F474779

General Info

Members Datasets Scaffolds Average Seq Length
680 484 504 252

Family's Representative Sequence

Representative Sequence 3300025901|Ga0207688_10036235|Ga0207688_100362351
Length 280
Sequence MIFDYVAYLVLALLIVGFLVSAIRVLREYERGIVFTLGRFTGVKGPGLIILIPFVQQMVRVDLRVIVQDVPPQDVISRDNVSVKVNAVIYFRIVDPERAIIKVENYMAATSQLAQTTLRSVLGKHELDEMLAERDRLNADIQQILDQQTDAWGIKVANVEIKHIDLNENMIRAIAKQAEAERLRRAKVINAEGEQQAAEKLVEAGRLLAAEPQAMQLRYFAALHDIASERSSTIIFPLPTDLLAHLGGASERQTVAAVGASDQQDRGQEPGVPSLGAKRA

Samples

Sample ID Description Type Environment
1 2508501050 Microvirga lupini Lut6 Isolate Nodule
2 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
3 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
4 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
5 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
6 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
7 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
8 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
9 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
10 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
11 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
12 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
13 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
14 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
15 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
16 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
17 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
18 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
19 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
20 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
21 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
22 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
23 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
24 2738543024 Aminobacter sp. AP02 Isolate Unclassified
25 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
26 2773857925 Microvirga vignae BR3299 Isolate Unclassified
27 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
28 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
29 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
30 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
31 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
32 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
33 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
34 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
35 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
36 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
37 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
38 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
39 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
40 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
41 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
42 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
43 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
44 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
45 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
46 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
47 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
48 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
49 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
50 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
51 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
52 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
53 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
54 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
55 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
56 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
57 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
58 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
59 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
60 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
61 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
62 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
63 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
64 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
65 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
66 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
67 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
68 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
69 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
70 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
71 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
72 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
73 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
74 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
75 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
76 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
77 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
78 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
79 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
80 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
81 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
82 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
83 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
84 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
85 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
86 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
87 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
88 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
89 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
90 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
91 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
92 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
93 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
94 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
95 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
96 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
97 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
98 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
99 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
100 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
101 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
102 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
103 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
104 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
105 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
106 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
107 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
108 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
109 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
110 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
111 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
112 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
113 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
114 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
115 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
116 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
117 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
118 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
119 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
120 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
121 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
122 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
123 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
124 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
125 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
126 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
127 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
128 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
129 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
130 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
131 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
132 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
133 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
134 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
135 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
136 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
137 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
138 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
139 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
140 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
141 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
142 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
143 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
144 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
145 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
146 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
147 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
148 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
149 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
150 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
151 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
152 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
153 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
154 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
155 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
156 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
157 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
158 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
159 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
160 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
161 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
162 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
163 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
164 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
165 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
166 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
167 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
168 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
169 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
170 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
171 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
172 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
173 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
174 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
175 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
176 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
177 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
178 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
179 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
180 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
181 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
182 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
183 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
184 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
185 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
186 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
187 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
188 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
189 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
190 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
191 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
192 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
193 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
194 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
195 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
196 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
197 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
198 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
199 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
200 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
201 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
202 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
203 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
204 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
205 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
206 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
207 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
208 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
209 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
210 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
211 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
212 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
213 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
214 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
215 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
216 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
217 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
218 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
219 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
220 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
221 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
222 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
223 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
224 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
225 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
226 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
227 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
228 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
229 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
230 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
231 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
232 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
233 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
234 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
235 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
236 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
237 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
238 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
239 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
240 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
241 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
242 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
243 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
244 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
245 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
246 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
247 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
248 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
249 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
250 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
288 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
291 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
292 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
293 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
294 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
295 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
297 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
298 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
300 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
301 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
302 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
303 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
304 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
305 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
306 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
307 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
308 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
309 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
310 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
311 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
312 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
313 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
314 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
315 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
316 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
317 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
318 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
319 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
320 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
321 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
322 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
323 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
324 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
325 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
326 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
327 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
328 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
329 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
330 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
331 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
332 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
333 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
334 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
335 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
336 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
337 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
338 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
339 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
340 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
341 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
342 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
343 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
344 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
345 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
346 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
347 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
348 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
349 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
350 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
351 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
352 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
353 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
354 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
355 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
356 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
357 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
358 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
359 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
360 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
361 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
362 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
363 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
364 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
365 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
366 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
367 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
368 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
369 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
370 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
371 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
372 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
373 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
374 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
375 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
376 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
377 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
378 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
379 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
380 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
381 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
382 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
383 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
384 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
385 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
386 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
387 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
388 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
389 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
390 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
391 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
392 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
393 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
394 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
395 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
396 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
397 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
398 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
399 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
400 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
401 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
402 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
403 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
404 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
405 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
406 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
407 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
408 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
409 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
410 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
411 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
412 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
413 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
414 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
415 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
416 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
417 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
418 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
419 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
420 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
421 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
422 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
423 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
424 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
425 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
426 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
427 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
428 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
429 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
430 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
431 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
432 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
433 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
434 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
435 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
436 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
437 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
438 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
439 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
440 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
441 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
442 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
443 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
444 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
445 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
446 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
447 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
448 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
449 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
450 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
451 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
452 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
453 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
454 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
455 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
456 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
457 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
458 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
459 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
460 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
461 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
462 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
463 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
464 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
465 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
466 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
467 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
468 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
469 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
470 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
471 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
472 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
473 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
474 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
475 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
476 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
477 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
478 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
479 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
480 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
481 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
482 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
483 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
484 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 74.37
Metatranscriptomes 0.3
Isolates 25.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.91
Nodule 17.21
Rhizoplane 4.41
Rhizosphere 65
Stem 0
Stem Tuber 0
Unclassified 11.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10003072 3300001979 Bacteria 7382
2 JGI24744J21845_10008185 3300002077 Bacteria 2159
3 JGI25406J46586_10000700 3300003203 Bacteria 15651
4 Ga0070658_10015872 3300005327 Bacteria 6022
5 Ga0070676_10188375 3300005328 Bacteria 1345
6 Ga0070670_100053420 3300005331 Bacteria 3470
7 Ga0068869_100242150 3300005334 Bacteria 1437
8 Ga0070680_100104495 3300005336 Bacteria 2354
9 Ga0070682_100113635 3300005337 Bacteria 1808
10 Ga0070660_100026898 3300005339 Bacteria 4287
11 Ga0070660_100447876 3300005339 Bacteria 1071
12 Ga0070668_100066136 3300005347 Bacteria 2804
13 Ga0070668_100091258 3300005347 Bacteria 2401
14 Ga0070669_100246002 3300005353 Bacteria 1422
15 Ga0070675_100170274 3300005354 Bacteria 1877
16 Ga0070674_100033619 3300005356 Bacteria 3415
17 Ga0070659_100144582 3300005366 Bacteria 1937
18 Ga0070659_100213127 3300005366 Bacteria 1592
19 Ga0070659_100379906 3300005366 Bacteria 1190
20 Ga0070709_10224267 3300005434 Bacteria 1342
21 Ga0070714_100342940 3300005435 Bacteria 1402
22 Ga0070714_100352874 3300005435 Bacteria 1382
23 Ga0070714_100368100 3300005435 Bacteria 1353
24 Ga0070713_100071323 3300005436 Bacteria 2935
25 Ga0070713_100115785 3300005436 Bacteria 2343
26 Ga0070710_10144539 3300005437 Bacteria 1461
27 Ga0070710_10245401 3300005437 Bacteria 1149
28 Ga0070711_100018137 3300005439 Bacteria 4489
29 Ga0070711_100315846 3300005439 Bacteria 1247
30 Ga0070700_100132162 3300005441 Bacteria 1686
31 Ga0070708_100331226 3300005445 Bacteria 1434
32 Ga0070708_100342723 3300005445 Bacteria 1408
33 Ga0070663_100005493 3300005455 Bacteria 7536
34 Ga0070663_100134995 3300005455 Bacteria 1878
35 Ga0070678_100042215 3300005456 Bacteria 3240
36 Ga0070678_100204750 3300005456 Bacteria 1631
37 Ga0070662_100116580 3300005457 Bacteria 2041
38 Ga0070662_100138831 3300005457 Bacteria 1881
39 Ga0070681_10111785 3300005458 Bacteria 2671
40 Ga0070681_10332899 3300005458 Bacteria 1428
41 Ga0068867_100156792 3300005459 Bacteria 1793
42 Ga0068867_100323153 3300005459 Bacteria 1279
43 Ga0070685_10175952 3300005466 Bacteria 1374
44 Ga0070706_100405438 3300005467 Bacteria 1269
45 Ga0070706_100582837 3300005467 Bacteria 1040
46 Ga0070707_100213467 3300005468 Bacteria 1881
47 Ga0070699_100088571 3300005518 Bacteria 2703
48 Ga0070699_100453019 3300005518 Bacteria 1163
49 Ga0070679_100061096 3300005530 Bacteria 3756
50 Ga0070697_100090264 3300005536 Bacteria 2532
51 Ga0070697_100480900 3300005536 Bacteria 1084
52 Ga0068853_100210834 3300005539 Bacteria 1770
53 Ga0070672_100136130 3300005543 Bacteria 2023
54 Ga0070672_100645907 3300005543 Bacteria 924
55 Ga0070696_100176538 3300005546 Bacteria 1583
56 Ga0070696_100273903 3300005546 Bacteria 1284
57 Ga0070693_100040363 3300005547 Bacteria 2620
58 Ga0070693_100276388 3300005547 Bacteria 1123
59 Ga0070665_100157518 3300005548 Bacteria 2273
60 Ga0068855_100115059 3300005563 Bacteria 3084
61 Ga0068855_100156405 3300005563 Bacteria 2589
62 Ga0070664_100481794 3300005564 Bacteria 1142
63 Ga0068857_100026472 3300005577 Bacteria 5113
64 Ga0068854_100117861 3300005578 Bacteria 2011
65 Ga0068856_100148323 3300005614 Bacteria 2353
66 Ga0068856_100150136 3300005614 Bacteria 2339
67 Ga0070702_100097968 3300005615 Bacteria 1793
68 Ga0068852_100002547 3300005616 Bacteria 12557
69 Ga0068852_100737554 3300005616 Bacteria 997
70 Ga0068864_100242978 3300005618 Bacteria 1668
71 Ga0068866_10296037 3300005718 Bacteria 1009
72 Ga0068861_100114761 3300005719 Bacteria 2163
73 Ga0068861_100849576 3300005719 Bacteria 860
74 Ga0068870_10142706 3300005840 Bacteria 1403
75 Ga0068863_100081050 3300005841 Bacteria 3074
76 Ga0068858_100005442 3300005842 Bacteria 12465
77 Ga0081455_10001280 3300005937 Bacteria 31292
78 Ga0081455_10005009 3300005937 Bacteria 14652
79 Ga0081455_10006109 3300005937 Bacteria 13011
80 Ga0081455_10009321 3300005937 Bacteria 10104
81 Ga0081455_10021388 3300005937 Bacteria 6068
82 Ga0081455_10023945 3300005937 Bacteria 5668
83 Ga0081455_10039797 3300005937 Bacteria 4151
84 Ga0081455_10054744 3300005937 Bacteria 3398
85 Ga0081538_10006867 3300005981 Bacteria 9911
86 Ga0081538_10011456 3300005981 Bacteria 7181
87 Ga0081540_1002273 3300005983 Bacteria 15792
88 Ga0081540_1008687 3300005983 Bacteria 7074
89 Ga0081540_1024602 3300005983 Bacteria 3491
90 Ga0081540_1034330 3300005983 Bacteria 2738
91 Ga0081539_10000726 3300005985 Bacteria 66051
92 Ga0081539_10009085 3300005985 Bacteria 8419
93 Ga0081539_10045148 3300005985 Bacteria 2537
94 Ga0081539_10079199 3300005985 Bacteria 1732
95 Ga0070717_10015837 3300006028 Bacteria 5830
96 Ga0070717_10045837 3300006028 Bacteria 3576
97 Ga0070717_10076324 3300006028 Bacteria 2804
98 Ga0070717_10355896 3300006028 Bacteria 1310
99 Ga0075368_10021110 3300006042 Bacteria 2471
100 Ga0075368_10035880 3300006042 Bacteria 1936
101 Ga0075364_10051210 3300006051 Bacteria 2696
102 Ga0075432_10075381 3300006058 Bacteria 1217
103 Ga0070715_10005685 3300006163 Bacteria 4181
104 Ga0070715_10216608 3300006163 Bacteria 982
105 Ga0070716_100047588 3300006173 Bacteria 2420
106 Ga0070712_100275363 3300006175 Bacteria 1354
107 Ga0075369_10069968 3300006186 Bacteria 1543
108 Ga0075427_10015903 3300006194 Bacteria 1165
109 Ga0075428_100111593 3300006844 Bacteria 2979
110 Ga0075428_100258470 3300006844 Bacteria 1875
111 Ga0075428_100774821 3300006844 Bacteria 1020
112 Ga0075430_100020556 3300006846 Bacteria 5615
113 Ga0075430_100026312 3300006846 Bacteria 4951
114 Ga0075430_100460557 3300006846 Bacteria 1049
115 Ga0075431_100138817 3300006847 Bacteria 2506
116 Ga0075431_100411366 3300006847 Bacteria 1353
117 Ga0075433_10081818 3300006852 Bacteria 2847
118 Ga0075433_10210483 3300006852 Bacteria 1728
119 Ga0075433_10390914 3300006852 Bacteria 1227
120 Ga0075434_100064983 3300006871 Bacteria 3633
121 Ga0075434_100165178 3300006871 Bacteria 2233
122 Ga0075434_100266547 3300006871 Bacteria 1732
123 Ga0075434_100613705 3300006871 Bacteria 1107
124 Ga0075429_100372927 3300006880 Bacteria 1249
125 Ga0068865_100149854 3300006881 Bacteria 1769
126 Ga0075436_100048089 3300006914 Bacteria 2943
127 Ga0075435_100251182 3300007076 Bacteria 1505
128 Ga0075435_100558670 3300007076 Bacteria 992
129 Ga0099794_10016238 3300007265 Bacteria 3298
130 Ga0099794_10076766 3300007265 Bacteria 1643
131 Ga0099795_10069163 3300007788 Bacteria 1328
132 Ga0105250_10075635 3300009092 Bacteria 1362
133 Ga0105240_10100746 3300009093 Bacteria 3514
134 Ga0105240_10466306 3300009093 Bacteria 1410
135 Ga0105240_11126833 3300009093 Bacteria 834
136 Ga0111539_10026889 3300009094 Bacteria 7029
137 Ga0111539_10205363 3300009094 Bacteria 2296
138 Ga0111539_10354998 3300009094 Bacteria 1706
139 Ga0111539_10534941 3300009094 Bacteria 1365
140 Ga0111539_10998127 3300009094 Bacteria 973
141 Ga0105245_10039196 3300009098 Bacteria 4217
142 Ga0105245_10160101 3300009098 Bacteria 2135
143 Ga0105247_10025455 3300009101 Bacteria 3569
144 Ga0114129_10079273 3300009147 Bacteria 4567
145 Ga0114129_10339316 3300009147 Bacteria 1993
146 Ga0114129_10557592 3300009147 Bacteria 1489
147 Ga0105243_10376316 3300009148 Bacteria 1312
148 Ga0105241_10041599 3300009174 Bacteria 3473
149 Ga0105242_10328590 3300009176 Bacteria 1405
150 Ga0105248_10050893 3300009177 Bacteria 4648
151 Ga0105238_10034956 3300009551 Bacteria 5112
152 Ga0105238_10556681 3300009551 Bacteria 1151
153 Ga0105249_10080019 3300009553 Bacteria 3035
154 Ga0105249_10214559 3300009553 Bacteria 1891
155 Ga0105239_10142225 3300010375 Bacteria 2674
156 Ga0105239_10341529 3300010375 Bacteria 1690
157 Ga0105239_10518452 3300010375 Bacteria 1356
158 Ga0105239_10837993 3300010375 Bacteria 1054
159 Ga0105246_10069752 3300011119 Bacteria 2470
160 Ga0157370_10062738 3300013104 Bacteria 3523
161 Ga0157369_10022574 3300013105 Bacteria 7019
162 Ga0157369_10247236 3300013105 Bacteria 1862
163 Ga0157374_10200656 3300013296 Bacteria 1953
164 Ga0163162_10096698 3300013306 Bacteria 3041
165 Ga0163162_10401571 3300013306 Bacteria 1503
166 Ga0163162_10585663 3300013306 Bacteria 1242
167 Ga0157375_10087997 3300013308 Bacteria 3160
168 Ga0163163_10499371 3300014325 Bacteria 1278
169 Ga0157380_10068265 3300014326 Bacteria 2865
170 Ga0157376_10095030 3300014969 Bacteria 2591
171 Ga0163161_10146394 3300017792 Bacteria 1792
172 Ga0213873_10040091 3300021358 Bacteria 1202
173 Ga0213876_10002788 3300021384 Bacteria 10179
174 Ga0213876_10004257 3300021384 Bacteria 8025
175 Ga0213876_10187571 3300021384 Bacteria 1100
176 Ga0213875_10090328 3300021388 Bacteria 1428
177 Ga0213875_10212032 3300021388 Bacteria 912
178 Ga0213871_10007597 3300021441 Bacteria 2353
179 Ga0224712_10007228 3300022467 Bacteria 3221
180 Ga0228598_1039499 3300024227 Bacteria 931
181 Ga0209025_1001512 3300025294 Bacteria 29864
182 Ga0209758_1009660 3300025297 Bacteria 5943
183 Ga0207653_10008693 3300025885 Bacteria 3167
184 Ga0207642_10046969 3300025899 Bacteria 1927
185 Ga0207642_10063153 3300025899 Bacteria 1731
186 Ga0207710_10016666 3300025900 Bacteria 3110
187 Ga0207688_10036235 3300025901 Bacteria 2735
188 Ga0207685_10131304 3300025905 Bacteria 1112
189 Ga0207699_10007096 3300025906 Bacteria 5461
190 Ga0207645_10097199 3300025907 Bacteria 1898
191 Ga0207645_10105252 3300025907 Bacteria 1823
192 Ga0207705_10117987 3300025909 Bacteria 1966
193 Ga0207684_10192680 3300025910 Bacteria 1758
194 Ga0207707_10041441 3300025912 Bacteria 4021
195 Ga0207707_10106512 3300025912 Bacteria 2451
196 Ga0207695_10667258 3300025913 Bacteria 920
197 Ga0207693_10027049 3300025915 Bacteria 4537
198 Ga0207693_10232883 3300025915 Bacteria 1446
199 Ga0207663_10103814 3300025916 Bacteria 1915
200 Ga0207657_10038674 3300025919 Bacteria 4245
201 Ga0207652_10561702 3300025921 Bacteria 1025
202 Ga0207652_10606977 3300025921 Bacteria 981
203 Ga0207681_10560419 3300025923 Bacteria 941
204 Ga0207694_10033748 3300025924 Bacteria 3921
205 Ga0207650_10405622 3300025925 Bacteria 1129
206 Ga0207659_10093113 3300025926 Bacteria 2255
207 Ga0207687_10037457 3300025927 Bacteria 3309
208 Ga0207687_10055615 3300025927 Bacteria 2773
209 Ga0207700_10041513 3300025928 Bacteria 3366
210 Ga0207664_10648637 3300025929 Bacteria 949
211 Ga0207644_10109090 3300025931 Bacteria 2090
212 Ga0207690_10347421 3300025932 Bacteria 1172
213 Ga0207690_10441147 3300025932 Bacteria 1045
214 Ga0207706_10124568 3300025933 Bacteria 2267
215 Ga0207706_10131987 3300025933 Bacteria 2197
216 Ga0207686_10033881 3300025934 Bacteria 3051
217 Ga0207709_10055777 3300025935 Bacteria 2443
218 Ga0207709_10103794 3300025935 Bacteria 1885
219 Ga0207670_10213155 3300025936 Bacteria 1474
220 Ga0207669_10096029 3300025937 Bacteria 1944
221 Ga0207669_10205587 3300025937 Bacteria 1433
222 Ga0207665_10020165 3300025939 Bacteria 4380
223 Ga0207691_10085044 3300025940 Bacteria 2839
224 Ga0207711_10019309 3300025941 Bacteria 5676
225 Ga0207689_10110996 3300025942 Bacteria 2253
226 Ga0207667_10098162 3300025949 Bacteria 3023
227 Ga0207667_10691756 3300025949 Bacteria 1023
228 Ga0207651_10050713 3300025960 Bacteria 2820
229 Ga0207668_10044494 3300025972 Bacteria 3020
230 Ga0207668_10204720 3300025972 Bacteria 1574
231 Ga0207658_10121741 3300025986 Bacteria 2082
232 Ga0207703_10053258 3300026035 Bacteria 3288
233 Ga0207678_10054273 3300026067 Bacteria 3451
234 Ga0207678_10231130 3300026067 Bacteria 1583
235 Ga0207708_10055030 3300026075 Bacteria 3033
236 Ga0207702_10067383 3300026078 Bacteria 3072
237 Ga0207648_10049071 3300026089 Bacteria 3695
238 Ga0207648_10241638 3300026089 Bacteria 1608
239 Ga0207648_10521231 3300026089 Bacteria 1089
240 Ga0207676_10007871 3300026095 Bacteria 7579
241 Ga0207674_10002930 3300026116 Bacteria 21206
242 Ga0207674_10034187 3300026116 Bacteria 5318
243 Ga0207674_10049920 3300026116 Bacteria 4277
244 Ga0207675_100104366 3300026118 Bacteria 2671
245 Ga0207675_100253913 3300026118 Bacteria 1702
246 Ga0207683_10029574 3300026121 Bacteria 4743
247 Ga0207683_10072136 3300026121 Bacteria 3054
248 Ga0207698_10122647 3300026142 Bacteria 2203
249 Ga0207428_10010236 3300027907 Bacteria 8383
250 Ga0207428_10259419 3300027907 Bacteria 1295
251 Ga0268266_10035315 3300028379 Bacteria 4252
252 Ga0268266_10045599 3300028379 Bacteria 3750
253 Ga0268265_10011432 3300028380 Bacteria 6001
254 Ga0268265_10266262 3300028380 Bacteria 1526
255 Ga0268265_10683839 3300028380 Bacteria 989
256 Ga0268264_10166108 3300028381 Bacteria 1992
257 Ga0265338_10074974 3300028800 Bacteria 2873
258 Ga0265763_1005432 3300030763 Bacteria 1069
259 Ga0265325_10113443 3300031241 Bacteria 1314
260 Ga0265339_10005488 3300031249 Bacteria 8447
261 Ga0307509_10162799 3300031507 Bacteria 2125
262 Ga0307408_100230427 3300031548 Bacteria 1517
263 Ga0265313_10000131 3300031595 Bacteria 75926
264 Ga0307410_10053728 3300031852 Bacteria 2727
265 Ga0307412_10186646 3300031911 Bacteria 1564
266 Ga0307416_100038721 3300032002 Bacteria 3681
267 Ga0307416_100056299 3300032002 Bacteria 3173
268 Ga0307414_10127418 3300032004 Bacteria 1970
269 Ga0307411_10024645 3300032005 Bacteria 3590
270 Ga0307415_100098440 3300032126 Bacteria 2138
271 Ga0307510_10007185 3300033180 Bacteria 13262
272 Ga0373923_0011341 3300035111 Bacteria 3266
273 Ga0373954_0008901 3300035118 Bacteria 4417
274 Ga0373956_0003850 3300035119 Bacteria 6039
275 Ga0373956_0073741 3300035119 Bacteria 1560
276 Ga0373957_0039020 3300035120 Bacteria 1780
277 Ga0373943_0066594 3300035170 Bacteria 1814
278 Ga0373946_0146888 3300035171 Bacteria 1097
279 Ga0373946_0151036 3300035171 Bacteria 1084
280 Ga0373924_0007927 3300035410 Bacteria 3844
281 Ga0373935_0060235 3300035692 Bacteria 2428
282 Ga0373927_0036463 3300035695 Bacteria 3198
283 Ga0373927_0051140 3300035695 Bacteria 2672
284 Ga0373927_0229552 3300035695 Bacteria 1219
285 Ga0373947_0064742 3300035725 Bacteria 2229
286 Ga0373937_0502307 3300036401 Bacteria 1152
287 Ga0316582_0183176 3300036647 Bacteria 1425
288 Ga0373925_0101705 3300037068 Bacteria 2210
289 Ga0373925_0183120 3300037068 Bacteria 1659
290 Ga0373925_0197210 3300037068 Bacteria 1600
291 Ga0395899_0089324 3300037312 Bacteria 2235
292 Ga0395899_0119669 3300037312 Bacteria 1887
293 Ga0395900_0015669 3300037418 Bacteria 7728
294 Ga0395900_0237034 3300037418 Bacteria 1832
295 Ga0395898_0060757 3300037466 Bacteria 3672
296 Ga0395898_0158887 3300037466 Bacteria 2162
297 Ga0395905_0006632 3300037471 Bacteria 11604
298 Ga0395905_0045589 3300037471 Bacteria 4112
299 Ga0395905_0067708 3300037471 Bacteria 3344
300 Ga0395905_0074713 3300037471 Bacteria 3177
301 Ga0395905_0162212 3300037471 Bacteria 2101
302 Ga0395905_0414824 3300037471 Bacteria 1242
303 Ga0395905_0594625 3300037471 Bacteria 1008
304 Ga0436364_0329188 3300037853 Bacteria 16674
305 Ga0436364_0817427 3300037853 Bacteria 1033
306 Ga0395901_0006908 3300038443 Bacteria 11467
307 Ga0395901_0043447 3300038443 Bacteria 4662
308 Ga0395901_0067661 3300038443 Bacteria 3720
309 Ga0395901_0072012 3300038443 Bacteria 3602
310 Ga0395901_0658513 3300038443 Bacteria 1049
311 Ga0400486_22289 3300038742 Bacteria 3166
312 Ga0400487_25960 3300039110 Bacteria 3122
313 Ga0436365_0190362 3300039437 Bacteria 40496
314 Ga0436365_0260170 3300039437 Bacteria 52235
315 Ga0436365_0275343 3300039437 Bacteria 3434
316 Ga0436360_0693057 3300039438 Bacteria 5079
317 Ga0436360_1279071 3300039438 Bacteria 4959
318 Ga0436361_0424425 3300039447 Bacteria 14085
319 Ga0436361_1149293 3300039447 Bacteria 6067
320 Ga0436363_0809548 3300039450 Bacteria 8310
321 Ga0436363_1207525 3300039450 Bacteria 1128
322 Ga0436363_1583481 3300039450 Bacteria 855
323 Ga0436362_0204855 3300039453 Bacteria 17349
324 Ga0436362_0584849 3300039453 Bacteria 5582
325 Ga0466972_0004633 3300044658 Bacteria 6885
326 Ga0466964_0045186 3300044706 Bacteria 1792
327 Ga0466968_0000249 3300044735 Bacteria 17055
328 Ga0466960_0005567 3300044901 Bacteria 4994
329 Ga0466959_0068177 3300045049 Bacteria 2578
330 Ga0466958_0021589 3300045836 Bacteria 3765
331 Ga0495617_031525 3300046452 Bacteria 1780
332 Ga0495592_0025015 3300046454 Bacteria 4535
333 Ga0495592_0089342 3300046454 Bacteria 2213
334 Ga0495603_0015346 3300046455 Bacteria 4635
335 Ga0495603_0082720 3300046455 Bacteria 1880
336 Ga0495629_0139925 3300046459 Bacteria 1684
337 Ga0495629_0383454 3300046459 Bacteria 956
338 Ga0495638_0090618 3300046460 Bacteria 1843
339 Ga0495651_0070783 3300046462 Bacteria 2653
340 Ga0495651_0211293 3300046462 Bacteria 1350
341 Ga0495653_0045571 3300046463 Bacteria 3400
342 Ga0495582_0038974 3300046473 Bacteria 2616
343 Ga0495605_0026193 3300046474 Bacteria 3032
344 Ga0495639_0007249 3300046475 Bacteria 4761
345 Ga0495662_0029090 3300046476 Bacteria 2668
346 Ga0495662_0058245 3300046476 Bacteria 1866
347 Ga0495664_0003009 3300046477 Bacteria 9117
348 Ga0495585_0053855 3300046492 Bacteria 2226
349 Ga0495594_0018386 3300046499 Bacteria 3701
350 Ga0495594_0155476 3300046499 Bacteria 1299
351 Ga0495608_0014617 3300046511 Bacteria 5445
352 Ga0495616_0088471 3300046513 Bacteria 1470
353 Ga0495616_0104350 3300046513 Bacteria 1325
354 Ga0495618_0060818 3300046514 Bacteria 2395
355 Ga0495628_0038018 3300046516 Bacteria 3856
356 Ga0495628_0270418 3300046516 Bacteria 1264
357 Ga0495631_0036628 3300046518 Bacteria 2190
358 Ga0495632_0050219 3300046519 Bacteria 2058
359 Ga0495644_0028601 3300046523 Bacteria 2109
360 Ga0495663_0012675 3300046525 Bacteria 2351
361 Ga0495663_0017939 3300046525 Bacteria 2012
362 Ga0495652_0082365 3300046529 Bacteria 2652
363 Ga0495640_0067610 3300046533 Bacteria 2406
364 Ga0495640_0101687 3300046533 Bacteria 1886
365 Ga0495587_0010482 3300046536 Bacteria 5896
366 Ga0495587_0040791 3300046536 Bacteria 2772
367 Ga0495598_0003339 3300046537 Bacteria 3400
368 Ga0495609_0061763 3300046538 Bacteria 1655
369 Ga0495621_0009097 3300046539 Bacteria 3004
370 Ga0495597_0032596 3300046542 Bacteria 2364
371 Ga0495633_0015543 3300046558 Bacteria 3946
372 Ga0495633_0018591 3300046558 Bacteria 3527
373 Ga0495667_0019300 3300046559 Bacteria 4600
374 Ga0495667_0217629 3300046559 Bacteria 1219
375 Ga0495611_0041739 3300046648 Bacteria 2047
376 Ga0495659_0012707 3300046664 Bacteria 2732
377 Ga0495659_0029639 3300046664 Bacteria 1900
378 Ga0495588_0005748 3300046674 Bacteria 5538
379 Ga0495657_0055781 3300046675 Bacteria 2635
380 Ga0495599_0058233 3300046678 Bacteria 2417
381 Ga0495646_0018676 3300046680 Bacteria 4391
382 Ga0495646_0149104 3300046680 Bacteria 1302
383 Ga0495658_0245788 3300046683 Bacteria 1124
384 Ga0495669_0206654 3300046684 Bacteria 939
385 Ga0495613_0121305 3300046689 Bacteria 1877
386 Ga0495624_0208383 3300046690 Bacteria 1186
387 Ga0495670_0071256 3300046691 Bacteria 1759
388 Ga0495670_0085672 3300046691 Bacteria 1608
389 Ga0495671_0069501 3300046692 Bacteria 1731
390 Ga0495600_0074802 3300046809 Bacteria 2212
391 Ga0495604_0038094 3300047317 Bacteria 3783
392 Ga0495604_0124365 3300047317 Bacteria 1862
393 Ga0495674_0046602 3300047319 Bacteria 3847
394 Ga0495674_0066194 3300047319 Bacteria 3136
395 Ga0495676_0383016 3300047321 Bacteria 935
396 Ga0495680_0095227 3300047322 Bacteria 2226
397 Ga0495680_0111549 3300047322 Bacteria 2026
398 Ga0495675_0010585 3300047444 Bacteria 5764
399 Ga0495685_045710 3300047447 Bacteria 1491
400 Ga0495673_0019696 3300047469 Bacteria 3377
401 Ga0495681_0115801 3300047470 Bacteria 1156
402 Ga0495593_0043449 3300047673 Bacteria 2408
403 Ga0495602_0000790 3300048088 Bacteria 30230
404 Ga0495602_0088196 3300048088 Bacteria 2583
405 Ga0496100_0017551 3300048903 Bacteria 4228
406 Ga0496101_0226083 3300048904 Bacteria 1454
407 Ga0496102_0000315 3300048905 Bacteria 60883
408 Ga0496102_0536368 3300048905 Bacteria 1093
409 Ga0496102_0705165 3300048905 Bacteria 932
410 Ga0496102_0901346 3300048905 Bacteria 806
411 Ga0496103_0000993 3300048906 Bacteria 19978
412 Ga0496103_0125360 3300048906 Bacteria 1638
413 Ga0496103_0344169 3300048906 Bacteria 959
414 Ga0496103_0354842 3300048906 Bacteria 943
415 Ga0496106_0316307 3300048909 Bacteria 1253
416 Ga0496106_0335967 3300048909 Bacteria 1213
417 Ga0496106_0412930 3300048909 Bacteria 1085
418 Ga0496106_0414611 3300048909 Bacteria 1082
419 Ga0496107_0409947 3300048910 Bacteria 1008
420 Ga0496107_0464553 3300048910 Bacteria 940
421 Ga0496109_0231384 3300048912 Bacteria 1739
422 Ga0496110_0069131 3300048913 Bacteria 3127
423 Ga0496110_0218051 3300048913 Bacteria 1735
424 Ga0496110_0301931 3300048913 Bacteria 1458
425 Ga0496110_0840833 3300048913 Bacteria 823
426 Ga0496112_0018656 3300048915 Bacteria 6538
427 Ga0496112_0069562 3300048915 Bacteria 3477
428 Ga0496112_0105612 3300048915 Bacteria 2786
429 Ga0496112_0276153 3300048915 Bacteria 1628
430 Ga0496113_0115003 3300048916 Bacteria 2098
431 Ga0496114_0066602 3300048917 Bacteria 3020
432 Ga0496114_0225236 3300048917 Bacteria 1647
433 Ga0496116_0008674 3300048919 Bacteria 8786
434 Ga0496117_0000484 3300048920 Bacteria 65863
435 Ga0496118_0000486 3300048921 Bacteria 65791
436 Ga0496121_0105369 3300048924 Bacteria 2164
437 Ga0496121_0158281 3300048924 Bacteria 1659
438 Ga0496125_0277370 3300048928 Bacteria 1041
439 Ga0496126_0335736 3300048929 Bacteria 1239
440 Ga0501031_0027978 3300049568 Bacteria 3674
441 Ga0501034_0109550 3300049571 Bacteria 2753
442 Ga0501036_0030453 3300049572 Bacteria 4558
443 Ga0501038_0295820 3300049574 Bacteria 1271
444 Ga0501040_0094175 3300049576 Bacteria 2084
445 Ga0501042_0115887 3300049578 Bacteria 1929
446 Ga0501046_0070768 3300049580 Bacteria 2712
447 Ga0501047_0055051 3300049581 Bacteria 3847
448 Ga0501067_0172892 3300049583 Bacteria 1203
449 Ga0501070_0069624 3300049586 Bacteria 2913
450 Ga0501074_0226463 3300049590 Bacteria 1331
451 Ga0501076_0536684 3300049592 Bacteria 964
452 Ga0501223_000017 3300049663 Bacteria 68157
453 Ga0501238_008161 3300049671 Bacteria 1372
454 Ga0501225_0000004 3300049705 Bacteria 140738
455 Ga0501080_0342317 3300049742 Bacteria 1351
456 Ga0501081_0109533 3300049743 Bacteria 1959
457 Ga0501035_0079116 3300049822 Bacteria 2904
458 nmdc:mga0yw44_30952_c1 3300050492 Bacteria 3108
459 nmdc:mga05p37_19478_c1 3300050507 Bacteria 8209
460 nmdc:mga05p37_247082_c1 3300050507 Bacteria 2142
461 nmdc:mga05p37_391108_c1 3300050507 Bacteria 1626
462 nmdc:mga05p37_85770_c1 3300050507 Bacteria 3881
463 nmdc:mga05p37_91304_c1 3300050507 Bacteria 3753
464 nmdc:mga09592_152585_c1 3300050508 Bacteria 1993
465 nmdc:mga09592_8478_c1 3300050508 Bacteria 8359
466 nmdc:mga0qj67_116748_c1 3300050509 Bacteria 2157
467 nmdc:mga0qj67_170393_c1 3300050509 Bacteria 1767
468 nmdc:mga0qj67_274908_c1 3300050509 Bacteria 1365
469 nmdc:mga0qj67_63050_c1 3300050509 Bacteria 2947
470 nmdc:mga0qj67_97785_c1 3300050509 Bacteria 2364
471 nmdc:mga06r32_110797_c1 3300050510 Bacteria 2701
472 nmdc:mga06r32_135902_c1 3300050510 Bacteria 2433
473 nmdc:mga06r32_228062_c1 3300050510 Bacteria 1851
474 nmdc:mga08y16_1039751_c1 3300050511 Bacteria 797
475 nmdc:mga08y16_127245_c1 3300050511 Bacteria 2650
476 nmdc:mga08y16_14183_c1 3300050511 Bacteria 8386
477 nmdc:mga0n895_112627_c1 3300050512 Bacteria 2738
478 nmdc:mga0n895_230407_c1 3300050512 Bacteria 1880
479 nmdc:mga0n895_5196_c1 3300050512 Bacteria 10834
480 nmdc:mga0n895_59117_c1 3300050512 Bacteria 3782
481 nmdc:mga0rr50_168696_c1 3300050513 Bacteria 1782
482 nmdc:mga0rr50_382725_c1 3300050513 Bacteria 1187
483 nmdc:mga0rr50_437155_c1 3300050513 Bacteria 1108
484 nmdc:mga08x19_215382_c1 3300050514 Bacteria 1319
485 nmdc:mga08x19_376017_c1 3300050514 Bacteria 994
486 nmdc:mga08x19_84541_c1 3300050514 Bacteria 2087
487 nmdc:mga0a205_100988_c1 3300050515 Bacteria 2783
488 nmdc:mga0a205_120792_c1 3300050515 Bacteria 2519
489 nmdc:mga0a205_141741_c1 3300050515 Bacteria 2304
490 nmdc:mga0a205_87149_c1 3300050515 Bacteria 3016
491 nmdc:mga0sz30_65455_c1 3300050516 Bacteria 1558
492 Ga0495601_0003666 3300053077 Bacteria 8829
493 Ga0495601_0116559 3300053077 Bacteria 1732
494 Ga0495612_0002987 3300053078 Bacteria 7016
495 Ga0495612_0012385 3300053078 Bacteria 3438
496 Ga0495595_0025381 3300053084 Bacteria 2626
497 Ga0495619_0018387 3300053085 Bacteria 4434
498 Ga0495619_0022453 3300053085 Bacteria 4039
499 Ga0500592_013992 3300053116 Bacteria 1286
500 Ga0500595_002626 3300053119 Bacteria 8752
501 Ga0500590_019375 3300053148 Bacteria 3526
502 Ga0500616_0006401 3300053153 Bacteria 7719
503 Ga0500645_011715 3300053730 Bacteria 2853
504 Ga0501084_0106019 3300054114 Bacteria 2361

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049574 Ga0501038_0295820 Ga0501038_0295820_567_1259 223
2 3300046648 Ga0495611_0041739 Ga0495611_0041739_1317_2033 232
3 3300009094 Ga0111539_10534941 Ga0111539_105349411 233
4 3300006844 Ga0075428_100258470 Ga0075428_1002584702 234
5 3300006846 Ga0075430_100460557 Ga0075430_1004605572 234
6 3300006847 Ga0075431_100138817 Ga0075431_1001388171 234
7 3300006852 Ga0075433_10081818 Ga0075433_100818183 234
8 3300006871 Ga0075434_100613705 Ga0075434_1006137051 234
9 3300006914 Ga0075436_100048089 Ga0075436_1000480892 234
10 3300007076 Ga0075435_100251182 Ga0075435_1002511822 234
11 3300009094 Ga0111539_10998127 Ga0111539_109981271 234
12 3300027907 Ga0207428_10259419 Ga0207428_102594191 234
13 3300037418 Ga0395900_0015669 Ga0395900_0015669_1717_2457 234
14 3300037471 Ga0395905_0067708 Ga0395905_0067708_896_1636 234
15 3300038443 Ga0395901_0072012 Ga0395901_0072012_1154_1894 234
16 3300048905 Ga0496102_0901346 Ga0496102_0901346_14_754 234
17 3300048909 Ga0496106_0412930 Ga0496106_0412930_124_864 234
18 3300048910 Ga0496107_0464553 Ga0496107_0464553_33_773 234
19 3300050507 nmdc:mga05p37_91304_c1 nmdc:mga05p37_91304_c1_663_1403 234
20 3300050508 nmdc:mga09592_152585_c1 nmdc:mga09592_152585_c1_1181_1921 234
21 3300050510 nmdc:mga06r32_228062_c1 nmdc:mga06r32_228062_c1_183_923 234
22 3300050511 nmdc:mga08y16_127245_c1 nmdc:mga08y16_127245_c1_1151_1891 234
23 3300050512 nmdc:mga0n895_112627_c1 nmdc:mga0n895_112627_c1_374_1114 234
24 3300050513 nmdc:mga0rr50_382725_c1 nmdc:mga0rr50_382725_c1_201_941 234
25 3300050515 nmdc:mga0a205_141741_c1 nmdc:mga0a205_141741_c1_1490_2230 234
26 3300006163 Ga0070715_10216608 Ga0070715_102166081 236
27 3300006175 Ga0070712_100275363 Ga0070712_1002753632 236
28 3300025905 Ga0207685_10131304 Ga0207685_101313041 236
29 3300028800 Ga0265338_10074974 Ga0265338_100749743 236
30 3300031241 Ga0265325_10113443 Ga0265325_101134432 236
31 3300031249 Ga0265339_10005488 Ga0265339_100054885 236
32 3300031595 Ga0265313_10000131 Ga0265313_100001313 236
33 3300005435 Ga0070714_100342940 Ga0070714_1003429402 237
34 3300005937 Ga0081455_10009321 Ga0081455_1000932111 237
35 3300005937 Ga0081455_10021388 Ga0081455_100213882 237
36 3300006852 Ga0075433_10210483 Ga0075433_102104831 237
37 3300009094 Ga0111539_10205363 Ga0111539_102053632 237
38 3300021388 Ga0213875_10212032 Ga0213875_102120321 237
39 3300037853 Ga0436364_0817427 Ga0436364_0817427_69_824 237
40 3300045049 Ga0466959_0068177 Ga0466959_0068177_26_784 237
41 3300045836 Ga0466958_0021589 Ga0466958_0021589_2945_3703 237
42 3300049583 Ga0501067_0172892 Ga0501067_0172892_263_1027 237
43 3300050511 nmdc:mga08y16_1039751_c1 nmdc:mga08y16_1039751_c1_10_756 237
44 3300050515 nmdc:mga0a205_120792_c1 nmdc:mga0a205_120792_c1_972_1718 237
45 3300005435 Ga0070714_100368100 Ga0070714_1003681002 238
46 3300005437 Ga0070710_10245401 Ga0070710_102454012 238
47 3300005937 Ga0081455_10006109 Ga0081455_1000610914 238
48 3300006028 Ga0070717_10355896 Ga0070717_103558962 238
49 3300048909 Ga0496106_0414611 Ga0496106_0414611_22_762 238
50 3300006844 Ga0075428_100774821 Ga0075428_1007748212 239
51 3300006846 Ga0075430_100026312 Ga0075430_1000263126 239
52 3300024227 Ga0228598_1039499 Ga0228598_10394992 239
53 3300037312 Ga0395899_0089324 Ga0395899_0089324_965_1738 239
54 3300037471 Ga0395905_0414824 Ga0395905_0414824_267_1025 239
55 3300038443 Ga0395901_0006908 Ga0395901_0006908_1436_2209 239
56 3300048905 Ga0496102_0536368 Ga0496102_0536368_87_854 239
57 3300048909 Ga0496106_0335967 Ga0496106_0335967_122_889 239
58 3300050509 nmdc:mga0qj67_97785_c1 nmdc:mga0qj67_97785_c1_593_1336 239
59 3300050510 nmdc:mga06r32_135902_c1 nmdc:mga06r32_135902_c1_783_1526 239
60 iso_pu_bacteria 2840764183 2840765746 239
61 3300005366 Ga0070659_100379906 Ga0070659_1003799062 240
62 3300005467 Ga0070706_100405438 Ga0070706_1004054382 240
63 3300005564 Ga0070664_100481794 Ga0070664_1004817941 240
64 3300009093 Ga0105240_10100746 Ga0105240_101007462 240
65 3300013105 Ga0157369_10022574 Ga0157369_100225748 240
66 3300022467 Ga0224712_10007228 Ga0224712_100072283 240
67 3300025912 Ga0207707_10041441 Ga0207707_100414413 240
68 3300046476 Ga0495662_0029090 Ga0495662_0029090_1536_2291 240
69 3300047469 Ga0495673_0019696 Ga0495673_0019696_870_1634 240
70 iso_pu_bacteria 2513237094 2513637959 240
71 iso_pu_bacteria 2513237098 2513674521 240
72 iso_pu_bacteria 2844315083 2844318339 240
73 iso_pu_bacteria 2874620515 2874627849 240
74 iso_pu_bacteria 2903727486 2903729286 240
75 iso_pu_bacteria 2903768456 2903769397 240
76 iso_pu_bacteria 2904666416 2904672831 240
77 iso_pu_bacteria 2904690495 2904698037 240
78 iso_pu_bacteria 2906602504 2906609418 240
79 iso_pu_bacteria 2906626472 2906628717 240
80 iso_pu_bacteria 2922361189 2922367902 240
81 iso_pu_bacteria 2922393267 2922395590 240
82 iso_pu_bacteria 2932794094 2932796459 240
83 iso_pu_bacteria 2932801729 2932808920 240
84 iso_pu_bacteria 2935769743 2935774067 240
85 iso_pu_bacteria 2935777560 2935780589 240
86 iso_pu_bacteria 2935785616 2935789563 240
87 iso_pu_bacteria 2935793552 2935797340 240
88 iso_pu_bacteria 2935883170 2935886632 240
89 iso_pu_bacteria 2935959822 2935960500 240
90 iso_pu_bacteria 2941531003 2941534094 240
91 iso_pu_bacteria 3005594810 3005598431 240
92 iso_pu_bacteria 3005718088 3005721596 240
93 iso_pu_bacteria 643348564 643601060 240
94 iso_pu_bacteria 8016522445 8016530428 240
95 iso_pu_bacteria 8016530956 8016535699 240
96 iso_pu_bacteria 8016557553 8016561630 240
97 iso_pu_bacteria 8016566248 8016574035 240
98 iso_pu_bacteria 8016575299 8016578150 240
99 iso_pu_bacteria 8016583857 8016592815 240
100 iso_pu_bacteria 8016595262 8016599468 240
101 iso_pu_bacteria 8016603502 8016611521 240
102 iso_pu_bacteria 8019530166 8019535423 240
103 iso_pu_bacteria 8019538911 8019544080 240
104 iso_pu_bacteria 8019648815 8019657468 240
105 iso_pu_bacteria 8056967851 8056972698 240
106 3300005445 Ga0070708_100331226 Ga0070708_1003312262 241
107 3300006847 Ga0075431_100411366 Ga0075431_1004113661 241
108 3300007788 Ga0099795_10069163 Ga0099795_100691632 241
109 3300009147 Ga0114129_10339316 Ga0114129_103393162 241
110 3300010375 Ga0105239_10518452 Ga0105239_105184522 241
111 3300025931 Ga0207644_10109090 Ga0207644_101090902 241
112 3300037312 Ga0395899_0119669 Ga0395899_0119669_167_916 241
113 3300037418 Ga0395900_0237034 Ga0395900_0237034_963_1736 241
114 3300037466 Ga0395898_0060757 Ga0395898_0060757_1805_2566 241
115 3300037466 Ga0395898_0158887 Ga0395898_0158887_996_1745 241
116 3300037471 Ga0395905_0006632 Ga0395905_0006632_6706_7455 241
117 3300037471 Ga0395905_0045589 Ga0395905_0045589_1282_2031 241
118 3300038443 Ga0395901_0067661 Ga0395901_0067661_1822_2571 241
119 3300038443 Ga0395901_0658513 Ga0395901_0658513_87_848 241
120 3300048904 Ga0496101_0226083 Ga0496101_0226083_65_814 241
121 3300048913 Ga0496110_0218051 Ga0496110_0218051_337_1098 241
122 3300048915 Ga0496112_0069562 Ga0496112_0069562_1999_2748 241
123 3300048916 Ga0496113_0115003 Ga0496113_0115003_1049_1798 241
124 3300050507 nmdc:mga05p37_247082_c1 nmdc:mga05p37_247082_c1_266_1027 241
125 iso_pu_bacteria 2508501128 2509147380 241
126 iso_pu_bacteria 2513237092 2513628244 241
127 iso_pu_bacteria 2513237095 2513646606 241
128 iso_pu_bacteria 2513237096 2513655211 241
129 iso_pu_bacteria 2513237137 2513861462 241
130 iso_pu_bacteria 2513237139 2513876418 241
131 iso_pu_bacteria 2513237145 2513915765 241
132 iso_pu_bacteria 2513237161 2514010755 241
133 iso_pu_bacteria 2517093001 2517102050 241
134 iso_pu_bacteria 2517572143 2517894928 241
135 iso_pu_bacteria 2524023205 2524436511 241
136 iso_pu_bacteria 2524023210 2524463758 241
137 iso_pu_bacteria 2524023228 2524534699 241
138 iso_pu_bacteria 2528768022 2528851518 241
139 iso_pu_bacteria 2602042107 2603857893 241
140 iso_pu_bacteria 2617270735 2617352269 241
141 iso_pu_bacteria 2617270741 2617376514 241
142 iso_pu_bacteria 2667528175 2671123038 241
143 iso_pu_bacteria 2728368998 2728748812 241
144 iso_pu_bacteria 2738543024 2739308937 241
145 iso_pu_bacteria 2744054633 2745077115 241
146 iso_pu_bacteria 2791355197 2793072023 241
147 iso_pu_bacteria 2791355199 2793079728 241
148 iso_pu_bacteria 2802429603 2805919698 241
149 iso_pu_bacteria 2816332527 2818240201 241
150 iso_pu_bacteria 2824600985 2824604235 241
151 iso_pu_bacteria 2824609381 2824617465 241
152 iso_pu_bacteria 2824653114 2824660058 241
153 iso_pu_bacteria 2824661429 2824666626 241
154 iso_pu_bacteria 2824671348 2824677018 241
155 iso_pu_bacteria 2824679649 2824686349 241
156 iso_pu_bacteria 2824687955 2824694924 241
157 iso_pu_bacteria 2824696289 2824702887 241
158 iso_pu_bacteria 2824704595 2824712180 241
159 iso_pu_bacteria 2824732956 2824739540 241
160 iso_pu_bacteria 2824746037 2824753522 241
161 iso_pu_bacteria 2824753945 2824760173 241
162 iso_pu_bacteria 2824763712 2824767162 241
163 iso_pu_bacteria 2824773399 2824780628 241
164 iso_pu_bacteria 2838122688 2838126589 241
165 iso_pu_bacteria 2841941048 2841947242 241
166 iso_pu_bacteria 2841949485 2841950687 241
167 iso_pu_bacteria 2841957949 2841964377 241
168 iso_pu_bacteria 2841966195 2841967004 241
169 iso_pu_bacteria 2841974524 2841975748 241
170 iso_pu_bacteria 2841983080 2841990116 241
171 iso_pu_bacteria 2847930680 2847935217 241
172 iso_pu_bacteria 2847939898 2847945821 241
173 iso_pu_bacteria 2857524615 2857527266 241
174 iso_pu_bacteria 2874612657 2874612804 241
175 iso_pu_bacteria 2874628541 2874636300 241
176 iso_pu_bacteria 2876761206 2876770782 241
177 iso_pu_bacteria 2876808645 2876813224 241
178 iso_pu_bacteria 2879083081 2879089121 241
179 iso_pu_bacteria 2879099564 2879102917 241
180 iso_pu_bacteria 2879110137 2879110383 241
181 iso_pu_bacteria 2881364244 2881366660 241
182 iso_pu_bacteria 2881665667 2881669584 241
183 iso_pu_bacteria 2885374607 2885375354 241
184 iso_pu_bacteria 2885409591 2885412736 241
185 iso_pu_bacteria 2888378607 2888383278 241
186 iso_pu_bacteria 2888419890 2888423658 241
187 iso_pu_bacteria 2889033259 2889040807 241
188 iso_pu_bacteria 2903748898 2903756539 241
189 iso_pu_bacteria 2904699407 2904700161 241
190 iso_pu_bacteria 2904711408 2904717121 241
191 iso_pu_bacteria 2906610324 2906611663 241
192 iso_pu_bacteria 2906635258 2906639642 241
193 iso_pu_bacteria 2906643746 2906645919 241
194 iso_pu_bacteria 2906660503 2906660615 241
195 iso_pu_bacteria 2908739725 2908745249 241
196 iso_pu_bacteria 2908756301 2908763075 241
197 iso_pu_bacteria 2908775508 2908779381 241
198 iso_pu_bacteria 2919073203 2919078383 241
199 iso_pu_bacteria 2922368715 2922373440 241
200 iso_pu_bacteria 2922386360 2922392209 241
201 iso_pu_bacteria 2922425934 2922427683 241
202 iso_pu_bacteria 2929615660 2929617187 241
203 iso_pu_bacteria 2929624759 2929626891 241
204 iso_pu_bacteria 2932784394 2932793211 241
205 iso_pu_bacteria 2932809354 2932813050 241
206 iso_pu_bacteria 2932818245 2932821099 241
207 iso_pu_bacteria 2932828146 2932836793 241
208 iso_pu_bacteria 2933577622 2933579144 241
209 iso_pu_bacteria 2935616580 2935621558 241
210 iso_pu_bacteria 2935630451 2935632366 241
211 iso_pu_bacteria 2935638405 2935645491 241
212 iso_pu_bacteria 2935665750 2935667609 241
213 iso_pu_bacteria 2935675223 2935681771 241
214 iso_pu_bacteria 2935684952 2935688357 241
215 iso_pu_bacteria 2935694250 2935699040 241
216 iso_pu_bacteria 2935703347 2935706421 241
217 iso_pu_bacteria 2935713505 2935715376 241
218 iso_pu_bacteria 2935722832 2935726060 241
219 iso_pu_bacteria 2935732158 2935734195 241
220 iso_pu_bacteria 2935741537 2935743574 241
221 iso_pu_bacteria 2935750917 2935754389 241
222 iso_pu_bacteria 2935760218 2935768495 241
223 iso_pu_bacteria 2935801545 2935806584 241
224 iso_pu_bacteria 2935810662 2935813176 241
225 iso_pu_bacteria 2935827899 2935830829 241
226 iso_pu_bacteria 2935837841 2935840855 241
227 iso_pu_bacteria 2935855204 2935859805 241
228 iso_pu_bacteria 2935864058 2935869122 241
229 iso_pu_bacteria 2935873716 2935880685 241
230 iso_pu_bacteria 2935992306 2936000961 241
231 iso_pu_bacteria 2936002035 2936010175 241
232 iso_pu_bacteria 2936037263 2936043728 241
233 iso_pu_bacteria 2940556831 2940560235 241
234 iso_pu_bacteria 2941507105 2941508313 241
235 iso_pu_bacteria 2941515067 2941515181 241
236 iso_pu_bacteria 2941523033 2941524244 241
237 iso_pu_bacteria 2941538514 2941541014 241
238 iso_pu_bacteria 3005474847 3005477398 241
239 iso_pu_bacteria 3005483717 3005489424 241
240 iso_pu_bacteria 3005587118 3005588562 241
241 iso_pu_bacteria 8006933436 8006933837 241
242 iso_pu_bacteria 8006973647 8006983509 241
243 iso_pu_bacteria 8006984368 8006990525 241
244 iso_pu_bacteria 8016511872 8016514238 241
245 iso_pu_bacteria 8017057580 8017062186 241
246 iso_pu_bacteria 8019555841 8019559767 241
247 iso_pu_bacteria 8019565922 8019569876 241
248 iso_pu_bacteria 8019576017 8019581636 241
249 iso_pu_bacteria 8019586578 8019589269 241
250 iso_pu_bacteria 8019597564 8019601962 241
251 iso_pu_bacteria 8019608314 8019616588 241
252 iso_pu_bacteria 8055742211 8055747198 241
253 iso_pu_bacteria 8056673599 8056680653 241
254 iso_pu_bacteria 8056681323 8056685649 241
255 iso_pu_bacteria 8056689827 8056695323 241
256 3300005347 Ga0070668_100091258 Ga0070668_1000912583 242
257 3300005468 Ga0070707_100213467 Ga0070707_1002134673 242
258 3300005518 Ga0070699_100088571 Ga0070699_1000885713 242
259 3300005548 Ga0070665_100157518 Ga0070665_1001575182 242
260 3300005577 Ga0068857_100026472 Ga0068857_1000264723 242
261 3300005578 Ga0068854_100117861 Ga0068854_1001178613 242
262 3300005985 Ga0081539_10009085 Ga0081539_100090852 242
263 3300006028 Ga0070717_10076324 Ga0070717_100763244 242
264 3300006844 Ga0075428_100111593 Ga0075428_1001115932 242
265 3300009093 Ga0105240_11126833 Ga0105240_111268331 242
266 3300013105 Ga0157369_10247236 Ga0157369_102472362 242
267 3300025907 Ga0207645_10105252 Ga0207645_101052522 242
268 3300025923 Ga0207681_10560419 Ga0207681_105604191 242
269 3300025925 Ga0207650_10405622 Ga0207650_104056222 242
270 3300025937 Ga0207669_10205587 Ga0207669_102055872 242
271 3300026116 Ga0207674_10034187 Ga0207674_100341872 242
272 3300038742 Ga0400486_22289 Ga0400486_22289_1315_2067 242
273 3300039110 Ga0400487_25960 Ga0400487_25960_10_762 242
274 3300047447 Ga0495685_045710 Ga0495685_045710_514_1278 242
275 3300047470 Ga0495681_0115801 Ga0495681_0115801_89_853 242
276 3300049576 Ga0501040_0094175 Ga0501040_0094175_1140_1907 242
277 3300049590 Ga0501074_0226463 Ga0501074_0226463_81_848 242
278 3300049592 Ga0501076_0536684 Ga0501076_0536684_178_945 242
279 3300049663 Ga0501223_000017 Ga0501223_000017_20085_20846 242
280 3300049705 Ga0501225_0000004 Ga0501225_0000004_28044_28805 242
281 3300054114 Ga0501084_0106019 Ga0501084_0106019_423_1190 242
282 3300005339 Ga0070660_100026898 Ga0070660_1000268984 243
283 3300005458 Ga0070681_10332899 Ga0070681_103328993 243
284 3300005530 Ga0070679_100061096 Ga0070679_1000610966 243
285 3300005937 Ga0081455_10001280 Ga0081455_1000128015 243
286 3300006028 Ga0070717_10045837 Ga0070717_100458374 243
287 3300013104 Ga0157370_10062738 Ga0157370_100627382 243
288 3300021384 Ga0213876_10187571 Ga0213876_101875712 243
289 3300025919 Ga0207657_10038674 Ga0207657_100386744 243
290 3300025921 Ga0207652_10561702 Ga0207652_105617021 243
291 3300035119 Ga0373956_0073741 Ga0373956_0073741_254_1009 243
292 3300035171 Ga0373946_0146888 Ga0373946_0146888_68_823 243
293 3300035695 Ga0373927_0051140 Ga0373927_0051140_353_1108 243
294 3300035725 Ga0373947_0064742 Ga0373947_0064742_1028_1783 243
295 3300036401 Ga0373937_0502307 Ga0373937_0502307_205_960 243
296 3300037068 Ga0373925_0183120 Ga0373925_0183120_534_1289 243
297 3300039437 Ga0436365_0275343 Ga0436365_0275343_2548_3303 243
298 3300039438 Ga0436360_1279071 Ga0436360_1279071_810_1574 243
299 3300046454 Ga0495592_0089342 Ga0495592_0089342_1408_2163 243
300 3300046459 Ga0495629_0139925 Ga0495629_0139925_321_1076 243
301 3300046462 Ga0495651_0070783 Ga0495651_0070783_226_981 243
302 3300046463 Ga0495653_0045571 Ga0495653_0045571_1070_1825 243
303 3300046473 Ga0495582_0038974 Ga0495582_0038974_1479_2234 243
304 3300046499 Ga0495594_0155476 Ga0495594_0155476_474_1229 243
305 3300046514 Ga0495618_0060818 Ga0495618_0060818_1619_2374 243
306 3300046516 Ga0495628_0270418 Ga0495628_0270418_390_1145 243
307 3300046529 Ga0495652_0082365 Ga0495652_0082365_1827_2582 243
308 3300046533 Ga0495640_0067610 Ga0495640_0067610_1276_2031 243
309 3300046536 Ga0495587_0040791 Ga0495587_0040791_88_843 243
310 3300046559 Ga0495667_0217629 Ga0495667_0217629_194_949 243
311 3300046680 Ga0495646_0149104 Ga0495646_0149104_343_1098 243
312 3300046683 Ga0495658_0245788 Ga0495658_0245788_306_1061 243
313 3300046689 Ga0495613_0121305 Ga0495613_0121305_71_826 243
314 3300046690 Ga0495624_0208383 Ga0495624_0208383_159_914 243
315 3300047317 Ga0495604_0124365 Ga0495604_0124365_320_1075 243
316 3300047319 Ga0495674_0066194 Ga0495674_0066194_2072_2827 243
317 3300047321 Ga0495676_0383016 Ga0495676_0383016_98_853 243
318 3300047322 Ga0495680_0095227 Ga0495680_0095227_1168_1923 243
319 3300047673 Ga0495593_0043449 Ga0495593_0043449_1104_1859 243
320 3300048088 Ga0495602_0088196 Ga0495602_0088196_284_1039 243
321 3300048915 Ga0496112_0018656 Ga0496112_0018656_2873_3628 243
322 3300053077 Ga0495601_0116559 Ga0495601_0116559_564_1319 243
323 3300053078 Ga0495612_0012385 Ga0495612_0012385_2312_3067 243
324 3300053084 Ga0495595_0025381 Ga0495595_0025381_1496_2251 243
325 3300053085 Ga0495619_0018387 Ga0495619_0018387_228_983 243
326 3300005327 Ga0070658_10015872 Ga0070658_100158722 244
327 3300005366 Ga0070659_100144582 Ga0070659_1001445822 244
328 3300005455 Ga0070663_100005493 Ga0070663_1000054931 244
329 3300005536 Ga0070697_100480900 Ga0070697_1004809002 244
330 3300005618 Ga0068864_100242978 Ga0068864_1002429782 244
331 3300005985 Ga0081539_10079199 Ga0081539_100791991 244
332 3300021358 Ga0213873_10040091 Ga0213873_100400912 244
333 3300021384 Ga0213876_10002788 Ga0213876_100027881 244
334 3300021384 Ga0213876_10004257 Ga0213876_100042578 244
335 3300021388 Ga0213875_10090328 Ga0213875_100903282 244
336 3300025909 Ga0207705_10117987 Ga0207705_101179873 244
337 3300035695 Ga0373927_0229552 Ga0373927_0229552_310_1071 244
338 3300037853 Ga0436364_0329188 Ga0436364_0329188_8420_9184 244
339 3300039437 Ga0436365_0190362 Ga0436365_0190362_15725_16489 244
340 3300039437 Ga0436365_0260170 Ga0436365_0260170_19296_20060 244
341 3300039450 Ga0436363_0809548 Ga0436363_0809548_2453_3217 244
342 3300039453 Ga0436362_0204855 Ga0436362_0204855_8822_9586 244
343 3300046455 Ga0495603_0082720 Ga0495603_0082720_732_1493 244
344 3300048912 Ga0496109_0231384 Ga0496109_0231384_75_833 244
345 3300048917 Ga0496114_0066602 Ga0496114_0066602_1581_2345 244
346 3300049586 Ga0501070_0069624 Ga0501070_0069624_195_956 244
347 3300049671 Ga0501238_008161 Ga0501238_008161_160_984 244
348 3300050512 nmdc:mga0n895_59117_c1 nmdc:mga0n895_59117_c1_1634_2395 244
349 3300050515 nmdc:mga0a205_87149_c1 nmdc:mga0a205_87149_c1_70_828 244
350 iso_pu_bacteria 2513237351 2514588027 244
351 3300002077 JGI24744J21845_10008185 JGI24744J21845_100081852 245
352 3300003203 JGI25406J46586_10000700 JGI25406J46586_1000070014 245
353 3300005328 Ga0070676_10188375 Ga0070676_101883752 245
354 3300005331 Ga0070670_100053420 Ga0070670_1000534202 245
355 3300005334 Ga0068869_100242150 Ga0068869_1002421502 245
356 3300005336 Ga0070680_100104495 Ga0070680_1001044952 245
357 3300005337 Ga0070682_100113635 Ga0070682_1001136351 245
358 3300005339 Ga0070660_100447876 Ga0070660_1004478762 245
359 3300005347 Ga0070668_100066136 Ga0070668_1000661362 245
360 3300005353 Ga0070669_100246002 Ga0070669_1002460022 245
361 3300005354 Ga0070675_100170274 Ga0070675_1001702742 245
362 3300005356 Ga0070674_100033619 Ga0070674_1000336193 245
363 3300005439 Ga0070711_100315846 Ga0070711_1003158462 245
364 3300005441 Ga0070700_100132162 Ga0070700_1001321622 245
365 3300005445 Ga0070708_100342723 Ga0070708_1003427232 245
366 3300005455 Ga0070663_100134995 Ga0070663_1001349952 245
367 3300005456 Ga0070678_100042215 Ga0070678_1000422152 245
368 3300005456 Ga0070678_100204750 Ga0070678_1002047501 245
369 3300005457 Ga0070662_100116580 Ga0070662_1001165803 245
370 3300005457 Ga0070662_100138831 Ga0070662_1001388313 245
371 3300005459 Ga0068867_100156792 Ga0068867_1001567922 245
372 3300005459 Ga0068867_100323153 Ga0068867_1003231532 245
373 3300005466 Ga0070685_10175952 Ga0070685_101759522 245
374 3300005467 Ga0070706_100582837 Ga0070706_1005828371 245
375 3300005518 Ga0070699_100453019 Ga0070699_1004530192 245
376 3300005539 Ga0068853_100210834 Ga0068853_1002108342 245
377 3300005543 Ga0070672_100136130 Ga0070672_1001361302 245
378 3300005543 Ga0070672_100645907 Ga0070672_1006459072 245
379 3300005546 Ga0070696_100176538 Ga0070696_1001765381 245
380 3300005547 Ga0070693_100040363 Ga0070693_1000403632 245
381 3300005563 Ga0068855_100115059 Ga0068855_1001150592 245
382 3300005614 Ga0068856_100148323 Ga0068856_1001483233 245
383 3300005615 Ga0070702_100097968 Ga0070702_1000979683 245
384 3300005616 Ga0068852_100737554 Ga0068852_1007375541 245
385 3300005718 Ga0068866_10296037 Ga0068866_102960372 245
386 3300005719 Ga0068861_100114761 Ga0068861_1001147612 245
387 3300005719 Ga0068861_100849576 Ga0068861_1008495761 245
388 3300005840 Ga0068870_10142706 Ga0068870_101427062 245
389 3300005841 Ga0068863_100081050 Ga0068863_1000810503 245
390 3300005937 Ga0081455_10005009 Ga0081455_1000500910 245
391 3300005981 Ga0081538_10006867 Ga0081538_100068672 245
392 3300005981 Ga0081538_10011456 Ga0081538_100114568 245
393 3300005983 Ga0081540_1002273 Ga0081540_100227310 245
394 3300005983 Ga0081540_1024602 Ga0081540_10246023 245
395 3300005983 Ga0081540_1034330 Ga0081540_10343302 245
396 3300005985 Ga0081539_10000726 Ga0081539_1000072670 245
397 3300005985 Ga0081539_10045148 Ga0081539_100451481 245
398 3300006042 Ga0075368_10021110 Ga0075368_100211102 245
399 3300006042 Ga0075368_10035880 Ga0075368_100358802 245
400 3300006051 Ga0075364_10051210 Ga0075364_100512103 245
401 3300006173 Ga0070716_100047588 Ga0070716_1000475881 245
402 3300006186 Ga0075369_10069968 Ga0075369_100699683 245
403 3300006871 Ga0075434_100165178 Ga0075434_1001651782 245
404 3300006881 Ga0068865_100149854 Ga0068865_1001498542 245
405 3300007265 Ga0099794_10076766 Ga0099794_100767661 245
406 3300009092 Ga0105250_10075635 Ga0105250_100756352 245
407 3300009093 Ga0105240_10466306 Ga0105240_104663062 245
408 3300009094 Ga0111539_10354998 Ga0111539_103549982 245
409 3300009098 Ga0105245_10039196 Ga0105245_100391965 245
410 3300009098 Ga0105245_10160101 Ga0105245_101601012 245
411 3300009101 Ga0105247_10025455 Ga0105247_100254553 245
412 3300009147 Ga0114129_10079273 Ga0114129_100792732 245
413 3300009148 Ga0105243_10376316 Ga0105243_103763162 245
414 3300009174 Ga0105241_10041599 Ga0105241_100415992 245
415 3300009176 Ga0105242_10328590 Ga0105242_103285902 245
416 3300009177 Ga0105248_10050893 Ga0105248_100508934 245
417 3300009551 Ga0105238_10034956 Ga0105238_100349563 245
418 3300009553 Ga0105249_10214559 Ga0105249_102145592 245
419 3300010375 Ga0105239_10142225 Ga0105239_101422252 245
420 3300010375 Ga0105239_10341529 Ga0105239_103415293 245
421 3300011119 Ga0105246_10069752 Ga0105246_100697522 245
422 3300013296 Ga0157374_10200656 Ga0157374_102006563 245
423 3300013306 Ga0163162_10096698 Ga0163162_100966982 245
424 3300013306 Ga0163162_10401571 Ga0163162_104015711 245
425 3300013306 Ga0163162_10585663 Ga0163162_105856631 245
426 3300013308 Ga0157375_10087997 Ga0157375_100879973 245
427 3300014326 Ga0157380_10068265 Ga0157380_100682652 245
428 3300014969 Ga0157376_10095030 Ga0157376_100950302 245
429 3300017792 Ga0163161_10146394 Ga0163161_101463942 245
430 3300025899 Ga0207642_10046969 Ga0207642_100469692 245
431 3300025899 Ga0207642_10063153 Ga0207642_100631532 245
432 3300025900 Ga0207710_10016666 Ga0207710_100166662 245
433 3300025907 Ga0207645_10097199 Ga0207645_100971992 245
434 3300025913 Ga0207695_10667258 Ga0207695_106672581 245
435 3300025921 Ga0207652_10606977 Ga0207652_106069771 245
436 3300025924 Ga0207694_10033748 Ga0207694_100337483 245
437 3300025926 Ga0207659_10093113 Ga0207659_100931132 245
438 3300025927 Ga0207687_10037457 Ga0207687_100374572 245
439 3300025927 Ga0207687_10055615 Ga0207687_100556152 245
440 3300025932 Ga0207690_10347421 Ga0207690_103474212 245
441 3300025933 Ga0207706_10124568 Ga0207706_101245682 245
442 3300025933 Ga0207706_10131987 Ga0207706_101319873 245
443 3300025934 Ga0207686_10033881 Ga0207686_100338812 245
444 3300025935 Ga0207709_10055777 Ga0207709_100557775 245
445 3300025936 Ga0207670_10213155 Ga0207670_102131552 245
446 3300025937 Ga0207669_10096029 Ga0207669_100960293 245
447 3300025940 Ga0207691_10085044 Ga0207691_100850443 245
448 3300025941 Ga0207711_10019309 Ga0207711_100193097 245
449 3300025942 Ga0207689_10110996 Ga0207689_101109962 245
450 3300025949 Ga0207667_10691756 Ga0207667_106917562 245
451 3300025960 Ga0207651_10050713 Ga0207651_100507132 245
452 3300025972 Ga0207668_10044494 Ga0207668_100444942 245
453 3300025986 Ga0207658_10121741 Ga0207658_101217412 245
454 3300026067 Ga0207678_10054273 Ga0207678_100542733 245
455 3300026067 Ga0207678_10231130 Ga0207678_102311302 245
456 3300026075 Ga0207708_10055030 Ga0207708_100550302 245
457 3300026089 Ga0207648_10049071 Ga0207648_100490713 245
458 3300026089 Ga0207648_10241638 Ga0207648_102416382 245
459 3300026089 Ga0207648_10521231 Ga0207648_105212311 245
460 3300026095 Ga0207676_10007871 Ga0207676_100078717 245
461 3300026116 Ga0207674_10049920 Ga0207674_100499202 245
462 3300026118 Ga0207675_100104366 Ga0207675_1001043662 245
463 3300026118 Ga0207675_100253913 Ga0207675_1002539131 245
464 3300026121 Ga0207683_10029574 Ga0207683_100295743 245
465 3300026121 Ga0207683_10072136 Ga0207683_100721362 245
466 3300028379 Ga0268266_10045599 Ga0268266_100455993 245
467 3300028380 Ga0268265_10011432 Ga0268265_100114323 245
468 3300028380 Ga0268265_10266262 Ga0268265_102662622 245
469 3300028380 Ga0268265_10683839 Ga0268265_106838392 245
470 3300030763 Ga0265763_1005432 Ga0265763_10054321 245
471 3300031507 Ga0307509_10162799 Ga0307509_101627992 245
472 3300031548 Ga0307408_100230427 Ga0307408_1002304272 245
473 3300032002 Ga0307416_100056299 Ga0307416_1000562993 245
474 3300033180 Ga0307510_10007185 Ga0307510_100071852 245
475 3300035171 Ga0373946_0151036 Ga0373946_0151036_247_1011 245
476 3300037471 Ga0395905_0162212 Ga0395905_0162212_1231_1995 245
477 3300039450 Ga0436363_1207525 Ga0436363_1207525_11_772 245
478 3300039450 Ga0436363_1583481 Ga0436363_1583481_19_780 245
479 3300044658 Ga0466972_0004633 Ga0466972_0004633_2003_2764 245
480 3300044706 Ga0466964_0045186 Ga0466964_0045186_308_1069 245
481 3300044735 Ga0466968_0000249 Ga0466968_0000249_5409_6170 245
482 3300044901 Ga0466960_0005567 Ga0466960_0005567_1945_2706 245
483 3300046452 Ga0495617_031525 Ga0495617_031525_676_1440 245
484 3300046455 Ga0495603_0015346 Ga0495603_0015346_2754_3518 245
485 3300046460 Ga0495638_0090618 Ga0495638_0090618_680_1444 245
486 3300046474 Ga0495605_0026193 Ga0495605_0026193_893_1657 245
487 3300046475 Ga0495639_0007249 Ga0495639_0007249_3556_4320 245
488 3300046492 Ga0495585_0053855 Ga0495585_0053855_67_831 245
489 3300046499 Ga0495594_0018386 Ga0495594_0018386_1174_1938 245
490 3300046513 Ga0495616_0088471 Ga0495616_0088471_50_814 245
491 3300046513 Ga0495616_0104350 Ga0495616_0104350_29_793 245
492 3300046519 Ga0495632_0050219 Ga0495632_0050219_1157_1921 245
493 3300046523 Ga0495644_0028601 Ga0495644_0028601_852_1616 245
494 3300046525 Ga0495663_0012675 Ga0495663_0012675_214_978 245
495 3300046525 Ga0495663_0017939 Ga0495663_0017939_169_933 245
496 3300046537 Ga0495598_0003339 Ga0495598_0003339_453_1217 245
497 3300046538 Ga0495609_0061763 Ga0495609_0061763_761_1525 245
498 3300046539 Ga0495621_0009097 Ga0495621_0009097_1415_2179 245
499 3300046542 Ga0495597_0032596 Ga0495597_0032596_1474_2238 245
500 3300046558 Ga0495633_0015543 Ga0495633_0015543_1250_2014 245
501 3300046558 Ga0495633_0018591 Ga0495633_0018591_1818_2582 245
502 3300046664 Ga0495659_0012707 Ga0495659_0012707_1416_2180 245
503 3300046664 Ga0495659_0029639 Ga0495659_0029639_765_1529 245
504 3300046674 Ga0495588_0005748 Ga0495588_0005748_2120_2884 245
505 3300046684 Ga0495669_0206654 Ga0495669_0206654_99_863 245
506 3300046691 Ga0495670_0071256 Ga0495670_0071256_643_1407 245
507 3300046691 Ga0495670_0085672 Ga0495670_0085672_629_1393 245
508 3300046692 Ga0495671_0069501 Ga0495671_0069501_646_1410 245
509 3300048906 Ga0496103_0125360 Ga0496103_0125360_695_1459 245
510 3300048906 Ga0496103_0354842 Ga0496103_0354842_116_880 245
511 3300048913 Ga0496110_0069131 Ga0496110_0069131_1836_2600 245
512 3300048915 Ga0496112_0105612 Ga0496112_0105612_187_951 245
513 3300048917 Ga0496114_0225236 Ga0496114_0225236_474_1238 245
514 3300048924 Ga0496121_0105369 Ga0496121_0105369_1336_2100 245
515 3300048924 Ga0496121_0158281 Ga0496121_0158281_108_872 245
516 3300048928 Ga0496125_0277370 Ga0496125_0277370_107_871 245
517 3300048929 Ga0496126_0335736 Ga0496126_0335736_287_1051 245
518 3300049581 Ga0501047_0055051 Ga0501047_0055051_214_978 245
519 3300049822 Ga0501035_0079116 Ga0501035_0079116_1971_2735 245
520 3300050492 nmdc:mga0yw44_30952_c1 nmdc:mga0yw44_30952_c1_153_917 245
521 3300050509 nmdc:mga0qj67_274908_c1 nmdc:mga0qj67_274908_c1_447_1211 245
522 3300050514 nmdc:mga08x19_215382_c1 nmdc:mga08x19_215382_c1_38_799 245
523 3300050514 nmdc:mga08x19_376017_c1 nmdc:mga08x19_376017_c1_61_825 245
524 3300050514 nmdc:mga08x19_84541_c1 nmdc:mga08x19_84541_c1_1298_2044 245
525 3300050515 nmdc:mga0a205_100988_c1 nmdc:mga0a205_100988_c1_471_1235 245
526 3300053116 Ga0500592_013992 Ga0500592_013992_362_1126 245
527 3300053119 Ga0500595_002626 Ga0500595_002626_1807_2571 245
528 3300053148 Ga0500590_019375 Ga0500590_019375_2553_3317 245
529 3300053153 Ga0500616_0006401 Ga0500616_0006401_3064_3828 245
530 3300053730 Ga0500645_011715 Ga0500645_011715_693_1457 245
531 iso_pu_bacteria 2508501050 2508733972 245
532 iso_pu_bacteria 2889790730 2889794434 245
533 iso_pu_bacteria 2889914905 2889914945 245
534 3300005435 Ga0070714_100352874 Ga0070714_1003528742 246
535 3300005436 Ga0070713_100071323 Ga0070713_1000713233 246
536 3300005437 Ga0070710_10144539 Ga0070710_101445391 246
537 3300005458 Ga0070681_10111785 Ga0070681_101117852 246
538 3300005536 Ga0070697_100090264 Ga0070697_1000902642 246
539 3300005546 Ga0070696_100273903 Ga0070696_1002739031 246
540 3300005547 Ga0070693_100276388 Ga0070693_1002763882 246
541 3300005614 Ga0068856_100150136 Ga0068856_1001501363 246
542 3300005616 Ga0068852_100002547 Ga0068852_10000254716 246
543 3300005937 Ga0081455_10023945 Ga0081455_100239452 246
544 3300005937 Ga0081455_10039797 Ga0081455_100397972 246
545 3300005937 Ga0081455_10054744 Ga0081455_100547441 246
546 3300005983 Ga0081540_1008687 Ga0081540_10086878 246
547 3300006028 Ga0070717_10015837 Ga0070717_100158377 246
548 3300006058 Ga0075432_10075381 Ga0075432_100753811 246
549 3300006163 Ga0070715_10005685 Ga0070715_100056852 246
550 3300006194 Ga0075427_10015903 Ga0075427_100159031 246
551 3300006846 Ga0075430_100020556 Ga0075430_1000205563 246
552 3300006852 Ga0075433_10390914 Ga0075433_103909142 246
553 3300006871 Ga0075434_100064983 Ga0075434_1000649834 246
554 3300006871 Ga0075434_100266547 Ga0075434_1002665471 246
555 3300006880 Ga0075429_100372927 Ga0075429_1003729271 246
556 3300007076 Ga0075435_100558670 Ga0075435_1005586702 246
557 3300007265 Ga0099794_10016238 Ga0099794_100162383 246
558 3300009094 Ga0111539_10026889 Ga0111539_100268895 246
559 3300009147 Ga0114129_10557592 Ga0114129_105575922 246
560 3300009553 Ga0105249_10080019 Ga0105249_100800192 246
561 3300010375 Ga0105239_10837993 Ga0105239_108379932 246
562 3300025294 Ga0209025_1001512 Ga0209025_100151216 246
563 3300025297 Ga0209758_1009660 Ga0209758_10096603 246
564 3300025885 Ga0207653_10008693 Ga0207653_100086933 246
565 3300025906 Ga0207699_10007096 Ga0207699_100070964 246
566 3300025910 Ga0207684_10192680 Ga0207684_101926802 246
567 3300025912 Ga0207707_10106512 Ga0207707_101065122 246
568 3300025915 Ga0207693_10027049 Ga0207693_100270493 246
569 3300025915 Ga0207693_10232883 Ga0207693_102328831 246
570 3300025916 Ga0207663_10103814 Ga0207663_101038142 246
571 3300025928 Ga0207700_10041513 Ga0207700_100415134 246
572 3300025929 Ga0207664_10648637 Ga0207664_106486371 246
573 3300025939 Ga0207665_10020165 Ga0207665_100201654 246
574 3300026078 Ga0207702_10067383 Ga0207702_100673832 246
575 3300027907 Ga0207428_10010236 Ga0207428_100102365 246
576 3300035170 Ga0373943_0066594 Ga0373943_0066594_441_1214 246
577 3300037068 Ga0373925_0197210 Ga0373925_0197210_350_1123 246
578 3300039447 Ga0436361_0424425 Ga0436361_0424425_12891_13655 246
579 3300048903 Ga0496100_0017551 Ga0496100_0017551_763_1527 246
580 3300048905 Ga0496102_0705165 Ga0496102_0705165_150_917 246
581 3300048906 Ga0496103_0344169 Ga0496103_0344169_73_837 246
582 3300048909 Ga0496106_0316307 Ga0496106_0316307_359_1126 246
583 3300048910 Ga0496107_0409947 Ga0496107_0409947_225_992 246
584 3300048913 Ga0496110_0301931 Ga0496110_0301931_113_877 246
585 3300048913 Ga0496110_0840833 Ga0496110_0840833_32_799 246
586 3300048915 Ga0496112_0276153 Ga0496112_0276153_209_976 246
587 3300050507 nmdc:mga05p37_19478_c1 nmdc:mga05p37_19478_c1_1820_2584 246
588 3300050507 nmdc:mga05p37_391108_c1 nmdc:mga05p37_391108_c1_539_1303 246
589 3300050507 nmdc:mga05p37_85770_c1 nmdc:mga05p37_85770_c1_2114_2878 246
590 3300050508 nmdc:mga09592_8478_c1 nmdc:mga09592_8478_c1_4599_5363 246
591 3300050509 nmdc:mga0qj67_116748_c1 nmdc:mga0qj67_116748_c1_465_1229 246
592 3300050509 nmdc:mga0qj67_63050_c1 nmdc:mga0qj67_63050_c1_1361_2125 246
593 3300050510 nmdc:mga06r32_110797_c1 nmdc:mga06r32_110797_c1_1816_2580 246
594 3300050511 nmdc:mga08y16_14183_c1 nmdc:mga08y16_14183_c1_4593_5357 246
595 3300050512 nmdc:mga0n895_230407_c1 nmdc:mga0n895_230407_c1_252_1016 246
596 3300050512 nmdc:mga0n895_5196_c1 nmdc:mga0n895_5196_c1_4569_5333 246
597 3300050513 nmdc:mga0rr50_168696_c1 nmdc:mga0rr50_168696_c1_83_847 246
598 3300050513 nmdc:mga0rr50_437155_c1 nmdc:mga0rr50_437155_c1_192_956 246
599 3300050516 nmdc:mga0sz30_65455_c1 nmdc:mga0sz30_65455_c1_603_1367 246
600 iso_pu_bacteria 2773857925 2774868893 246
601 iso_pu_bacteria 2835312727 2835315279 246
602 iso_pu_bacteria 2882456835 2882458125 246
603 3300036647 Ga0316582_0183176 Ga0316582_0183176_293_1063 247
604 3300049571 Ga0501034_0109550 Ga0501034_0109550_422_1192 247
605 3300050509 nmdc:mga0qj67_170393_c1 nmdc:mga0qj67_170393_c1_577_1347 247
606 iso_pu_bacteria 2937843397 2937844304 247
607 3300021441 Ga0213871_10007597 Ga0213871_100075972 248
608 3300037471 Ga0395905_0074713 Ga0395905_0074713_398_1234 248
609 3300039438 Ga0436360_0693057 Ga0436360_0693057_1666_2445 248
610 3300039447 Ga0436361_1149293 Ga0436361_1149293_1781_2560 248
611 3300039453 Ga0436362_0584849 Ga0436362_0584849_1889_2668 248
612 3300046518 Ga0495631_0036628 Ga0495631_0036628_1216_1989 248
613 3300049568 Ga0501031_0027978 Ga0501031_0027978_115_906 248
614 3300049572 Ga0501036_0030453 Ga0501036_0030453_3247_4038 248
615 3300049578 Ga0501042_0115887 Ga0501042_0115887_1034_1825 248
616 3300049580 Ga0501046_0070768 Ga0501046_0070768_1371_2162 248
617 3300049742 Ga0501080_0342317 Ga0501080_0342317_31_822 248
618 3300049743 Ga0501081_0109533 Ga0501081_0109533_895_1686 248
619 3300005434 Ga0070709_10224267 Ga0070709_102242672 249
620 3300005436 Ga0070713_100115785 Ga0070713_1001157853 249
621 3300005439 Ga0070711_100018137 Ga0070711_1000181373 249
622 3300009551 Ga0105238_10556681 Ga0105238_105566811 249
623 3300014325 Ga0163163_10499371 Ga0163163_104993712 249
624 3300028379 Ga0268266_10035315 Ga0268266_100353152 249
625 3300035111 Ga0373923_0011341 Ga0373923_0011341_24_803 249
626 3300035118 Ga0373954_0008901 Ga0373954_0008901_2200_2979 249
627 3300035119 Ga0373956_0003850 Ga0373956_0003850_3335_4114 249
628 3300035120 Ga0373957_0039020 Ga0373957_0039020_685_1464 249
629 3300035410 Ga0373924_0007927 Ga0373924_0007927_360_1139 249
630 3300035692 Ga0373935_0060235 Ga0373935_0060235_1169_1948 249
631 3300035695 Ga0373927_0036463 Ga0373927_0036463_1191_1970 249
632 3300037068 Ga0373925_0101705 Ga0373925_0101705_665_1444 249
633 3300038443 Ga0395901_0043447 Ga0395901_0043447_445_1230 249
634 3300046454 Ga0495592_0025015 Ga0495592_0025015_2328_3107 249
635 3300046459 Ga0495629_0383454 Ga0495629_0383454_145_924 249
636 3300046462 Ga0495651_0211293 Ga0495651_0211293_382_1161 249
637 3300046476 Ga0495662_0058245 Ga0495662_0058245_409_1188 249
638 3300046477 Ga0495664_0003009 Ga0495664_0003009_3371_4150 249
639 3300046511 Ga0495608_0014617 Ga0495608_0014617_3164_3943 249
640 3300046516 Ga0495628_0038018 Ga0495628_0038018_2262_3041 249
641 3300046533 Ga0495640_0101687 Ga0495640_0101687_769_1548 249
642 3300046536 Ga0495587_0010482 Ga0495587_0010482_4190_4969 249
643 3300046559 Ga0495667_0019300 Ga0495667_0019300_2055_2834 249
644 3300046675 Ga0495657_0055781 Ga0495657_0055781_1141_1920 249
645 3300046678 Ga0495599_0058233 Ga0495599_0058233_1152_1931 249
646 3300046680 Ga0495646_0018676 Ga0495646_0018676_911_1690 249
647 3300046809 Ga0495600_0074802 Ga0495600_0074802_137_916 249
648 3300047317 Ga0495604_0038094 Ga0495604_0038094_449_1228 249
649 3300047319 Ga0495674_0046602 Ga0495674_0046602_1933_2712 249
650 3300047322 Ga0495680_0111549 Ga0495680_0111549_716_1495 249
651 3300047444 Ga0495675_0010585 Ga0495675_0010585_3163_3942 249
652 3300048088 Ga0495602_0000790 Ga0495602_0000790_23853_24632 249
653 3300053077 Ga0495601_0003666 Ga0495601_0003666_7334_8113 249
654 3300053078 Ga0495612_0002987 Ga0495612_0002987_1187_1966 249
655 3300053085 Ga0495619_0022453 Ga0495619_0022453_1980_2759 249
656 3300025901 Ga0207688_10036235 Ga0207688_100362351 250
657 3300025935 Ga0207709_10103794 Ga0207709_101037942 250
658 3300025972 Ga0207668_10204720 Ga0207668_102047202 250
659 3300031852 Ga0307410_10053728 Ga0307410_100537282 250
660 3300031911 Ga0307412_10186646 Ga0307412_101866461 250
661 3300032002 Ga0307416_100038721 Ga0307416_1000387214 250
662 3300032004 Ga0307414_10127418 Ga0307414_101274182 250
663 3300032005 Ga0307411_10024645 Ga0307411_100246451 250
664 3300032126 Ga0307415_100098440 Ga0307415_1000984401 250
665 3300048905 Ga0496102_0000315 Ga0496102_0000315_14687_15469 251
666 3300048906 Ga0496103_0000993 Ga0496103_0000993_4626_5408 251
667 3300048919 Ga0496116_0008674 Ga0496116_0008674_3168_3950 251
668 3300048920 Ga0496117_0000484 Ga0496117_0000484_50152_50934 251
669 3300048921 Ga0496118_0000486 Ga0496118_0000486_14748_15530 251
670 3300037471 Ga0395905_0594625 Ga0395905_0594625_40_831 254
671 3300005842 Ga0068858_100005442 Ga0068858_10000544212 255
672 3300026035 Ga0207703_10053258 Ga0207703_100532583 255
673 3300028381 Ga0268264_10166108 Ga0268264_101661082 255
674 3300001979 JGI24740J21852_10003072 JGI24740J21852_100030725 259
675 3300005366 Ga0070659_100213127 Ga0070659_1002131271 259
676 3300005563 Ga0068855_100156405 Ga0068855_1001564051 259
677 3300025932 Ga0207690_10441147 Ga0207690_104411471 259
678 3300025949 Ga0207667_10098162 Ga0207667_100981622 259
679 3300026116 Ga0207674_10002930 Ga0207674_100029303 259
680 3300026142 Ga0207698_10122647 Ga0207698_101226473 259

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01145

Band_7

SPFH domain / Band 7 family

24

195

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
8gn9-assembly1.cif.gz_A-2 spfh domain of pyrococcus horikoshii stomatin 0.9401 63 168
8gn9-assembly1.cif.gz_A-2 spfh domain of pyrococcus horikoshii stomatin 0.9316 63 168
4fvj-assembly2.cif.gz_B spfh domain of the mouse stomatin (crystal form 2) 0.9104 59 169
2rpb-assembly1.cif.gz_A the solution structure of membrane protein 0.8949 61 169
4fvj-assembly2.cif.gz_B spfh domain of the mouse stomatin (crystal form 2) 0.8799 59 169
ID Description Score Start End Superfamily
af_F1R5A4_90_200_3.30.479.30 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;Band 7 domain 0.9567 65 169 3.30.479.30
af_Q8T4B6_101_212_3.30.479.30 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;Band 7 domain 0.956 65 168 3.30.479.30
af_A0A1D8PTU3_111_221_3.30.479.30 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;Band 7 domain 0.9271 61 169 3.30.479.30
af_Q9VGD7_116_226_3.30.479.30 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;Band 7 domain 0.9262 61 168 3.30.479.30
af_F1Q9K0_120_233_3.30.479.30 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;Band 7 domain 0.9214 61 163 3.30.479.30
ID Description Score Start End GO Terms
AF-A0A3M1FY76-F1-model_v4 Slipin family protein 0.9422 65 173 GO:0005886
AF-A0A7Z9S0L7-F1-model_v4 Slipin family protein 0.9388 65 175 GO:0005886
AF-A0A0N4T7I1-F1-model_v4 PHB domain-containing protein 0.9385 64 178 GO:0005886
AF-A0A1E7IXH0-F1-model_v4 Band 7 domain-containing protein 0.937 65 184 GO:0005886
AF-G2DGS6-F1-model_v4 Protein QmcA 0.9354 66 176 GO:0006508
GO:0008233
GO:0016020

Feature Viewer

pLDDT pTM Quality
73.86 0.5 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map