F474660

General Info

Members Datasets Scaffolds Average Seq Length
678 318 1356 287

Family's Representative Sequence

Representative Sequence 3300031903|Ga0307407_10274055|Ga0307407_102740552
Length 319
Sequence VALAADRTGPPDPRSGGPPPWLSRGAAPDAPTQPGRKLASWLHRHAGVRLAALLSAPMAWLVVAYLGSLAVLLVSSLWTVNSFTGTLIREPTLDNFRTILTEPVYRNVVLRSIGVAAAVTVIDAAIALPMALFMAKVASPRARHWLVIAILTPLWASYLVKAYAWRVMLANGGPIDWLLGGDGHGPGYGLTATVIVLSYLWLPYMILPVFTGLDRLPDSLLEASADLGARAGTTFRTVVVPMVMPSLVAGSIFTFSLSLGDYITVQIVGGRSQLIGNLVYANIGAANNLPFAAALATIPVAIMVGYLLAVRRTGALDQL

Samples

Sample ID Description Type Environment
1 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
69 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
73 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
74 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
75 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
76 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
77 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
78 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
79 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
83 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
89 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
104 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
114 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
115 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
116 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
117 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
118 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
170 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
171 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
175 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
176 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
177 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
178 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
179 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
180 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
181 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
182 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
183 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
184 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
185 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
186 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
187 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
188 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
189 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
190 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
191 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
192 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
193 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
194 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
195 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
196 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
197 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
198 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
199 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
200 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
201 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
202 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
203 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
204 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
205 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
206 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
207 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
208 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
209 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
210 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
211 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
212 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
213 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
214 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
215 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
216 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
217 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
218 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
219 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
220 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
221 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
222 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
223 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
224 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
225 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
226 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
227 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
228 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
229 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
230 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
231 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
232 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
233 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
234 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
235 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
236 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
237 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
238 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
239 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
240 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
241 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
242 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
243 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
244 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
245 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
246 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
247 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
248 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
249 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
250 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
251 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
252 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
253 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
254 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
255 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
256 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
257 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
258 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
259 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
273 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
274 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
275 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
276 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
277 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
278 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
279 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
280 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
281 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
282 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
283 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
285 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
286 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
287 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
288 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
289 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
290 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
291 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
292 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
293 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
294 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
295 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
296 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
297 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
298 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
299 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
300 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
301 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
302 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
303 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
304 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
305 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
306 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
307 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
308 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
309 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
310 2558860280 Kutzneria sp. 744 Isolate Unclassified
311 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
312 2643221615 Nocardioides sp. Root224 Isolate Unclassified
313 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
314 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
315 2902582711 Micromonospora sp. AP08 Isolate Unclassified
316 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
317 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
318 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.67
Metatranscriptomes 0
Isolates 1.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.23
Nodule 0
Rhizoplane 11.95
Rhizosphere 78.91
Stem 0
Stem Tuber 0
Unclassified 0.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307407_10274055 3300031903 Bacteria 1166
2 LJQas_1002434 3300000549 Bacteria 2589
3 JGI24751J29686_10004243 3300002459 Bacteria 2908
4 Ga0070658_10065628 3300005327 Bacteria 2963
5 Ga0070676_10021068 3300005328 Bacteria 3647
6 Ga0070676_10036389 3300005328 Bacteria 2836
7 Ga0070683_100064097 3300005329 Bacteria 3420
8 Ga0070683_100164202 3300005329 Bacteria 2107
9 Ga0070683_100429970 3300005329 Bacteria 1260
10 Ga0070690_100005532 3300005330 Bacteria 7106
11 Ga0070670_100019163 3300005331 Bacteria 5868
12 Ga0068869_100018671 3300005334 Bacteria 4724
13 Ga0070666_10013334 3300005335 Bacteria 5211
14 Ga0070680_100063795 3300005336 Bacteria 3018
15 Ga0070682_100057933 3300005337 Bacteria 2442
16 Ga0068868_100003930 3300005338 Bacteria 10383
17 Ga0068868_100007923 3300005338 Bacteria 7588
18 Ga0068868_100051739 3300005338 Bacteria 3232
19 Ga0068868_100096907 3300005338 Bacteria 2383
20 Ga0068868_100106629 3300005338 Bacteria 2273
21 Ga0068868_100197183 3300005338 Bacteria 1677
22 Ga0068868_100338476 3300005338 Bacteria 1286
23 Ga0070660_100051368 3300005339 Bacteria 3175
24 Ga0070689_100018679 3300005340 Bacteria 5112
25 Ga0070689_100036289 3300005340 Bacteria 3770
26 Ga0070689_100339580 3300005340 Bacteria 1258
27 Ga0070691_10001538 3300005341 Bacteria 9931
28 Ga0070691_10021319 3300005341 Bacteria 2998
29 Ga0070687_100071630 3300005343 Bacteria 1863
30 Ga0070692_10006877 3300005345 Bacteria 4970
31 Ga0070692_10100436 3300005345 Bacteria 1585
32 Ga0070668_100003460 3300005347 Bacteria 11657
33 Ga0070668_100182781 3300005347 Bacteria 1714
34 Ga0070668_100228552 3300005347 Bacteria 1537
35 Ga0070675_100316758 3300005354 Bacteria 1377
36 Ga0070671_100037911 3300005355 Bacteria 3999
37 Ga0070671_100051390 3300005355 Bacteria 3428
38 Ga0070674_100086744 3300005356 Bacteria 2249
39 Ga0070674_100123075 3300005356 Bacteria 1923
40 Ga0070674_100274906 3300005356 Bacteria 1333
41 Ga0070673_100105013 3300005364 Bacteria 2333
42 Ga0070673_100368787 3300005364 Bacteria 1278
43 Ga0070688_100225661 3300005365 Bacteria 1322
44 Ga0070688_100479097 3300005365 Bacteria 935
45 Ga0070659_100033853 3300005366 Bacteria 3972
46 Ga0070659_100062698 3300005366 Bacteria 2939
47 Ga0070667_100490145 3300005367 Bacteria 1126
48 Ga0070714_100025924 3300005435 Bacteria 4842
49 Ga0070713_100003753 3300005436 Bacteria 10050
50 Ga0070701_10016722 3300005438 Bacteria 3417
51 Ga0070705_100021187 3300005440 Bacteria 3453
52 Ga0070705_100119167 3300005440 Bacteria 1701
53 Ga0070705_100123500 3300005440 Bacteria 1676
54 Ga0070700_100168072 3300005441 Bacteria 1516
55 Ga0070694_100248624 3300005444 Bacteria 1344
56 Ga0070663_100002020 3300005455 Bacteria 11335
57 Ga0070663_100010278 3300005455 Bacteria 5830
58 Ga0070678_100022800 3300005456 Bacteria 4158
59 Ga0070678_100316281 3300005456 Bacteria 1332
60 Ga0070662_100007677 3300005457 Bacteria 6998
61 Ga0070662_100136432 3300005457 Bacteria 1897
62 Ga0070681_10035257 3300005458 Bacteria 5026
63 Ga0068867_100001167 3300005459 Bacteria 17965
64 Ga0070685_10117074 3300005466 Bacteria 1650
65 Ga0070706_100156215 3300005467 Bacteria 2129
66 Ga0070707_100070989 3300005468 Bacteria 3354
67 Ga0070698_100001085 3300005471 Bacteria 29891
68 Ga0070698_100019165 3300005471 Bacteria 7192
69 Ga0070698_100252529 3300005471 Bacteria 1696
70 Ga0070699_100203607 3300005518 Bacteria 1760
71 Ga0070684_100021842 3300005535 Bacteria 5332
72 Ga0070684_100026608 3300005535 Bacteria 4874
73 Ga0070684_100557422 3300005535 Bacteria 1064
74 Ga0070697_100190224 3300005536 Bacteria 1742
75 Ga0068853_100252251 3300005539 Bacteria 1619
76 Ga0070686_100010954 3300005544 Bacteria 5133
77 Ga0070686_100034332 3300005544 Bacteria 3125
78 Ga0070695_100082640 3300005545 Bacteria 2127
79 Ga0070696_100012733 3300005546 Bacteria 5648
80 Ga0070696_100103945 3300005546 Bacteria 2039
81 Ga0070696_100154679 3300005546 Bacteria 1686
82 Ga0070665_100134065 3300005548 Bacteria 2478
83 Ga0070665_100476023 3300005548 Bacteria 1259
84 Ga0070704_100041860 3300005549 Bacteria 3165
85 Ga0070704_100219556 3300005549 Bacteria 1545
86 Ga0068855_100046262 3300005563 Bacteria 5145
87 Ga0068855_100229606 3300005563 Bacteria 2079
88 Ga0068855_100422517 3300005563 Bacteria 1458
89 Ga0068855_100426121 3300005563 Bacteria 1451
90 Ga0070664_100037100 3300005564 Bacteria 4095
91 Ga0068857_100288327 3300005577 Bacteria 1511
92 Ga0068854_100033288 3300005578 Bacteria 3592
93 Ga0068854_100109920 3300005578 Bacteria 2078
94 Ga0068854_100242942 3300005578 Bacteria 1435
95 Ga0068856_100079472 3300005614 Bacteria 3252
96 Ga0068856_100195529 3300005614 Bacteria 2036
97 Ga0070702_100100048 3300005615 Bacteria 1776
98 Ga0068852_100030291 3300005616 Bacteria 4453
99 Ga0068852_100039008 3300005616 Bacteria 3996
100 Ga0068864_100082387 3300005618 Bacteria 2823
101 Ga0068864_100194781 3300005618 Bacteria 1859
102 Ga0068864_100314251 3300005618 Bacteria 1470
103 Ga0068866_10021563 3300005718 Bacteria 2970
104 Ga0068861_100067244 3300005719 Bacteria 2765
105 Ga0068861_100123814 3300005719 Bacteria 2089
106 Ga0068861_100147802 3300005719 Bacteria 1925
107 Ga0068851_10019739 3300005834 Bacteria 3258
108 Ga0068870_10035440 3300005840 Bacteria 2560
109 Ga0068863_100009789 3300005841 Bacteria 9344
110 Ga0068863_100018636 3300005841 Bacteria 6641
111 Ga0068863_100041764 3300005841 Bacteria 4360
112 Ga0068863_100267334 3300005841 Bacteria 1654
113 Ga0068863_100514077 3300005841 Bacteria 1180
114 Ga0068858_100073576 3300005842 Bacteria 3172
115 Ga0068858_100212087 3300005842 Bacteria 1833
116 Ga0068860_100026646 3300005843 Bacteria 5573
117 Ga0068860_100030588 3300005843 Bacteria 5178
118 Ga0068860_100053843 3300005843 Bacteria 3825
119 Ga0068862_100063231 3300005844 Bacteria 3185
120 Ga0081455_10003611 3300005937 Bacteria 17731
121 Ga0081455_10025145 3300005937 Bacteria 5501
122 Ga0081455_10038418 3300005937 Bacteria 4240
123 Ga0081538_10075614 3300005981 Bacteria 1826
124 Ga0081540_1012872 3300005983 Bacteria 5471
125 Ga0081540_1016724 3300005983 Bacteria 4573
126 Ga0081540_1063298 3300005983 Bacteria 1751
127 Ga0081539_10001405 3300005985 Bacteria 41451
128 Ga0081539_10009012 3300005985 Bacteria 8478
129 Ga0081539_10011886 3300005985 Bacteria 6801
130 Ga0070717_10044621 3300006028 Bacteria 3621
131 Ga0075365_10003573 3300006038 Bacteria 8041
132 Ga0075365_10050839 3300006038 Bacteria 2735
133 Ga0075365_10117490 3300006038 Bacteria 1832
134 Ga0075365_10120784 3300006038 Bacteria 1807
135 Ga0075365_10150907 3300006038 Bacteria 1616
136 Ga0075363_100001228 3300006048 Bacteria 9491
137 Ga0075363_100111591 3300006048 Bacteria 1520
138 Ga0075364_10007483 3300006051 Bacteria 6489
139 Ga0075364_10100229 3300006051 Bacteria 1928
140 Ga0075364_10129013 3300006051 Bacteria 1696
141 Ga0075364_10337751 3300006051 Bacteria 1026
142 Ga0075432_10030525 3300006058 Bacteria 1862
143 Ga0075362_10005215 3300006177 Bacteria 4738
144 Ga0075362_10059067 3300006177 Bacteria 1731
145 Ga0075362_10116848 3300006177 Bacteria 1260
146 Ga0075367_10025230 3300006178 Bacteria 3360
147 Ga0075367_10051347 3300006178 Bacteria 2437
148 Ga0075367_10213671 3300006178 Bacteria 1206
149 Ga0075366_10058694 3300006195 Bacteria 2286
150 Ga0075370_10034045 3300006353 Bacteria 2855
151 Ga0075370_10077574 3300006353 Bacteria 1906
152 Ga0075370_10109066 3300006353 Bacteria 1606
153 Ga0068871_100114290 3300006358 Bacteria 2274
154 Ga0068871_100114414 3300006358 Bacteria 2273
155 Ga0068871_100128346 3300006358 Bacteria 2148
156 Ga0075428_100052542 3300006844 Bacteria 4465
157 Ga0075428_100080554 3300006844 Bacteria 3553
158 Ga0075430_100247716 3300006846 Bacteria 1476
159 Ga0075431_100000676 3300006847 Bacteria 29173
160 Ga0075431_100033118 3300006847 Bacteria 5326
161 Ga0075431_100125811 3300006847 Bacteria 2644
162 Ga0075431_100287615 3300006847 Bacteria 1663
163 Ga0075433_10070532 3300006852 Bacteria 3071
164 Ga0075434_100001921 3300006871 Bacteria 18017
165 Ga0075434_100049120 3300006871 Bacteria 4188
166 Ga0075429_100002702 3300006880 Bacteria 14953
167 Ga0075429_100286346 3300006880 Bacteria 1443
168 Ga0068865_100053131 3300006881 Bacteria 2811
169 Ga0068865_100076556 3300006881 Bacteria 2388
170 Ga0075436_100000663 3300006914 Bacteria 22664
171 Ga0075435_100002027 3300007076 Bacteria 13255
172 Ga0105240_10526148 3300009093 Bacteria 1311
173 Ga0111539_10022261 3300009094 Bacteria 7790
174 Ga0111539_10103122 3300009094 Bacteria 3348
175 Ga0111539_10168091 3300009094 Bacteria 2563
176 Ga0105245_10017702 3300009098 Bacteria 6220
177 Ga0105245_10221768 3300009098 Bacteria 1825
178 Ga0105245_10285659 3300009098 Bacteria 1614
179 Ga0114129_10170060 3300009147 Bacteria 2972
180 Ga0114129_10227875 3300009147 Bacteria 2511
181 Ga0105243_10010116 3300009148 Bacteria 7177
182 Ga0105243_10085613 3300009148 Bacteria 2584
183 Ga0105243_10164247 3300009148 Bacteria 1917
184 Ga0105243_10212016 3300009148 Bacteria 1706
185 Ga0105243_10266094 3300009148 Bacteria 1537
186 Ga0105243_10517557 3300009148 Bacteria 1134
187 Ga0105241_10028260 3300009174 Bacteria 4179
188 Ga0105242_10059867 3300009176 Bacteria 3126
189 Ga0105242_10127408 3300009176 Bacteria 2193
190 Ga0105248_10025546 3300009177 Bacteria 6567
191 Ga0105248_10031432 3300009177 Bacteria 5934
192 Ga0105248_10116774 3300009177 Bacteria 3009
193 Ga0105248_10154291 3300009177 Bacteria 2591
194 Ga0105248_10195647 3300009177 Bacteria 2278
195 Ga0105237_10054318 3300009545 Bacteria 4014
196 Ga0105237_10436164 3300009545 Bacteria 1316
197 Ga0105237_10768228 3300009545 Bacteria 970
198 Ga0105238_10056206 3300009551 Bacteria 3949
199 Ga0105238_10181967 3300009551 Bacteria 2079
200 Ga0105238_10228852 3300009551 Bacteria 1836
201 Ga0105249_10071356 3300009553 Bacteria 3208
202 Ga0105249_10102728 3300009553 Bacteria 2691
203 Ga0105249_10192783 3300009553 Bacteria 1990
204 Ga0105249_10252993 3300009553 Bacteria 1747
205 Ga0105249_10367840 3300009553 Unclassified 1461
206 Ga0105239_10032152 3300010375 Bacteria 5767
207 Ga0105239_10092943 3300010375 Bacteria 3330
208 Ga0105239_10171522 3300010375 Bacteria 2426
209 Ga0105239_10459591 3300010375 Bacteria 1445
210 Ga0105246_10008187 3300011119 Bacteria 6419
211 Ga0157371_10176500 3300013102 Bacteria 1527
212 Ga0157370_10031765 3300013104 Bacteria 5162
213 Ga0157369_10075291 3300013105 Bacteria 3620
214 Ga0157374_10010504 3300013296 Bacteria 7967
215 Ga0157374_10279034 3300013296 Bacteria 1649
216 Ga0157378_10007665 3300013297 Bacteria 9422
217 Ga0163162_10008544 3300013306 Bacteria 9984
218 Ga0163162_10074333 3300013306 Bacteria 3457
219 Ga0163162_10718608 3300013306 Bacteria 1120
220 Ga0157372_10058270 3300013307 Bacteria 4317
221 Ga0157372_10145615 3300013307 Bacteria 2732
222 Ga0157372_10332913 3300013307 Bacteria 1768
223 Ga0157375_10017673 3300013308 Bacteria 6444
224 Ga0157375_10185620 3300013308 Bacteria 2233
225 Ga0157375_10210860 3300013308 Bacteria 2100
226 Ga0157375_10464673 3300013308 Bacteria 1431
227 Ga0157375_10792477 3300013308 Bacteria 1097
228 Ga0163163_10060007 3300014325 Bacteria 3765
229 Ga0163163_10065583 3300014325 Bacteria 3605
230 Ga0163163_10174065 3300014325 Bacteria 2199
231 Ga0157380_10119787 3300014326 Bacteria 2227
232 Ga0157380_10247065 3300014326 Bacteria 1613
233 Ga0182008_10039488 3300014497 Bacteria 2358
234 Ga0157377_10005400 3300014745 Bacteria 6005
235 Ga0157377_10009619 3300014745 Bacteria 4753
236 Ga0157379_10056354 3300014968 Bacteria 3512
237 Ga0157379_10114027 3300014968 Bacteria 2429
238 Ga0157379_10240244 3300014968 Bacteria 1643
239 Ga0157379_10297725 3300014968 Bacteria 1470
240 Ga0157379_10452663 3300014968 Bacteria 1185
241 Ga0157376_10237808 3300014969 Bacteria 1695
242 Ga0157376_10438211 3300014969 Bacteria 1272
243 Ga0163161_10044339 3300017792 Bacteria 3203
244 Ga0207656_10004547 3300025321 Bacteria 4854
245 Ga0207688_10005360 3300025901 Bacteria 6963
246 Ga0207688_10018631 3300025901 Bacteria 3776
247 Ga0207680_10206000 3300025903 Bacteria 1343
248 Ga0207699_10066241 3300025906 Bacteria 2192
249 Ga0207645_10029478 3300025907 Bacteria 3537
250 Ga0207645_10042479 3300025907 Bacteria 2909
251 Ga0207645_10111585 3300025907 Bacteria 1770
252 Ga0207643_10000117 3300025908 Bacteria 54338
253 Ga0207705_10019086 3300025909 Bacteria 4904
254 Ga0207654_10014770 3300025911 Bacteria 4040
255 Ga0207707_10213441 3300025912 Bacteria 1681
256 Ga0207695_10137665 3300025913 Bacteria 2393
257 Ga0207693_10033341 3300025915 Bacteria 4063
258 Ga0207660_10243717 3300025917 Bacteria 1417
259 Ga0207662_10052216 3300025918 Bacteria 2432
260 Ga0207657_10030915 3300025919 Bacteria 4854
261 Ga0207652_10048958 3300025921 Bacteria 3615
262 Ga0207694_10146703 3300025924 Bacteria 1899
263 Ga0207650_10000493 3300025925 Bacteria 32882
264 Ga0207659_10023592 3300025926 Bacteria 4108
265 Ga0207659_10041269 3300025926 Bacteria 3231
266 Ga0207659_10103230 3300025926 Bacteria 2154
267 Ga0207687_10018266 3300025927 Bacteria 4626
268 Ga0207687_10048371 3300025927 Bacteria 2952
269 Ga0207687_10048752 3300025927 Bacteria 2943
270 Ga0207700_10024192 3300025928 Bacteria 4199
271 Ga0207700_10279956 3300025928 Bacteria 1434
272 Ga0207664_10221539 3300025929 Bacteria 1641
273 Ga0207644_10024057 3300025931 Bacteria 4177
274 Ga0207644_10030397 3300025931 Bacteria 3756
275 Ga0207690_10029835 3300025932 Bacteria 3472
276 Ga0207690_10239279 3300025932 Bacteria 1397
277 Ga0207706_10003126 3300025933 Bacteria 15895
278 Ga0207706_10009698 3300025933 Bacteria 8836
279 Ga0207706_10072389 3300025933 Bacteria 3032
280 Ga0207706_10137202 3300025933 Bacteria 2152
281 Ga0207706_10287047 3300025933 Bacteria 1435
282 Ga0207686_10077183 3300025934 Bacteria 2162
283 Ga0207709_10009069 3300025935 Bacteria 5485
284 Ga0207709_10063853 3300025935 Bacteria 2309
285 Ga0207709_10067848 3300025935 Bacteria 2252
286 Ga0207709_10143913 3300025935 Bacteria 1642
287 Ga0207709_10299897 3300025935 Bacteria 1194
288 Ga0207670_10019642 3300025936 Bacteria 4132
289 Ga0207669_10016656 3300025937 Bacteria 3742
290 Ga0207665_10025133 3300025939 Bacteria 3929
291 Ga0207691_10032484 3300025940 Bacteria 4865
292 Ga0207711_10112825 3300025941 Bacteria 2420
293 Ga0207711_10197339 3300025941 Bacteria 1836
294 Ga0207689_10009422 3300025942 Bacteria 8432
295 Ga0207689_10193688 3300025942 Bacteria 1677
296 Ga0207661_10021598 3300025944 Bacteria 4825
297 Ga0207661_10518664 3300025944 Bacteria 1090
298 Ga0207679_10002230 3300025945 Bacteria 11971
299 Ga0207679_10008645 3300025945 Bacteria 6491
300 Ga0207667_10082423 3300025949 Bacteria 3332
301 Ga0207667_10375243 3300025949 Bacteria 1449
302 Ga0207667_10506536 3300025949 Bacteria 1224
303 Ga0207712_10081619 3300025961 Bacteria 2355
304 Ga0207712_10134629 3300025961 Bacteria 1888
305 Ga0207712_10241055 3300025961 Unclassified 1456
306 Ga0207668_10001892 3300025972 Bacteria 12254
307 Ga0207668_10046396 3300025972 Bacteria 2969
308 Ga0207668_10071674 3300025972 Bacteria 2476
309 Ga0207668_10191064 3300025972 Bacteria 1623
310 Ga0207668_10251689 3300025972 Bacteria 1435
311 Ga0207640_10101431 3300025981 Bacteria 2019
312 Ga0207640_10179125 3300025981 Bacteria 1587
313 Ga0207658_10164721 3300025986 Bacteria 1820
314 Ga0207677_10005764 3300026023 Bacteria 6740
315 Ga0207677_10072877 3300026023 Bacteria 2430
316 Ga0207677_10145613 3300026023 Bacteria 1820
317 Ga0207677_10253965 3300026023 Bacteria 1429
318 Ga0207703_10087530 3300026035 Bacteria 2612
319 Ga0207703_10120589 3300026035 Bacteria 2251
320 Ga0207678_10000391 3300026067 Bacteria 39957
321 Ga0207678_10209134 3300026067 Bacteria 1669
322 Ga0207708_10017312 3300026075 Bacteria 5425
323 Ga0207708_10021321 3300026075 Bacteria 4885
324 Ga0207708_10047309 3300026075 Bacteria 3275
325 Ga0207708_10096740 3300026075 Bacteria 2282
326 Ga0207708_10151342 3300026075 Bacteria 1827
327 Ga0207708_10205977 3300026075 Bacteria 1571
328 Ga0207702_10002078 3300026078 Bacteria 19339
329 Ga0207702_10084488 3300026078 Bacteria 2764
330 Ga0207702_10115268 3300026078 Bacteria 2396
331 Ga0207702_10419071 3300026078 Bacteria 1294
332 Ga0207702_10618807 3300026078 Bacteria 1063
333 Ga0207641_10011671 3300026088 Bacteria 7214
334 Ga0207641_10017730 3300026088 Bacteria 5832
335 Ga0207641_10029839 3300026088 Bacteria 4511
336 Ga0207648_10002699 3300026089 Bacteria 18877
337 Ga0207648_10034388 3300026089 Bacteria 4468
338 Ga0207648_10060948 3300026089 Bacteria 3290
339 Ga0207676_10001839 3300026095 Bacteria 15547
340 Ga0207676_10076495 3300026095 Bacteria 2705
341 Ga0207676_10080092 3300026095 Bacteria 2650
342 Ga0207676_10361718 3300026095 Bacteria 1345
343 Ga0207674_10030133 3300026116 Bacteria 5708
344 Ga0207674_10055380 3300026116 Bacteria 4032
345 Ga0207674_10356367 3300026116 Bacteria 1414
346 Ga0207675_100000686 3300026118 Bacteria 33362
347 Ga0207675_100061350 3300026118 Bacteria 3510
348 Ga0207675_100066810 3300026118 Bacteria 3361
349 Ga0207675_100110177 3300026118 Bacteria 2598
350 Ga0207675_100258016 3300026118 Bacteria 1688
351 Ga0207683_10044178 3300026121 Bacteria 3895
352 Ga0207698_10048649 3300026142 Bacteria 3221
353 Ga0207698_10133262 3300026142 Bacteria 2127
354 Ga0207698_10212024 3300026142 Bacteria 1743
355 Ga0209813_10042107 3300027866 Bacteria 1395
356 Ga0207428_10022628 3300027907 Bacteria 5301
357 Ga0268266_10124063 3300028379 Bacteria 2302
358 Ga0268266_10255450 3300028379 Bacteria 1622
359 Ga0268266_10374409 3300028379 Bacteria 1342
360 Ga0268265_10015214 3300028380 Bacteria 5260
361 Ga0268265_10233863 3300028380 Bacteria 1617
362 Ga0268264_10030952 3300028381 Bacteria 4388
363 Ga0268264_10138905 3300028381 Bacteria 2164
364 Ga0307515_10126220 3300028794 Bacteria 2856
365 Ga0307511_10001274 3300030521 Bacteria 26705
366 Ga0307513_10025522 3300031456 Bacteria 6842
367 Ga0307509_10019348 3300031507 Bacteria 7768
368 Ga0307408_100059051 3300031548 Bacteria 2791
369 Ga0307508_10001935 3300031616 Bacteria 22718
370 Ga0316576_10307938 3300031727 Bacteria 1183
371 Ga0307413_10191722 3300031824 Bacteria 1468
372 Ga0307413_10283746 3300031824 Bacteria 1247
373 Ga0307518_10000241 3300031838 Bacteria 41161
374 Ga0307410_10056268 3300031852 Bacteria 2674
375 Ga0326468_10000083 3300031889 Bacteria 8124
376 Ga0307406_10039433 3300031901 Bacteria 2930
377 Ga0307406_10123415 3300031901 Bacteria 1805
378 Ga0307406_10191399 3300031901 Bacteria 1498
379 Ga0307406_10217854 3300031901 Bacteria 1417
380 Ga0307406_10218021 3300031901 Bacteria 1416
381 Ga0307407_10026838 3300031903 Bacteria 3056
382 Ga0307407_10042103 3300031903 Bacteria 2558
383 Ga0307407_10079625 3300031903 Bacteria 1977
384 Ga0307409_100001479 3300031995 Bacteria 11588
385 Ga0307409_100047500 3300031995 Bacteria 3259
386 Ga0307416_100010065 3300032002 Bacteria 6227
387 Ga0307416_100029855 3300032002 Bacteria 4081
388 Ga0307416_100076442 3300032002 Bacteria 2806
389 Ga0307416_100250724 3300032002 Bacteria 1723
390 Ga0307416_100427702 3300032002 Bacteria 1370
391 Ga0307416_100436073 3300032002 Bacteria 1359
392 Ga0307411_10280456 3300032005 Bacteria 1326
393 Ga0307415_100000049 3300032126 Bacteria 51581
394 Ga0307415_100057980 3300032126 Bacteria 2664
395 Ga0307415_100076829 3300032126 Bacteria 2369
396 Ga0307507_10056762 3300033179 Bacteria 3696
397 Ga0316574_0094024 3300035398 Bacteria 1914
398 Ga0373931_0181162 3300035691 Bacteria 1248
399 Ga0373935_0018731 3300035692 Bacteria 4217
400 Ga0373935_0166156 3300035692 Bacteria 1507
401 Ga0373947_0168992 3300035725 Bacteria 1418
402 Ga0395899_0007240 3300037312 Bacteria 8589
403 Ga0395899_0017405 3300037312 Bacteria 5475
404 Ga0395899_0030723 3300037312 Bacteria 4039
405 Ga0395900_0022618 3300037418 Bacteria 6433
406 Ga0395900_0144622 3300037418 Bacteria 2432
407 Ga0395900_0196035 3300037418 Bacteria 2046
408 Ga0395900_0209837 3300037418 Bacteria 1967
409 Ga0395898_0014756 3300037466 Bacteria 8020
410 Ga0395898_0163142 3300037466 Bacteria 2131
411 Ga0395898_0827038 3300037466 Bacteria 866
412 Ga0395905_0046823 3300037471 Bacteria 4055
413 Ga0395905_0312292 3300037471 Bacteria 1460
414 Ga0395901_0026456 3300038443 Bacteria 5956
415 Ga0395901_0271572 3300038443 Bacteria 1763
416 Ga0439463_011559 3300042016 Bacteria 2167
417 Ga0439463_033195 3300042016 Bacteria 1305
418 Ga0450902_003876 3300042137 Bacteria 2209
419 Ga0451577_0002607 3300042876 Bacteria 21201
420 Ga0466969_0040154 3300044656 Bacteria 2345
421 Ga0466972_0096218 3300044658 Bacteria 1402
422 Ga0453683_0122589 3300044673 Bacteria 1637
423 Ga0466965_0013666 3300044683 Bacteria 3833
424 Ga0466966_0001252 3300044684 Bacteria 16267
425 Ga0466961_0018128 3300044693 Bacteria 4527
426 Ga0466961_0052418 3300044693 Bacteria 2603
427 Ga0466963_0016775 3300044694 Bacteria 4558
428 Ga0466963_0028854 3300044694 Bacteria 3566
429 Ga0466963_0208105 3300044694 Bacteria 1369
430 Ga0466964_0002836 3300044706 Bacteria 6246
431 Ga0453684_0003257 3300044712 Bacteria 37095
432 Ga0466970_0008269 3300044765 Bacteria 5230
433 Ga0466970_0083549 3300044765 Bacteria 1728
434 Ga0466970_0095488 3300044765 Bacteria 1616
435 Ga0466970_0258849 3300044765 Bacteria 976
436 Ga0466957_0029745 3300044842 Bacteria 3258
437 Ga0466960_0004512 3300044901 Bacteria 5453
438 Ga0466960_0009790 3300044901 Bacteria 3963
439 Ga0466960_0015885 3300044901 Bacteria 3254
440 Ga0466960_0273099 3300044901 Bacteria 945
441 Ga0466960_0325747 3300044901 Bacteria 871
442 Ga0466959_0002606 3300045049 Bacteria 11578
443 Ga0451576_0039926 3300045051 Bacteria 4968
444 Ga0466958_0122084 3300045836 Bacteria 1631
445 Ga0466967_0017731 3300045976 Bacteria 5664
446 Ga0466967_0096872 3300045976 Bacteria 2692
447 Ga0466967_0482288 3300045976 Bacteria 1215
448 Ga0495638_0105041 3300046460 Bacteria 1684
449 Ga0495582_0033736 3300046473 Bacteria 2815
450 Ga0495605_0079009 3300046474 Bacteria 1541
451 Ga0495584_0045248 3300046491 Bacteria 2220
452 Ga0495585_0039507 3300046492 Bacteria 2652
453 Ga0495594_0014519 3300046499 Bacteria 4129
454 Ga0495596_0068695 3300046500 Bacteria 1377
455 Ga0495607_0070044 3300046501 Bacteria 1961
456 Ga0495616_0121646 3300046513 Bacteria 1204
457 Ga0495616_0135421 3300046513 Bacteria 1126
458 Ga0495630_0094582 3300046517 Bacteria 2259
459 Ga0495637_0028030 3300046520 Bacteria 2517
460 Ga0495663_0015948 3300046525 Bacteria 2122
461 Ga0495598_0089171 3300046537 Bacteria 1003
462 Ga0495621_0057250 3300046539 Bacteria 1407
463 Ga0495633_0075409 3300046558 Bacteria 1571
464 Ga0495656_0005188 3300046615 Bacteria 4492
465 Ga0495656_0021113 3300046615 Bacteria 2532
466 Ga0495611_0018526 3300046648 Bacteria 2986
467 Ga0495661_0063313 3300046665 Bacteria 2187
468 Ga0495670_0044141 3300046691 Bacteria 2225
469 Ga0495671_0094168 3300046692 Bacteria 1466
470 Ga0495589_0060452 3300046794 Bacteria 1861
471 Ga0495589_0082299 3300046794 Bacteria 1565
472 Ga0495581_0168235 3300047315 Bacteria 1282
473 Ga0495636_0029986 3300047318 Bacteria 2222
474 Ga0495672_0004033 3300047320 Bacteria 12274
475 Ga0495685_056398 3300047447 Bacteria 1328
476 Ga0496100_0003941 3300048903 Bacteria 7803
477 Ga0496100_0043703 3300048903 Bacteria 2867
478 Ga0496100_0086907 3300048903 Bacteria 2125
479 Ga0496100_0302111 3300048903 Bacteria 1198
480 Ga0496100_0370141 3300048903 Bacteria 1086
481 Ga0496101_0021327 3300048904 Bacteria 4451
482 Ga0496101_0024796 3300048904 Bacteria 4156
483 Ga0496101_0138707 3300048904 Bacteria 1852
484 Ga0496102_0004051 3300048905 Bacteria 12422
485 Ga0496102_0041815 3300048905 Bacteria 4152
486 Ga0496102_0045548 3300048905 Bacteria 3983
487 Ga0496102_0083069 3300048905 Bacteria 2955
488 Ga0496102_0255359 3300048905 Bacteria 1653
489 Ga0496102_0395761 3300048905 Unclassified 1299
490 Ga0496102_0406138 3300048905 Bacteria 1280
491 Ga0496104_0003502 3300048907 Bacteria 13540
492 Ga0496104_0031749 3300048907 Bacteria 4913
493 Ga0496104_0170589 3300048907 Bacteria 2086
494 Ga0496104_0242324 3300048907 Bacteria 1715
495 Ga0496104_0301932 3300048907 Bacteria 1513
496 Ga0496105_0003442 3300048908 Bacteria 11724
497 Ga0496105_0005173 3300048908 Bacteria 9892
498 Ga0496105_0025991 3300048908 Bacteria 4771
499 Ga0496105_0078002 3300048908 Bacteria 2735
500 Ga0496105_0310370 3300048908 Bacteria 1266
501 Ga0496106_0001302 3300048909 Bacteria 18735
502 Ga0496106_0006553 3300048909 Bacteria 8623
503 Ga0496106_0009225 3300048909 Bacteria 7288
504 Ga0496106_0097240 3300048909 Bacteria 2279
505 Ga0496107_0005994 3300048910 Bacteria 8332
506 Ga0496107_0013612 3300048910 Bacteria 5686
507 Ga0496107_0036116 3300048910 Bacteria 3544
508 Ga0496107_0079858 3300048910 Bacteria 2385
509 Ga0496107_0156697 3300048910 Bacteria 1686
510 Ga0496108_0000343 3300048911 Bacteria 39300
511 Ga0496108_0000996 3300048911 Bacteria 22097
512 Ga0496108_0001459 3300048911 Bacteria 18696
513 Ga0496108_0004061 3300048911 Bacteria 11743
514 Ga0496108_0040566 3300048911 Bacteria 3881
515 Ga0496108_0536443 3300048911 Bacteria 1021
516 Ga0496109_0008631 3300048912 Bacteria 8674
517 Ga0496109_0017442 3300048912 Bacteria 6294
518 Ga0496109_0022341 3300048912 Bacteria 5602
519 Ga0496109_0075581 3300048912 Bacteria 3097
520 Ga0496109_0090052 3300048912 Bacteria 2837
521 Ga0496109_0147818 3300048912 Bacteria 2199
522 Ga0496109_0151843 3300048912 Bacteria 2168
523 Ga0496109_0304077 3300048912 Unclassified 1504
524 Ga0496109_0350217 3300048912 Bacteria 1395
525 Ga0496110_0012203 3300048913 Bacteria 7059
526 Ga0496110_0043863 3300048913 Bacteria 3904
527 Ga0496110_0476106 3300048913 Bacteria 1137
528 Ga0496111_0002132 3300048914 Bacteria 11826
529 Ga0496111_0005798 3300048914 Bacteria 7966
530 Ga0496111_0014423 3300048914 Bacteria 5397
531 Ga0496111_0042423 3300048914 Bacteria 3266
532 Ga0496111_0083852 3300048914 Bacteria 2329
533 Ga0496111_0106471 3300048914 Bacteria 2064
534 Ga0496111_0172904 3300048914 Bacteria 1605
535 Ga0496112_0000886 3300048915 Bacteria 21512
536 Ga0496112_0023403 3300048915 Bacteria 5903
537 Ga0496112_0033527 3300048915 Bacteria 4993
538 Ga0496112_0113005 3300048915 Bacteria 2686
539 Ga0496112_0237615 3300048915 Bacteria 1775
540 Ga0496112_0560969 3300048915 Bacteria 1075
541 Ga0496113_0001514 3300048916 Bacteria 13025
542 Ga0496113_0012183 3300048916 Bacteria 5772
543 Ga0496113_0028509 3300048916 Bacteria 4016
544 Ga0496113_0030191 3300048916 Bacteria 3921
545 Ga0496113_0240011 3300048916 Unclassified 1446
546 Ga0496113_0386753 3300048916 Bacteria 1123
547 Ga0496114_0007060 3300048917 Bacteria 8861
548 Ga0496114_0011372 3300048917 Bacteria 7109
549 Ga0496114_0019559 3300048917 Bacteria 5487
550 Ga0496114_0028469 3300048917 Bacteria 4586
551 Ga0496114_0040332 3300048917 Bacteria 3865
552 Ga0496114_0095624 3300048917 Bacteria 2528
553 Ga0496114_0150743 3300048917 Bacteria 2017
554 Ga0496114_0177344 3300048917 Bacteria 1860
555 Ga0496114_0350062 3300048917 Bacteria 1306
556 Ga0496115_0123310 3300048918 Bacteria 2133
557 Ga0501032_0193512 3300049569 Bacteria 1329
558 Ga0501034_0006228 3300049571 Bacteria 12842
559 Ga0501036_0007464 3300049572 Bacteria 8912
560 Ga0501036_0205127 3300049572 Bacteria 1657
561 Ga0501037_0005067 3300049573 Bacteria 9586
562 Ga0501038_0012940 3300049574 Bacteria 7611
563 Ga0501038_0081095 3300049574 Bacteria 2734
564 Ga0501039_0030912 3300049575 Bacteria 4129
565 Ga0501039_0067700 3300049575 Bacteria 2773
566 Ga0501039_0113531 3300049575 Bacteria 2119
567 Ga0501040_0034607 3300049576 Bacteria 3422
568 Ga0501040_0043681 3300049576 Bacteria 3056
569 Ga0501041_0064861 3300049577 Bacteria 2237
570 Ga0501042_0005357 3300049578 Bacteria 8251
571 Ga0501042_0126635 3300049578 Bacteria 1839
572 Ga0501043_0008609 3300049579 Bacteria 8041
573 Ga0501046_0037033 3300049580 Bacteria 3922
574 Ga0501047_0007043 3300049581 Bacteria 10556
575 Ga0501048_0000973 3300049582 Bacteria 21220
576 Ga0501048_0007742 3300049582 Bacteria 8143
577 Ga0501067_0002098 3300049583 Bacteria 10978
578 Ga0501067_0027021 3300049583 Bacteria 3179
579 Ga0501069_0000952 3300049585 Bacteria 13786
580 Ga0501069_0050230 3300049585 Bacteria 2319
581 Ga0501070_0000730 3300049586 Bacteria 30031
582 Ga0501070_0051044 3300049586 Bacteria 3433
583 Ga0501070_0128324 3300049586 Bacteria 2096
584 Ga0501070_0160242 3300049586 Bacteria 1855
585 Ga0501070_0324077 3300049586 Bacteria 1253
586 Ga0501071_0043166 3300049587 Bacteria 3232
587 Ga0501071_0234859 3300049587 Bacteria 1382
588 Ga0501072_0134239 3300049588 Bacteria 1973
589 Ga0501072_0169203 3300049588 Bacteria 1744
590 Ga0501073_0011797 3300049589 Bacteria 6379
591 Ga0501073_0240117 3300049589 Bacteria 1251
592 Ga0501074_0000620 3300049590 Bacteria 22112
593 Ga0501074_0044051 3300049590 Bacteria 3231
594 Ga0501074_0138667 3300049590 Bacteria 1740
595 Ga0501074_0213348 3300049590 Bacteria 1375
596 Ga0501074_0271837 3300049590 Bacteria 1205
597 Ga0501075_0017442 3300049591 Bacteria 5187
598 Ga0501075_0133287 3300049591 Bacteria 1893
599 Ga0501076_0014733 3300049592 Bacteria 5894
600 Ga0501076_0041834 3300049592 Bacteria 3607
601 Ga0501076_0169418 3300049592 Bacteria 1780
602 Ga0501077_0046778 3300049593 Bacteria 2749
603 Ga0501077_0070313 3300049593 Bacteria 2218
604 Ga0501077_0310412 3300049593 Bacteria 1005
605 Ga0501079_0151215 3300049741 Bacteria 1810
606 Ga0501035_0030660 3300049822 Bacteria 4902
607 Ga0501045_0066622 3300049824 Bacteria 2644
608 Ga0501045_0335782 3300049824 Bacteria 1125
609 nmdc:mga03683_111319_c1 3300050489 Bacteria 1211
610 nmdc:mga03683_149090_c1 3300050489 Bacteria 1055
611 nmdc:mga03n38_16734_c1 3300050490 Bacteria 2859
612 nmdc:mga00v17_136514_c1 3300050491 Bacteria 1571
613 nmdc:mga00v17_137894_c1 3300050491 Bacteria 1563
614 nmdc:mga00v17_26837_c1 3300050491 Bacteria 3359
615 nmdc:mga00v17_40173_c1 3300050491 Bacteria 2806
616 nmdc:mga00v17_55728_c1 3300050491 Bacteria 2415
617 nmdc:mga0yw44_138019_c1 3300050492 Bacteria 1583
618 nmdc:mga0yw44_29693_c1 3300050492 Bacteria 3159
619 nmdc:mga0yw44_3355_c1 3300050492 Bacteria 7098
620 nmdc:mga0yw44_479452_c1 3300050492 Bacteria 844
621 nmdc:mga0yw44_7135_c1 3300050492 Bacteria 5472
622 nmdc:mga0yw44_77146_c1 3300050492 Bacteria 2081
623 nmdc:mga0yw44_92733_c1 3300050492 Bacteria 1912
624 nmdc:mga0k408_189958_c1 3300050493 Bacteria 1225
625 nmdc:mga06z11_135356_c1 3300050494 Bacteria 1388
626 nmdc:mga06z11_54334_c1 3300050494 Bacteria 2064
627 nmdc:mga06z11_85314_c1 3300050494 Bacteria 1703
628 nmdc:mga06z11_91144_c1 3300050494 Bacteria 1655
629 nmdc:mga07m45_16382_c1 3300050496 Bacteria 3969
630 nmdc:mga07m45_18953_c1 3300050496 Bacteria 3724
631 nmdc:mga07m45_82522_c1 3300050496 Bacteria 1836
632 nmdc:mga05p37_126130_c1 3300050507 Bacteria 3143
633 nmdc:mga05p37_294352_c1 3300050507 Bacteria 1931
634 nmdc:mga05p37_36027_c1 3300050507 Bacteria 6071
635 nmdc:mga05p37_520953_c1 3300050507 Bacteria 1360
636 nmdc:mga09592_102883_c1 3300050508 Bacteria 2447
637 nmdc:mga09592_11966_c1 3300050508 Bacteria 7058
638 nmdc:mga0qj67_26341_c1 3300050509 Bacteria 4501
639 nmdc:mga0qj67_341163_c1 3300050509 Bacteria 1212
640 nmdc:mga06r32_4332_c1 3300050510 Bacteria 12706
641 nmdc:mga06r32_556321_c1 3300050510 Bacteria 1121
642 nmdc:mga06r32_574960_c1 3300050510 Bacteria 1099
643 nmdc:mga06r32_727691_c1 3300050510 Bacteria 956
644 nmdc:mga06r32_907_c1 3300050510 Bacteria 26417
645 nmdc:mga08y16_19899_c1 3300050511 Bacteria 7080
646 nmdc:mga08y16_65779_c1 3300050511 Bacteria 3784
647 nmdc:mga08y16_76756_c1 3300050511 Bacteria 3483
648 nmdc:mga0n895_10411_c1 3300050512 Bacteria 8212
649 nmdc:mga0n895_47538_c1 3300050512 Bacteria 4195
650 nmdc:mga08x19_135541_c1 3300050514 Bacteria 1659
651 nmdc:mga08x19_261359_c1 3300050514 Bacteria 1197
652 nmdc:mga0a205_31401_c1 3300050515 Bacteria 5088
653 nmdc:mga0a205_58720_c1 3300050515 Bacteria 3716
654 nmdc:mga0sz30_6672_c1 3300050516 Bacteria 4300
655 Ga0495655_0003785 3300053083 Bacteria 2530
656 Ga0495619_0008871 3300053085 Bacteria 6356
657 Ga0500644_0000090 3300053088 Bacteria 56710
658 Ga0500556_0106594 3300053104 Bacteria 1084
659 Ga0500616_0014387 3300053153 Bacteria 4547
660 Ga0501084_0026872 3300054114 Bacteria 4808
661 Ga0501084_0090625 3300054114 Bacteria 2567
662 Ga0501082_0025248 3300060353 Bacteria 5120
663 Ga0466962_0009384 3300061719 Bacteria 4690
664 Ga0530510_0043046 3300061734 Bacteria 3261
665 Ga0530510_0048500 3300061734 Bacteria 3070
666 Ga0530510_0064905 3300061734 Bacteria 2645
667 Ga0530510_0206564 3300061734 Bacteria 1459
668 Ga0530510_0297615 3300061734 Bacteria 1207
669 Ga0530510_0468966 3300061734 Bacteria 953
670 2559425956 2558860280 Bacteria 11429938
671 2623587338 2622736626 Bacteria 7181580
672 2644089777 2643221615 Bacteria 5487866
673 2644319622 2643221657 Bacteria 5490246
674 2753268881 2751185782 Bacteria 11227053
675 2902587876 2902582711 Bacteria 6187705
676 2917740515 2917736166 Bacteria 9690793
677 2996226491 2996221748 Bacteria 6799777
678 8053947185 8053945823 Bacteria 8962862
679 Ga0307407_10274055
680 LJQas_1002434
681 JGI24751J29686_10004243
682 Ga0070658_10065628
683 Ga0070676_10021068
684 Ga0070676_10036389
685 Ga0070683_100064097
686 Ga0070683_100164202
687 Ga0070683_100429970
688 Ga0070690_100005532
689 Ga0070670_100019163
690 Ga0068869_100018671
691 Ga0070666_10013334
692 Ga0070680_100063795
693 Ga0070682_100057933
694 Ga0068868_100003930
695 Ga0068868_100007923
696 Ga0068868_100051739
697 Ga0068868_100096907
698 Ga0068868_100106629
699 Ga0068868_100197183
700 Ga0068868_100338476
701 Ga0070660_100051368
702 Ga0070689_100018679
703 Ga0070689_100036289
704 Ga0070689_100339580
705 Ga0070691_10001538
706 Ga0070691_10021319
707 Ga0070687_100071630
708 Ga0070692_10006877
709 Ga0070692_10100436
710 Ga0070668_100003460
711 Ga0070668_100182781
712 Ga0070668_100228552
713 Ga0070675_100316758
714 Ga0070671_100037911
715 Ga0070671_100051390
716 Ga0070674_100086744
717 Ga0070674_100123075
718 Ga0070674_100274906
719 Ga0070673_100105013
720 Ga0070673_100368787
721 Ga0070688_100225661
722 Ga0070688_100479097
723 Ga0070659_100033853
724 Ga0070659_100062698
725 Ga0070667_100490145
726 Ga0070714_100025924
727 Ga0070713_100003753
728 Ga0070701_10016722
729 Ga0070705_100021187
730 Ga0070705_100119167
731 Ga0070705_100123500
732 Ga0070700_100168072
733 Ga0070694_100248624
734 Ga0070663_100002020
735 Ga0070663_100010278
736 Ga0070678_100022800
737 Ga0070678_100316281
738 Ga0070662_100007677
739 Ga0070662_100136432
740 Ga0070681_10035257
741 Ga0068867_100001167
742 Ga0070685_10117074
743 Ga0070706_100156215
744 Ga0070707_100070989
745 Ga0070698_100001085
746 Ga0070698_100019165
747 Ga0070698_100252529
748 Ga0070699_100203607
749 Ga0070684_100021842
750 Ga0070684_100026608
751 Ga0070684_100557422
752 Ga0070697_100190224
753 Ga0068853_100252251
754 Ga0070686_100010954
755 Ga0070686_100034332
756 Ga0070695_100082640
757 Ga0070696_100012733
758 Ga0070696_100103945
759 Ga0070696_100154679
760 Ga0070665_100134065
761 Ga0070665_100476023
762 Ga0070704_100041860
763 Ga0070704_100219556
764 Ga0068855_100046262
765 Ga0068855_100229606
766 Ga0068855_100422517
767 Ga0068855_100426121
768 Ga0070664_100037100
769 Ga0068857_100288327
770 Ga0068854_100033288
771 Ga0068854_100109920
772 Ga0068854_100242942
773 Ga0068856_100079472
774 Ga0068856_100195529
775 Ga0070702_100100048
776 Ga0068852_100030291
777 Ga0068852_100039008
778 Ga0068864_100082387
779 Ga0068864_100194781
780 Ga0068864_100314251
781 Ga0068866_10021563
782 Ga0068861_100067244
783 Ga0068861_100123814
784 Ga0068861_100147802
785 Ga0068851_10019739
786 Ga0068870_10035440
787 Ga0068863_100009789
788 Ga0068863_100018636
789 Ga0068863_100041764
790 Ga0068863_100267334
791 Ga0068863_100514077
792 Ga0068858_100073576
793 Ga0068858_100212087
794 Ga0068860_100026646
795 Ga0068860_100030588
796 Ga0068860_100053843
797 Ga0068862_100063231
798 Ga0081455_10003611
799 Ga0081455_10025145
800 Ga0081455_10038418
801 Ga0081538_10075614
802 Ga0081540_1012872
803 Ga0081540_1016724
804 Ga0081540_1063298
805 Ga0081539_10001405
806 Ga0081539_10009012
807 Ga0081539_10011886
808 Ga0070717_10044621
809 Ga0075365_10003573
810 Ga0075365_10050839
811 Ga0075365_10117490
812 Ga0075365_10120784
813 Ga0075365_10150907
814 Ga0075363_100001228
815 Ga0075363_100111591
816 Ga0075364_10007483
817 Ga0075364_10100229
818 Ga0075364_10129013
819 Ga0075364_10337751
820 Ga0075432_10030525
821 Ga0075362_10005215
822 Ga0075362_10059067
823 Ga0075362_10116848
824 Ga0075367_10025230
825 Ga0075367_10051347
826 Ga0075367_10213671
827 Ga0075366_10058694
828 Ga0075370_10034045
829 Ga0075370_10077574
830 Ga0075370_10109066
831 Ga0068871_100114290
832 Ga0068871_100114414
833 Ga0068871_100128346
834 Ga0075428_100052542
835 Ga0075428_100080554
836 Ga0075430_100247716
837 Ga0075431_100000676
838 Ga0075431_100033118
839 Ga0075431_100125811
840 Ga0075431_100287615
841 Ga0075433_10070532
842 Ga0075434_100001921
843 Ga0075434_100049120
844 Ga0075429_100002702
845 Ga0075429_100286346
846 Ga0068865_100053131
847 Ga0068865_100076556
848 Ga0075436_100000663
849 Ga0075435_100002027
850 Ga0105240_10526148
851 Ga0111539_10022261
852 Ga0111539_10103122
853 Ga0111539_10168091
854 Ga0105245_10017702
855 Ga0105245_10221768
856 Ga0105245_10285659
857 Ga0114129_10170060
858 Ga0114129_10227875
859 Ga0105243_10010116
860 Ga0105243_10085613
861 Ga0105243_10164247
862 Ga0105243_10212016
863 Ga0105243_10266094
864 Ga0105243_10517557
865 Ga0105241_10028260
866 Ga0105242_10059867
867 Ga0105242_10127408
868 Ga0105248_10025546
869 Ga0105248_10031432
870 Ga0105248_10116774
871 Ga0105248_10154291
872 Ga0105248_10195647
873 Ga0105237_10054318
874 Ga0105237_10436164
875 Ga0105237_10768228
876 Ga0105238_10056206
877 Ga0105238_10181967
878 Ga0105238_10228852
879 Ga0105249_10071356
880 Ga0105249_10102728
881 Ga0105249_10192783
882 Ga0105249_10252993
883 Ga0105249_10367840
884 Ga0105239_10032152
885 Ga0105239_10092943
886 Ga0105239_10171522
887 Ga0105239_10459591
888 Ga0105246_10008187
889 Ga0157371_10176500
890 Ga0157370_10031765
891 Ga0157369_10075291
892 Ga0157374_10010504
893 Ga0157374_10279034
894 Ga0157378_10007665
895 Ga0163162_10008544
896 Ga0163162_10074333
897 Ga0163162_10718608
898 Ga0157372_10058270
899 Ga0157372_10145615
900 Ga0157372_10332913
901 Ga0157375_10017673
902 Ga0157375_10185620
903 Ga0157375_10210860
904 Ga0157375_10464673
905 Ga0157375_10792477
906 Ga0163163_10060007
907 Ga0163163_10065583
908 Ga0163163_10174065
909 Ga0157380_10119787
910 Ga0157380_10247065
911 Ga0182008_10039488
912 Ga0157377_10005400
913 Ga0157377_10009619
914 Ga0157379_10056354
915 Ga0157379_10114027
916 Ga0157379_10240244
917 Ga0157379_10297725
918 Ga0157379_10452663
919 Ga0157376_10237808
920 Ga0157376_10438211
921 Ga0163161_10044339
922 Ga0207656_10004547
923 Ga0207688_10005360
924 Ga0207688_10018631
925 Ga0207680_10206000
926 Ga0207699_10066241
927 Ga0207645_10029478
928 Ga0207645_10042479
929 Ga0207645_10111585
930 Ga0207643_10000117
931 Ga0207705_10019086
932 Ga0207654_10014770
933 Ga0207707_10213441
934 Ga0207695_10137665
935 Ga0207693_10033341
936 Ga0207660_10243717
937 Ga0207662_10052216
938 Ga0207657_10030915
939 Ga0207652_10048958
940 Ga0207694_10146703
941 Ga0207650_10000493
942 Ga0207659_10023592
943 Ga0207659_10041269
944 Ga0207659_10103230
945 Ga0207687_10018266
946 Ga0207687_10048371
947 Ga0207687_10048752
948 Ga0207700_10024192
949 Ga0207700_10279956
950 Ga0207664_10221539
951 Ga0207644_10024057
952 Ga0207644_10030397
953 Ga0207690_10029835
954 Ga0207690_10239279
955 Ga0207706_10003126
956 Ga0207706_10009698
957 Ga0207706_10072389
958 Ga0207706_10137202
959 Ga0207706_10287047
960 Ga0207686_10077183
961 Ga0207709_10009069
962 Ga0207709_10063853
963 Ga0207709_10067848
964 Ga0207709_10143913
965 Ga0207709_10299897
966 Ga0207670_10019642
967 Ga0207669_10016656
968 Ga0207665_10025133
969 Ga0207691_10032484
970 Ga0207711_10112825
971 Ga0207711_10197339
972 Ga0207689_10009422
973 Ga0207689_10193688
974 Ga0207661_10021598
975 Ga0207661_10518664
976 Ga0207679_10002230
977 Ga0207679_10008645
978 Ga0207667_10082423
979 Ga0207667_10375243
980 Ga0207667_10506536
981 Ga0207712_10081619
982 Ga0207712_10134629
983 Ga0207712_10241055
984 Ga0207668_10001892
985 Ga0207668_10046396
986 Ga0207668_10071674
987 Ga0207668_10191064
988 Ga0207668_10251689
989 Ga0207640_10101431
990 Ga0207640_10179125
991 Ga0207658_10164721
992 Ga0207677_10005764
993 Ga0207677_10072877
994 Ga0207677_10145613
995 Ga0207677_10253965
996 Ga0207703_10087530
997 Ga0207703_10120589
998 Ga0207678_10000391
999 Ga0207678_10209134
1000 Ga0207708_10017312
1001 Ga0207708_10021321
1002 Ga0207708_10047309
1003 Ga0207708_10096740
1004 Ga0207708_10151342
1005 Ga0207708_10205977
1006 Ga0207702_10002078
1007 Ga0207702_10084488
1008 Ga0207702_10115268
1009 Ga0207702_10419071
1010 Ga0207702_10618807
1011 Ga0207641_10011671
1012 Ga0207641_10017730
1013 Ga0207641_10029839
1014 Ga0207648_10002699
1015 Ga0207648_10034388
1016 Ga0207648_10060948
1017 Ga0207676_10001839
1018 Ga0207676_10076495
1019 Ga0207676_10080092
1020 Ga0207676_10361718
1021 Ga0207674_10030133
1022 Ga0207674_10055380
1023 Ga0207674_10356367
1024 Ga0207675_100000686
1025 Ga0207675_100061350
1026 Ga0207675_100066810
1027 Ga0207675_100110177
1028 Ga0207675_100258016
1029 Ga0207683_10044178
1030 Ga0207698_10048649
1031 Ga0207698_10133262
1032 Ga0207698_10212024
1033 Ga0209813_10042107
1034 Ga0207428_10022628
1035 Ga0268266_10124063
1036 Ga0268266_10255450
1037 Ga0268266_10374409
1038 Ga0268265_10015214
1039 Ga0268265_10233863
1040 Ga0268264_10030952
1041 Ga0268264_10138905
1042 Ga0307515_10126220
1043 Ga0307511_10001274
1044 Ga0307513_10025522
1045 Ga0307509_10019348
1046 Ga0307408_100059051
1047 Ga0307508_10001935
1048 Ga0316576_10307938
1049 Ga0307413_10191722
1050 Ga0307413_10283746
1051 Ga0307518_10000241
1052 Ga0307410_10056268
1053 Ga0326468_10000083
1054 Ga0307406_10039433
1055 Ga0307406_10123415
1056 Ga0307406_10191399
1057 Ga0307406_10217854
1058 Ga0307406_10218021
1059 Ga0307407_10026838
1060 Ga0307407_10042103
1061 Ga0307407_10079625
1062 Ga0307409_100001479
1063 Ga0307409_100047500
1064 Ga0307416_100010065
1065 Ga0307416_100029855
1066 Ga0307416_100076442
1067 Ga0307416_100250724
1068 Ga0307416_100427702
1069 Ga0307416_100436073
1070 Ga0307411_10280456
1071 Ga0307415_100000049
1072 Ga0307415_100057980
1073 Ga0307415_100076829
1074 Ga0307507_10056762
1075 Ga0316574_0094024
1076 Ga0373931_0181162
1077 Ga0373935_0018731
1078 Ga0373935_0166156
1079 Ga0373947_0168992
1080 Ga0395899_0007240
1081 Ga0395899_0017405
1082 Ga0395899_0030723
1083 Ga0395900_0022618
1084 Ga0395900_0144622
1085 Ga0395900_0196035
1086 Ga0395900_0209837
1087 Ga0395898_0014756
1088 Ga0395898_0163142
1089 Ga0395898_0827038
1090 Ga0395905_0046823
1091 Ga0395905_0312292
1092 Ga0395901_0026456
1093 Ga0395901_0271572
1094 Ga0439463_011559
1095 Ga0439463_033195
1096 Ga0450902_003876
1097 Ga0451577_0002607
1098 Ga0466969_0040154
1099 Ga0466972_0096218
1100 Ga0453683_0122589
1101 Ga0466965_0013666
1102 Ga0466966_0001252
1103 Ga0466961_0018128
1104 Ga0466961_0052418
1105 Ga0466963_0016775
1106 Ga0466963_0028854
1107 Ga0466963_0208105
1108 Ga0466964_0002836
1109 Ga0453684_0003257
1110 Ga0466970_0008269
1111 Ga0466970_0083549
1112 Ga0466970_0095488
1113 Ga0466970_0258849
1114 Ga0466957_0029745
1115 Ga0466960_0004512
1116 Ga0466960_0009790
1117 Ga0466960_0015885
1118 Ga0466960_0273099
1119 Ga0466960_0325747
1120 Ga0466959_0002606
1121 Ga0451576_0039926
1122 Ga0466958_0122084
1123 Ga0466967_0017731
1124 Ga0466967_0096872
1125 Ga0466967_0482288
1126 Ga0495638_0105041
1127 Ga0495582_0033736
1128 Ga0495605_0079009
1129 Ga0495584_0045248
1130 Ga0495585_0039507
1131 Ga0495594_0014519
1132 Ga0495596_0068695
1133 Ga0495607_0070044
1134 Ga0495616_0121646
1135 Ga0495616_0135421
1136 Ga0495630_0094582
1137 Ga0495637_0028030
1138 Ga0495663_0015948
1139 Ga0495598_0089171
1140 Ga0495621_0057250
1141 Ga0495633_0075409
1142 Ga0495656_0005188
1143 Ga0495656_0021113
1144 Ga0495611_0018526
1145 Ga0495661_0063313
1146 Ga0495670_0044141
1147 Ga0495671_0094168
1148 Ga0495589_0060452
1149 Ga0495589_0082299
1150 Ga0495581_0168235
1151 Ga0495636_0029986
1152 Ga0495672_0004033
1153 Ga0495685_056398
1154 Ga0496100_0003941
1155 Ga0496100_0043703
1156 Ga0496100_0086907
1157 Ga0496100_0302111
1158 Ga0496100_0370141
1159 Ga0496101_0021327
1160 Ga0496101_0024796
1161 Ga0496101_0138707
1162 Ga0496102_0004051
1163 Ga0496102_0041815
1164 Ga0496102_0045548
1165 Ga0496102_0083069
1166 Ga0496102_0255359
1167 Ga0496102_0395761
1168 Ga0496102_0406138
1169 Ga0496104_0003502
1170 Ga0496104_0031749
1171 Ga0496104_0170589
1172 Ga0496104_0242324
1173 Ga0496104_0301932
1174 Ga0496105_0003442
1175 Ga0496105_0005173
1176 Ga0496105_0025991
1177 Ga0496105_0078002
1178 Ga0496105_0310370
1179 Ga0496106_0001302
1180 Ga0496106_0006553
1181 Ga0496106_0009225
1182 Ga0496106_0097240
1183 Ga0496107_0005994
1184 Ga0496107_0013612
1185 Ga0496107_0036116
1186 Ga0496107_0079858
1187 Ga0496107_0156697
1188 Ga0496108_0000343
1189 Ga0496108_0000996
1190 Ga0496108_0001459
1191 Ga0496108_0004061
1192 Ga0496108_0040566
1193 Ga0496108_0536443
1194 Ga0496109_0008631
1195 Ga0496109_0017442
1196 Ga0496109_0022341
1197 Ga0496109_0075581
1198 Ga0496109_0090052
1199 Ga0496109_0147818
1200 Ga0496109_0151843
1201 Ga0496109_0304077
1202 Ga0496109_0350217
1203 Ga0496110_0012203
1204 Ga0496110_0043863
1205 Ga0496110_0476106
1206 Ga0496111_0002132
1207 Ga0496111_0005798
1208 Ga0496111_0014423
1209 Ga0496111_0042423
1210 Ga0496111_0083852
1211 Ga0496111_0106471
1212 Ga0496111_0172904
1213 Ga0496112_0000886
1214 Ga0496112_0023403
1215 Ga0496112_0033527
1216 Ga0496112_0113005
1217 Ga0496112_0237615
1218 Ga0496112_0560969
1219 Ga0496113_0001514
1220 Ga0496113_0012183
1221 Ga0496113_0028509
1222 Ga0496113_0030191
1223 Ga0496113_0240011
1224 Ga0496113_0386753
1225 Ga0496114_0007060
1226 Ga0496114_0011372
1227 Ga0496114_0019559
1228 Ga0496114_0028469
1229 Ga0496114_0040332
1230 Ga0496114_0095624
1231 Ga0496114_0150743
1232 Ga0496114_0177344
1233 Ga0496114_0350062
1234 Ga0496115_0123310
1235 Ga0501032_0193512
1236 Ga0501034_0006228
1237 Ga0501036_0007464
1238 Ga0501036_0205127
1239 Ga0501037_0005067
1240 Ga0501038_0012940
1241 Ga0501038_0081095
1242 Ga0501039_0030912
1243 Ga0501039_0067700
1244 Ga0501039_0113531
1245 Ga0501040_0034607
1246 Ga0501040_0043681
1247 Ga0501041_0064861
1248 Ga0501042_0005357
1249 Ga0501042_0126635
1250 Ga0501043_0008609
1251 Ga0501046_0037033
1252 Ga0501047_0007043
1253 Ga0501048_0000973
1254 Ga0501048_0007742
1255 Ga0501067_0002098
1256 Ga0501067_0027021
1257 Ga0501069_0000952
1258 Ga0501069_0050230
1259 Ga0501070_0000730
1260 Ga0501070_0051044
1261 Ga0501070_0128324
1262 Ga0501070_0160242
1263 Ga0501070_0324077
1264 Ga0501071_0043166
1265 Ga0501071_0234859
1266 Ga0501072_0134239
1267 Ga0501072_0169203
1268 Ga0501073_0011797
1269 Ga0501073_0240117
1270 Ga0501074_0000620
1271 Ga0501074_0044051
1272 Ga0501074_0138667
1273 Ga0501074_0213348
1274 Ga0501074_0271837
1275 Ga0501075_0017442
1276 Ga0501075_0133287
1277 Ga0501076_0014733
1278 Ga0501076_0041834
1279 Ga0501076_0169418
1280 Ga0501077_0046778
1281 Ga0501077_0070313
1282 Ga0501077_0310412
1283 Ga0501079_0151215
1284 Ga0501035_0030660
1285 Ga0501045_0066622
1286 Ga0501045_0335782
1287 nmdc:mga03683_111319_c1
1288 nmdc:mga03683_149090_c1
1289 nmdc:mga03n38_16734_c1
1290 nmdc:mga00v17_136514_c1
1291 nmdc:mga00v17_137894_c1
1292 nmdc:mga00v17_26837_c1
1293 nmdc:mga00v17_40173_c1
1294 nmdc:mga00v17_55728_c1
1295 nmdc:mga0yw44_138019_c1
1296 nmdc:mga0yw44_29693_c1
1297 nmdc:mga0yw44_3355_c1
1298 nmdc:mga0yw44_479452_c1
1299 nmdc:mga0yw44_7135_c1
1300 nmdc:mga0yw44_77146_c1
1301 nmdc:mga0yw44_92733_c1
1302 nmdc:mga0k408_189958_c1
1303 nmdc:mga06z11_135356_c1
1304 nmdc:mga06z11_54334_c1
1305 nmdc:mga06z11_85314_c1
1306 nmdc:mga06z11_91144_c1
1307 nmdc:mga07m45_16382_c1
1308 nmdc:mga07m45_18953_c1
1309 nmdc:mga07m45_82522_c1
1310 nmdc:mga05p37_126130_c1
1311 nmdc:mga05p37_294352_c1
1312 nmdc:mga05p37_36027_c1
1313 nmdc:mga05p37_520953_c1
1314 nmdc:mga09592_102883_c1
1315 nmdc:mga09592_11966_c1
1316 nmdc:mga0qj67_26341_c1
1317 nmdc:mga0qj67_341163_c1
1318 nmdc:mga06r32_4332_c1
1319 nmdc:mga06r32_556321_c1
1320 nmdc:mga06r32_574960_c1
1321 nmdc:mga06r32_727691_c1
1322 nmdc:mga06r32_907_c1
1323 nmdc:mga08y16_19899_c1
1324 nmdc:mga08y16_65779_c1
1325 nmdc:mga08y16_76756_c1
1326 nmdc:mga0n895_10411_c1
1327 nmdc:mga0n895_47538_c1
1328 nmdc:mga08x19_135541_c1
1329 nmdc:mga08x19_261359_c1
1330 nmdc:mga0a205_31401_c1
1331 nmdc:mga0a205_58720_c1
1332 nmdc:mga0sz30_6672_c1
1333 Ga0495655_0003785
1334 Ga0495619_0008871
1335 Ga0500644_0000090
1336 Ga0500556_0106594
1337 Ga0500616_0014387
1338 Ga0501084_0026872
1339 Ga0501084_0090625
1340 Ga0501082_0025248
1341 Ga0466962_0009384
1342 Ga0530510_0043046
1343 Ga0530510_0048500
1344 Ga0530510_0064905
1345 Ga0530510_0206564
1346 Ga0530510_0297615
1347 Ga0530510_0468966
1348 2559425956
1349 2623587338
1350 2644089777
1351 2644319622
1352 2753268881
1353 2902587876
1354 2917740515
1355 2996226491
1356 8053947185

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

120

312

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
2onk-assembly2.cif.gz_I abc transporter modbc in complex with its binding protein moda 0.8724 11 277
7cad-assembly1.cif.gz_A mycobacterium smegmatis sugabc complex 0.8599 7 271
2onk-assembly2.cif.gz_I abc transporter modbc in complex with its binding protein moda 0.8565 11 277
3d31-assembly1.cif.gz_C modbc from methanosarcina acetivorans 0.8562 13 273
3d31-assembly1.cif.gz_C modbc from methanosarcina acetivorans 0.8436 13 273
ID Description Score Start End Superfamily
af_P77156_29_305_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9415 14 272 1.10.3720.10
af_P0AFK4_1_269_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9173 17 280 1.10.3720.10
af_Q2G2B0_2_264_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.911 15 271 1.10.3720.10
af_P0AFK4_1_269_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8978 17 280 1.10.3720.10
af_I6XFF3_60_302_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8926 53 283 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A4T0URA4-F1-model_v4 ABC transporter permease 0.9866 22 283 GO:0005886
GO:0055085
AF-A0A4T0URA4-F1-model_v4 ABC transporter permease 0.9792 22 283 GO:0005886
GO:0055085
AF-A0A7Y9JBH3-F1-model_v4 Putative spermidine/putrescine transport system permease protein 0.9785 8 283 GO:0005886
GO:0055085
AF-A0A286G6K8-F1-model_v4 Putative spermidine/putrescine transport system permease protein 0.9784 30 283 GO:0005886
GO:0055085
AF-X5LIP7-F1-model_v4 deleted 0.9772 12 283

Map