041 | 249 |
| 641 | 3300046533 | Ga0495640_0101687 | Ga0495640_0101687_769_1548 | 249 |
| 642 | 3300046536 | Ga0495587_0010482 | Ga0495587_0010482_4190_4969 | 249 |
| 643 | 3300046559 | Ga0495667_0019300 | Ga0495667_0019300_2055_2834 | 249 |
| 644 | 3300046675 | Ga0495657_0055781 | Ga0495657_0055781_1141_1920 | 249 |
| 645 | 3300046678 | Ga0495599_0058233 | Ga0495599_0058233_1152_1931 | 249 |
| 646 | 3300046680 | Ga0495646_0018676 | Ga0495646_0018676_911_1690 | 249 |
| 647 | 3300046809 | Ga0495600_0074802 | Ga0495600_0074802_137_916 | 249 |
| 648 | 3300047317 | Ga0495604_0038094 | Ga0495604_0038094_449_1228 | 249 |
| 649 | 3300047319 | Ga0495674_0046602 | Ga0495674_0046602_1933_2712 | 249 |
| 650 | 3300047322 | Ga0495680_0111549 | Ga0495680_0111549_716_1495 | 249 |
| 651 | 3300047444 | Ga0495675_0010585 | Ga0495675_0010585_3163_3942 | 249 |
| 652 | 3300048088 | Ga0495602_0000790 | Ga0495602_0000790_23853_24632 | 249 |
| 653 | 3300053077 | Ga0495601_0003666 | Ga0495601_0003666_7334_8113 | 249 |
| 654 | 3300053078 | Ga0495612_0002987 | Ga0495612_0002987_1187_1966 | 249 |
| 655 | 3300053085 | Ga0495619_0022453 | Ga0495619_0022453_1980_2759 | 249 |
| 656 | 3300025901 | Ga0207688_10036235 | Ga0207688_100362351 | 250 |
| 657 | 3300025935 | Ga0207709_10103794 | Ga0207709_101037942 | 250 |
| 658 | 3300025972 | Ga0207668_10204720 | Ga0207668_102047202 | 250 |
| 659 | 3300031852 | Ga0307410_10053728 | Ga0307410_100537282 | 250 |
| 660 | 3300031911 | Ga0307412_10186646 | Ga0307412_101866461 | 250 |
| 661 | 3300032002 | Ga0307416_100038721 | Ga0307416_1000387214 | 250 |
| 662 | 3300032004 | Ga0307414_10127418 | Ga0307414_101274182 | 250 |
| 663 | 3300032005 | Ga0307411_10024645 | Ga0307411_100246451 | 250 |
| 664 | 3300032126 | Ga0307415_100098440 | Ga0307415_1000984401 | 250 |
| 665 | 3300048905 | Ga0496102_0000315 | Ga0496102_0000315_14687_15469 | 251 |
| 666 | 3300048906 | Ga0496103_0000993 | Ga0496103_0000993_4626_5408 | 251 |
| 667 | 3300048919 | Ga0496116_0008674 | Ga0496116_0008674_3168_3950 | 251 |
| 668 | 3300048920 | Ga0496117_0000484 | Ga0496117_0000484_50152_50934 | 251 |
| 669 | 3300048921 | Ga0496118_0000486 | Ga0496118_0000486_14748_15530 | 251 |
| 670 | 3300037471 | Ga0395905_0594625 | Ga0395905_0594625_40_831 | 254 |
| 671 | 3300005842 | Ga0068858_100005442 | Ga0068858_10000544212 | 255 |
| 672 | 3300026035 | Ga0207703_10053258 | Ga0207703_100532583 | 255 |
| 673 | 3300028381 | Ga0268264_10166108 | Ga0268264_101661082 | 255 |
| 674 | 3300001979 | JGI24740J21852_10003072 | JGI24740J21852_100030725 | 259 |
| 675 | 3300005366 | Ga0070659_100213127 | Ga0070659_1002131271 | 259 |
| 676 | 3300005563 | Ga0068855_100156405 | Ga0068855_1001564051 | 259 |
| 677 | 3300025932 | Ga0207690_10441147 | Ga0207690_104411471 | 259 |
| 678 | 3300025949 | Ga0207667_10098162 | Ga0207667_100981622 | 259 |
| 679 | 3300026116 | Ga0207674_10002930 | Ga0207674_100029303 | 259 |
| 680 | 3300026142 | Ga0207698_10122647 | Ga0207698_101226473 | 259 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8gn9-assembly1.cif.gz_A-2 | spfh domain of pyrococcus horikoshii stomatin | 0.9401 | 63 | 168 |
| 8gn9-assembly1.cif.gz_A-2 | spfh domain of pyrococcus horikoshii stomatin | 0.9316 | 63 | 168 |
| 4fvj-assembly2.cif.gz_B | spfh domain of the mouse stomatin (crystal form 2) | 0.9104 | 59 | 169 |
| 2rpb-assembly1.cif.gz_A | the solution structure of membrane protein | 0.8949 | 61 | 169 |
| 4fvj-assembly2.cif.gz_B | spfh domain of the mouse stomatin (crystal form 2) | 0.8799 | 59 | 169 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_F1R5A4_90_200_3.30.479.30 | Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;Band 7 domain | 0.9567 | 65 | 169 | 3.30.479.30 |
| af_Q8T4B6_101_212_3.30.479.30 | Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;Band 7 domain | 0.956 | 65 | 168 | 3.30.479.30 |
| af_A0A1D8PTU3_111_221_3.30.479.30 | Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;Band 7 domain | 0.9271 | 61 | 169 | 3.30.479.30 |
| af_Q9VGD7_116_226_3.30.479.30 | Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;Band 7 domain | 0.9262 | 61 | 168 | 3.30.479.30 |
| af_F1Q9K0_120_233_3.30.479.30 | Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;Band 7 domain | 0.9214 | 61 | 163 | 3.30.479.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3M1FY76-F1-model_v4 | Slipin family protein | 0.9422 | 65 | 173 |
GO:0005886
|
| AF-A0A7Z9S0L7-F1-model_v4 | Slipin family protein | 0.9388 | 65 | 175 |
GO:0005886
|
| AF-A0A0N4T7I1-F1-model_v4 | PHB domain-containing protein | 0.9385 | 64 | 178 |
GO:0005886
|
| AF-A0A1E7IXH0-F1-model_v4 | Band 7 domain-containing protein | 0.937 | 65 | 184 |
GO:0005886
|
| AF-G2DGS6-F1-model_v4 | Protein QmcA | 0.9354 | 66 | 176 |
GO:0006508
GO:0008233 GO:0016020 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar