F474637

General Info

Members Datasets Scaffolds Average Seq Length
678 327 1356 239

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10020536|Ga0081455_100205366
Length 268
Sequence MRRTIFPMESNAFYYFMDRMAMNKIVSDEEWAKARKSLLKKEKEFTTLRDQLSQQQRDLPWVSVNKEYVFEGKNGKQTLSELFDGRSQLIVYHFMFDPSWNAGCPSCSFWADNFNGIIVHLNRRDVTMVAVSHAPYSKLAAYQKRMGWNFKWLSSYDTDFNFDYHVSFTQDQITNKEDSYNYTDRAWMSEREGMSVFYKDTNGHVFHTYSAYARGIDMLNAAYNYLDLVPKGRDEAGHAFPQFWVRRHDEYGDPRRIDTEYYDVTKNL

Samples

Sample ID Description Type Environment
1 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
104 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
106 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
107 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
108 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
109 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
146 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
148 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
149 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
150 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
151 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
152 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
153 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
154 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
155 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
156 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
157 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
158 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
159 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
160 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
161 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
162 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
163 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
164 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
165 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
166 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
167 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
168 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
169 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
170 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
171 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
172 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
173 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
174 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
175 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
176 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
177 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
178 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
179 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
180 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
181 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
182 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
183 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
184 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
185 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
186 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
187 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
188 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
189 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
190 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
191 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
192 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
193 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
194 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
195 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
196 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
197 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
198 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
199 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
200 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
201 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
202 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
203 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
204 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
205 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
206 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
207 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
208 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
209 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
210 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
211 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
212 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
213 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
214 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
215 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
216 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
217 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
218 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
219 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
220 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
221 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
222 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
223 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
224 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
225 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
226 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
227 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
228 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
229 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
230 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
231 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
232 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
233 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
234 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
235 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
236 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
237 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
238 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
239 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
240 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
241 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
242 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
243 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
244 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
245 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
246 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
247 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
248 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
249 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
250 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
251 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
252 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
253 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
254 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
255 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
256 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
257 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
258 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
259 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
260 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
261 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
262 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
263 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
264 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
265 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
266 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
267 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
268 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
269 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
270 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
276 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
282 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
283 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
284 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
285 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
286 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
287 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
288 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
289 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
290 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
291 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
292 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
293 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
294 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
295 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
296 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
297 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
298 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
299 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
300 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
301 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
302 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
303 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
304 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
305 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
306 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
307 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
309 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
310 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
311 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
312 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
313 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
314 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
315 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
316 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
317 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
318 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
319 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
320 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
321 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
322 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
323 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
324 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
325 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
326 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
327 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.53
Metatranscriptomes 1.47
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.9
Rhizosphere 93.51
Stem 0
Stem Tuber 0
Unclassified 6.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10020536 3300005937 Archaea 6215
2 MBSR1b_contig_11073137 2162886012 Unclassified 2240
3 JGI24743J22301_10014784 3300001991 Unclassified 1441
4 JGI25405J52794_10017387 3300003911 Archaea 1427
5 Ga0065704_10077848 3300005289 Archaea 4594
6 Ga0065712_10032451 3300005290 Bacteria 1485
7 Ga0065715_10097426 3300005293 Unclassified 3675
8 Ga0065707_10454408 3300005295 Bacteria 797
9 Ga0070658_10166406 3300005327 Bacteria 1851
10 Ga0070683_100065833 3300005329 Bacteria 3375
11 Ga0070683_100157077 3300005329 Unclassified 2157
12 Ga0070683_100517954 3300005329 Bacteria 1140
13 Ga0070690_100083096 3300005330 Bacteria 2098
14 Ga0070670_100022660 3300005331 Bacteria 5404
15 Ga0070666_10184275 3300005335 Bacteria 1465
16 Ga0068868_100053603 3300005338 Bacteria 3177
17 Ga0068868_100257178 3300005338 Archaea 1471
18 Ga0070669_100118237 3300005353 Bacteria 2018
19 Ga0070675_100115751 3300005354 Unclassified 2273
20 Ga0070671_100200302 3300005355 Bacteria 1693
21 Ga0070673_100673128 3300005364 Bacteria 949
22 Ga0070688_100028336 3300005365 Bacteria 3342
23 Ga0070688_100071342 3300005365 Bacteria 2223
24 Ga0070659_100095132 3300005366 Bacteria 2393
25 Ga0070667_100583132 3300005367 Bacteria 1029
26 Ga0070709_10002045 3300005434 Archaea 10950
27 Ga0070714_100067281 3300005435 Bacteria 3088
28 Ga0070714_100148134 3300005435 Unclassified 2113
29 Ga0070713_100069776 3300005436 Archaea 2965
30 Ga0070713_100111232 3300005436 Archaea 2388
31 Ga0070710_10144887 3300005437 Bacteria 1460
32 Ga0070711_100002189 3300005439 Archaea 11089
33 Ga0070711_100026501 3300005439 Archaea 3798
34 Ga0070711_100045818 3300005439 Archaea 2977
35 Ga0070711_100105988 3300005439 Bacteria 2054
36 Ga0070700_100039617 3300005441 Bacteria 2879
37 Ga0070694_100029576 3300005444 Bacteria 3576
38 Ga0070708_100014377 3300005445 Bacteria 6511
39 Ga0070708_100045837 3300005445 Bacteria 3855
40 Ga0070708_100091090 3300005445 Bacteria 2776
41 Ga0070708_100234876 3300005445 Bacteria 1721
42 Ga0070708_100295025 3300005445 Bacteria 1526
43 Ga0070708_100542015 3300005445 Archaea 1098
44 Ga0070662_100030067 3300005457 Bacteria 3797
45 Ga0070681_10543759 3300005458 Bacteria 1075
46 Ga0070706_100000541 3300005467 Bacteria 43892
47 Ga0070706_100013447 3300005467 Bacteria 7567
48 Ga0070706_100021256 3300005467 Bacteria 5977
49 Ga0070706_100044535 3300005467 Bacteria 4099
50 Ga0070706_100172669 3300005467 Bacteria 2018
51 Ga0070706_100446205 3300005467 Bacteria 1204
52 Ga0070707_100013210 3300005468 Bacteria 7720
53 Ga0070707_100029672 3300005468 Bacteria 5206
54 Ga0070707_100056567 3300005468 Bacteria 3762
55 Ga0070707_100444173 3300005468 Bacteria 1257
56 Ga0070698_100007827 3300005471 Bacteria 11568
57 Ga0070698_100097574 3300005471 Bacteria 2914
58 Ga0070698_100211761 3300005471 Bacteria 1872
59 Ga0070698_100220715 3300005471 Bacteria 1829
60 Ga0070698_100513406 3300005471 Bacteria 1137
61 Ga0070699_100026721 3300005518 Bacteria 4979
62 Ga0070699_100040935 3300005518 Bacteria 4011
63 Ga0070699_100049873 3300005518 Bacteria 3623
64 Ga0070699_100090655 3300005518 Bacteria 2672
65 Ga0070699_100102371 3300005518 Bacteria 2511
66 Ga0070699_100689727 3300005518 Archaea 933
67 Ga0070684_100075401 3300005535 Bacteria 2975
68 Ga0070684_100287536 3300005535 Bacteria 1507
69 Ga0070697_100125666 3300005536 Bacteria 2148
70 Ga0070697_100166065 3300005536 Bacteria 1866
71 Ga0070697_100187988 3300005536 Bacteria 1752
72 Ga0070697_100540616 3300005536 Bacteria 1021
73 Ga0070697_100563534 3300005536 Bacteria 999
74 Ga0070686_100236181 3300005544 Bacteria 1329
75 Ga0070695_100089722 3300005545 Archaea 2050
76 Ga0070695_100103548 3300005545 Bacteria 1920
77 Ga0070696_100314162 3300005546 Archaea 1204
78 Ga0070693_100293523 3300005547 Unclassified 1093
79 Ga0070704_100177154 3300005549 Bacteria 1702
80 Ga0070704_100351815 3300005549 Bacteria 1244
81 Ga0070704_100392039 3300005549 Bacteria 1183
82 Ga0070664_100052638 3300005564 Bacteria 3448
83 Ga0068857_100019909 3300005577 Bacteria 5898
84 Ga0068854_100043935 3300005578 Bacteria 3170
85 Ga0068856_100153900 3300005614 Unclassified 2309
86 Ga0068856_101272641 3300005614 Bacteria 751
87 Ga0070702_100157819 3300005615 Archaea 1463
88 Ga0068852_100158782 3300005616 Archaea 2109
89 Ga0068859_100094900 3300005617 Bacteria 3035
90 Ga0068859_100445557 3300005617 Bacteria 1391
91 Ga0068864_100097563 3300005618 Bacteria 2602
92 Ga0068864_100275050 3300005618 Bacteria 1570
93 Ga0068866_10050500 3300005718 Bacteria 2112
94 Ga0068861_100075663 3300005719 Bacteria 2621
95 Ga0068851_10213451 3300005834 Bacteria 1082
96 Ga0068863_100331802 3300005841 Bacteria 1479
97 Ga0068863_100601886 3300005841 Bacteria 1088
98 Ga0068863_100648705 3300005841 Bacteria 1047
99 Ga0068863_100651966 3300005841 Bacteria 1044
100 Ga0068858_100169012 3300005842 Bacteria 2061
101 Ga0068858_100196087 3300005842 Bacteria 1908
102 Ga0068858_100791880 3300005842 Unclassified 925
103 Ga0068860_100837053 3300005843 Bacteria 934
104 Ga0068862_100041880 3300005844 Bacteria 3898
105 Ga0068862_100275639 3300005844 Bacteria 1540
106 Ga0068862_100284815 3300005844 Bacteria 1515
107 Ga0081455_10022540 3300005937 Archaea 5885
108 Ga0081538_10061701 3300005981 Archaea 2144
109 Ga0081539_10002459 3300005985 Bacteria 26102
110 Ga0070717_10044160 3300006028 Bacteria 3639
111 Ga0070717_10097113 3300006028 Bacteria 2496
112 Ga0070717_10301410 3300006028 Archaea 1425
113 Ga0070715_10000735 3300006163 Archaea 8844
114 Ga0070716_100006023 3300006173 Archaea 5908
115 Ga0070712_100030053 3300006175 Unclassified 3647
116 Ga0070712_100134486 3300006175 Bacteria 1878
117 Ga0070712_100188509 3300006175 Bacteria 1612
118 Ga0075427_10025744 3300006194 Archaea 950
119 Ga0097621_100013597 3300006237 Bacteria 6072
120 Ga0097621_100235743 3300006237 Archaea 1598
121 Ga0068871_100001662 3300006358 Bacteria 14953
122 Ga0075428_100001149 3300006844 Archaea 28279
123 Ga0075428_100132155 3300006844 Archaea 2714
124 Ga0075428_100132922 3300006844 Unclassified 2706
125 Ga0075428_100171079 3300006844 Archaea 2354
126 Ga0075428_100274066 3300006844 Archaea 1815
127 Ga0075430_100000377 3300006846 Archaea 32736
128 Ga0075431_100000590 3300006847 Archaea 30661
129 Ga0075431_100026120 3300006847 Bacteria 5989
130 Ga0075431_100126454 3300006847 Archaea 2637
131 Ga0075431_100352381 3300006847 Archaea 1480
132 Ga0075431_100399775 3300006847 Archaea 1375
133 Ga0075433_10079897 3300006852 Archaea 2882
134 Ga0075433_10398404 3300006852 Bacteria 1214
135 Ga0075433_10566981 3300006852 Bacteria 997
136 Ga0075434_100015304 3300006871 Archaea 7352
137 Ga0075434_100169152 3300006871 Bacteria 2205
138 Ga0075434_100402058 3300006871 Bacteria 1391
139 Ga0075429_100000785 3300006880 Archaea 25009
140 Ga0075429_100510313 3300006880 Archaea 1054
141 Ga0075429_100627884 3300006880 Bacteria 941
142 Ga0075436_100035385 3300006914 Archaea 3446
143 Ga0075436_100044976 3300006914 Bacteria 3045
144 Ga0075436_100068712 3300006914 Bacteria 2447
145 Ga0097620_100094907 3300006931 Bacteria 3035
146 Ga0097620_100445599 3300006931 Bacteria 1391
147 Ga0075435_100022843 3300007076 Bacteria 4829
148 Ga0075435_100086777 3300007076 Bacteria 2577
149 Ga0075435_100298959 3300007076 Archaea 1376
150 Ga0099794_10055806 3300007265 Bacteria 1910
151 Ga0099794_10200124 3300007265 Bacteria 1023
152 Ga0099794_10211555 3300007265 Bacteria 994
153 Ga0105240_10040605 3300009093 Bacteria 5948
154 Ga0111539_10001324 3300009094 Archaea 33030
155 Ga0111539_10111298 3300009094 Archaea 3213
156 Ga0111539_10410541 3300009094 Bacteria 1577
157 Ga0105245_10018180 3300009098 Bacteria 6146
158 Ga0105245_10061383 3300009098 Bacteria 3388
159 Ga0105247_10097647 3300009101 Unclassified 1874
160 Ga0114129_10001372 3300009147 Archaea 32741
161 Ga0114129_10036899 3300009147 Bacteria 6900
162 Ga0114129_10139689 3300009147 Archaea 3322
163 Ga0114129_10309424 3300009147 Archaea 2103
164 Ga0114129_10489218 3300009147 Archaea 1608
165 Ga0114129_10691496 3300009147 Archaea 1312
166 Ga0105243_10004675 3300009148 Bacteria 10778
167 Ga0105243_10107330 3300009148 Bacteria 2328
168 Ga0105242_10033082 3300009176 Bacteria 4138
169 Ga0105248_10541977 3300009177 Bacteria 1312
170 Ga0105237_10023753 3300009545 Archaea 6276
171 Ga0105237_10156402 3300009545 Bacteria 2277
172 Ga0105237_10352757 3300009545 Bacteria 1475
173 Ga0105238_10420057 3300009551 Bacteria 1332
174 Ga0105249_10019174 3300009553 Bacteria 6100
175 Ga0105239_10315492 3300010375 Bacteria 1762
176 Ga0105239_10328855 3300010375 Bacteria 1724
177 Ga0105246_10055930 3300011119 Unclassified 2725
178 Ga0105246_10408890 3300011119 Bacteria 1129
179 Ga0157370_10083540 3300013104 Bacteria 3002
180 Ga0157369_10225650 3300013105 Unclassified 1960
181 Ga0157374_10165498 3300013296 Archaea 2155
182 Ga0157378_10053443 3300013297 Archaea 3596
183 Ga0163162_10626950 3300013306 Bacteria 1200
184 Ga0157372_10164039 3300013307 Bacteria 2569
185 Ga0157375_10000033 3300013308 Bacteria 184526
186 Ga0157375_10061259 3300013308 Bacteria 3735
187 Ga0157375_10476309 3300013308 Bacteria 1413
188 Ga0163163_10043841 3300014325 Bacteria 4388
189 Ga0163163_10544429 3300014325 Bacteria 1223
190 Ga0157380_10031564 3300014326 Bacteria 4067
191 Ga0182008_10061285 3300014497 Archaea 1854
192 Ga0157377_10013713 3300014745 Bacteria 4109
193 Ga0157377_10078211 3300014745 Archaea 1928
194 Ga0157379_10013124 3300014968 Bacteria 7254
195 Ga0157379_10174491 3300014968 Bacteria 1940
196 Ga0157376_11243896 3300014969 Bacteria 773
197 Ga0182007_10009205 3300015262 Archaea 4005
198 Ga0206351_10041059 3300020077 Unclassified 900
199 Ga0213873_10036605 3300021358 Bacteria 1247
200 Ga0213872_10008944 3300021361 Bacteria 4819
201 Ga0213872_10017804 3300021361 Bacteria 3280
202 Ga0213872_10110080 3300021361 Bacteria 1224
203 Ga0213872_10129906 3300021361 Bacteria 1110
204 Ga0213875_10088927 3300021388 Bacteria 1441
205 Ga0213871_10015774 3300021441 Bacteria 1811
206 Ga0213871_10032274 3300021441 Bacteria 1371
207 Ga0207656_10089459 3300025321 Bacteria 1395
208 Ga0207688_10015307 3300025901 Bacteria 4162
209 Ga0207688_10103558 3300025901 Archaea 1646
210 Ga0207647_10079693 3300025904 Bacteria 1965
211 Ga0207685_10065039 3300025905 Archaea 1459
212 Ga0207699_10001080 3300025906 Archaea 12890
213 Ga0207643_10094872 3300025908 Bacteria 1743
214 Ga0207705_10339296 3300025909 Bacteria 1156
215 Ga0207684_10000377 3300025910 Bacteria 60516
216 Ga0207684_10006621 3300025910 Bacteria 10533
217 Ga0207684_10013519 3300025910 Bacteria 7059
218 Ga0207684_10070301 3300025910 Bacteria 2974
219 Ga0207684_10134120 3300025910 Bacteria 2126
220 Ga0207695_10008692 3300025913 Bacteria 12667
221 Ga0207671_10240399 3300025914 Bacteria 1422
222 Ga0207693_10002488 3300025915 Archaea 16024
223 Ga0207663_10000284 3300025916 Archaea 22186
224 Ga0207663_10007079 3300025916 Bacteria 5792
225 Ga0207663_10012531 3300025916 Archaea 4586
226 Ga0207663_10017048 3300025916 Archaea 4040
227 Ga0207663_10100307 3300025916 Bacteria 1943
228 Ga0207663_10158173 3300025916 Bacteria 1596
229 Ga0207663_10608262 3300025916 Bacteria 859
230 Ga0207662_10065614 3300025918 Bacteria 2186
231 Ga0207646_10003335 3300025922 Bacteria 18239
232 Ga0207646_10008911 3300025922 Bacteria 9992
233 Ga0207646_10026256 3300025922 Bacteria 5317
234 Ga0207694_10139808 3300025924 Bacteria 1947
235 Ga0207650_10039934 3300025925 Bacteria 3431
236 Ga0207687_10080943 3300025927 Bacteria 2346
237 Ga0207687_10097476 3300025927 Bacteria 2157
238 Ga0207700_10040003 3300025928 Bacteria 3419
239 Ga0207700_10068539 3300025928 Archaea 2720
240 Ga0207700_10446407 3300025928 Archaea 1139
241 Ga0207644_10633430 3300025931 Unclassified 889
242 Ga0207690_10264921 3300025932 Bacteria 1333
243 Ga0207706_10098012 3300025933 Bacteria 2579
244 Ga0207704_10415531 3300025938 Bacteria 1065
245 Ga0207665_10001440 3300025939 Archaea 16000
246 Ga0207665_10029591 3300025939 Archaea 3620
247 Ga0207665_10041513 3300025939 Bacteria 3073
248 Ga0207665_10157007 3300025939 Archaea 1633
249 Ga0207665_10326531 3300025939 Bacteria 1153
250 Ga0207679_10108498 3300025945 Bacteria 2186
251 Ga0207640_10111956 3300025981 Bacteria 1937
252 Ga0207677_10247591 3300026023 Bacteria 1445
253 Ga0207703_10140719 3300026035 Bacteria 2094
254 Ga0207703_10165118 3300026035 Bacteria 1942
255 Ga0207639_10037913 3300026041 Bacteria 3583
256 Ga0207708_10010849 3300026075 Bacteria 6777
257 Ga0207702_10211345 3300026078 Unclassified 1804
258 Ga0207641_10298840 3300026088 Bacteria 1520
259 Ga0207648_10074351 3300026089 Bacteria 2962
260 Ga0207648_10349312 3300026089 Bacteria 1333
261 Ga0207676_10039241 3300026095 Bacteria 3621
262 Ga0207676_10099753 3300026095 Bacteria 2404
263 Ga0207674_10031032 3300026116 Bacteria 5616
264 Ga0207675_100100680 3300026118 Bacteria 2722
265 Ga0207698_10270572 3300026142 Unclassified 1566
266 Ga0207428_10000268 3300027907 Archaea 70566
267 Ga0207428_10053440 3300027907 Archaea 3221
268 Ga0207428_10399174 3300027907 Bacteria 1007
269 Ga0268265_10049530 3300028380 Bacteria 3160
270 Ga0268265_10093570 3300028380 Bacteria 2408
271 Ga0268265_10314360 3300028380 Bacteria 1416
272 Ga0265337_1000188 3300028556 Bacteria 32521
273 Ga0265337_1004272 3300028556 Bacteria 5959
274 Ga0265337_1012638 3300028556 Bacteria 2862
275 Ga0265337_1018431 3300028556 Bacteria 2218
276 Ga0265326_10007043 3300028558 Unclassified 3464
277 Ga0265319_1000264 3300028563 Bacteria 39616
278 Ga0265319_1000318 3300028563 Bacteria 35743
279 Ga0265319_1002353 3300028563 Bacteria 10389
280 Ga0265319_1037876 3300028563 Bacteria 1641
281 Ga0265318_10000087 3300028577 Bacteria 83561
282 Ga0265318_10000088 3300028577 Bacteria 82498
283 Ga0265318_10002706 3300028577 Bacteria 9299
284 Ga0265318_10018197 3300028577 Unclassified 2871
285 Ga0265323_10003524 3300028653 Bacteria 6894
286 Ga0265336_10000240 3300028666 Bacteria 39084
287 Ga0265336_10000575 3300028666 Bacteria 20685
288 Ga0265336_10032391 3300028666 Bacteria 1621
289 Ga0265338_10001431 3300028800 Bacteria 38817
290 Ga0265338_10001776 3300028800 Bacteria 34020
291 Ga0265338_10006722 3300028800 Bacteria 14520
292 Ga0265338_10014824 3300028800 Bacteria 8626
293 Ga0265338_10016869 3300028800 Bacteria 7906
294 Ga0265338_10037565 3300028800 Unclassified 4606
295 Ga0265338_10038042 3300028800 Unclassified 4567
296 Ga0265338_10041639 3300028800 Bacteria 4293
297 Ga0265338_10060421 3300028800 Bacteria 3331
298 Ga0265338_10087858 3300028800 Bacteria 2581
299 Ga0265338_10121726 3300028800 Bacteria 2078
300 Ga0265324_10002482 3300029957 Bacteria 9369
301 Ga0265330_10000934 3300031235 Bacteria 17967
302 Ga0265330_10027789 3300031235 Bacteria 2554
303 Ga0265330_10036155 3300031235 Bacteria 2202
304 Ga0265332_10000049 3300031238 Bacteria 112846
305 Ga0265332_10171274 3300031238 Unclassified 906
306 Ga0265328_10083281 3300031239 Bacteria 1179
307 Ga0265320_10000150 3300031240 Bacteria 57930
308 Ga0265320_10000449 3300031240 Bacteria 32297
309 Ga0265320_10000451 3300031240 Bacteria 32255
310 Ga0265320_10001231 3300031240 Bacteria 18800
311 Ga0265320_10001910 3300031240 Bacteria 14720
312 Ga0265320_10023524 3300031240 Unclassified 3278
313 Ga0265325_10007565 3300031241 Bacteria 6494
314 Ga0265325_10120331 3300031241 Bacteria 1266
315 Ga0265329_10000404 3300031242 Bacteria 22574
316 Ga0265340_10008141 3300031247 Bacteria 5672
317 Ga0265339_10007155 3300031249 Bacteria 7240
318 Ga0265331_10000430 3300031250 Bacteria 41552
319 Ga0265331_10013176 3300031250 Bacteria 4452
320 Ga0265327_10001819 3300031251 Bacteria 24953
321 Ga0265327_10010189 3300031251 Bacteria 6642
322 Ga0265316_10000362 3300031344 Bacteria 51331
323 Ga0265316_10008541 3300031344 Bacteria 9496
324 Ga0265316_10010176 3300031344 Bacteria 8589
325 Ga0265316_10047569 3300031344 Bacteria 3392
326 Ga0265316_10428107 3300031344 Bacteria 951
327 Ga0265313_10000195 3300031595 Bacteria 64872
328 Ga0265313_10006993 3300031595 Bacteria 7824
329 Ga0265314_10000153 3300031711 Bacteria 103485
330 Ga0265314_10002621 3300031711 Bacteria 18160
331 Ga0265314_10044975 3300031711 Unclassified 3124
332 Ga0265314_10194720 3300031711 Bacteria 1203
333 Ga0265342_10001256 3300031712 Bacteria 23950
334 Ga0265342_10117189 3300031712 Bacteria 1503
335 Ga0307413_10143644 3300031824 Archaea 1653
336 Ga0307410_10119360 3300031852 Archaea 1921
337 Ga0307410_10431559 3300031852 Archaea 1071
338 Ga0307406_10083372 3300031901 Archaea 2132
339 Ga0307412_10261812 3300031911 Archaea 1349
340 Ga0307409_100129880 3300031995 Archaea 2151
341 Ga0307416_100345608 3300032002 Archaea 1503
342 Ga0307415_100509013 3300032126 Archaea 1054
343 Ga0307415_100655648 3300032126 Unclassified 941
344 Ga0373934_0014190 3300035086 Archaea 3017
345 Ga0373944_0020712 3300035089 Bacteria 1897
346 Ga0373923_0021077 3300035111 Archaea 2540
347 Ga0373923_0049898 3300035111 Bacteria 1751
348 Ga0373936_0153476 3300035113 Bacteria 999
349 Ga0373945_0012043 3300035116 Bacteria 2867
350 Ga0373953_0000240 3300035117 Archaea 14955
351 Ga0373954_0000817 3300035118 Archaea 12053
352 Ga0373954_0067534 3300035118 Bacteria 1694
353 Ga0373956_0005384 3300035119 Archaea 5124
354 Ga0373956_0037991 3300035119 Unclassified 2129
355 Ga0373956_0042646 3300035119 Bacteria 2018
356 Ga0373957_0001138 3300035120 Archaea 7047
357 Ga0373957_0053158 3300035120 Bacteria 1553
358 Ga0373943_0010235 3300035170 Bacteria 4206
359 Ga0373946_0030574 3300035171 Bacteria 2151
360 Ga0373946_0039355 3300035171 Unclassified 1930
361 Ga0373955_0001869 3300035172 Archaea 9064
362 Ga0373924_0005590 3300035410 Bacteria 4459
363 Ga0373935_0018552 3300035692 Unclassified 4234
364 Ga0373935_0034359 3300035692 Bacteria 3160
365 Ga0373927_0039432 3300035695 Archaea 3066
366 Ga0373927_0088127 3300035695 Unclassified 2015
367 Ga0373933_0001792 3300035724 Archaea 12432
368 Ga0373933_0021520 3300035724 Bacteria 3664
369 Ga0373933_0377556 3300035724 Bacteria 923
370 Ga0373947_0231542 3300035725 Archaea 1217
371 Ga0373947_0299271 3300035725 Bacteria 1072
372 Ga0373937_0012768 3300036401 Archaea 7394
373 Ga0373937_0030050 3300036401 Bacteria 4921
374 Ga0373937_0061563 3300036401 Bacteria 3450
375 Ga0373937_0149889 3300036401 Bacteria 2184
376 Ga0373925_0013724 3300037068 Bacteria 5863
377 Ga0373925_0345964 3300037068 Bacteria 1206
378 Ga0395898_0004222 3300037466 Bacteria 15747
379 Ga0436364_0129059 3300037853 Bacteria 7150
380 Ga0436364_0810580 3300037853 Bacteria 3221
381 Ga0395901_0036919 3300038443 Bacteria 5052
382 Ga0242419_000107 3300038698 Archaea 4101
383 Ga0242420_000010 3300038996 Archaea 27345
384 Ga0436360_0192135 3300039438 Bacteria 6508
385 Ga0436360_0256508 3300039438 Bacteria 2249
386 Ga0436360_0497859 3300039438 Bacteria 1610
387 Ga0436360_0590668 3300039438 Bacteria 995
388 Ga0436360_1034577 3300039438 Bacteria 4166
389 Ga0436360_1282614 3300039438 Bacteria 2342
390 Ga0436361_0025472 3300039447 Bacteria 7273
391 Ga0436361_0075975 3300039447 Bacteria 5616
392 Ga0436361_0221031 3300039447 Bacteria 5714
393 Ga0436361_0314766 3300039447 Bacteria 6693
394 Ga0436361_0466156 3300039447 Bacteria 1249
395 Ga0436361_0910629 3300039447 Bacteria 2470
396 Ga0436363_1515046 3300039450 Bacteria 1273
397 Ga0439453_0027000 3300041408 Unclassified 1067
398 Ga0451577_0028240 3300042876 Bacteria 5076
399 Ga0451577_0066650 3300042876 Bacteria 3211
400 Ga0451577_0385161 3300042876 Bacteria 1273
401 Ga0453684_0183026 3300044712 Bacteria 2458
402 Ga0451576_0377069 3300045051 Bacteria 1487
403 Ga0495592_0000027 3300046454 Bacteria 132938
404 Ga0495592_0013849 3300046454 Archaea 6131
405 Ga0495592_0116153 3300046454 Bacteria 1889
406 Ga0495592_0144908 3300046454 Bacteria 1648
407 Ga0495592_0177158 3300046454 Unclassified 1455
408 Ga0495592_0177188 3300046454 Bacteria 1455
409 Ga0495629_0178882 3300046459 Bacteria 1470
410 Ga0495641_0023407 3300046461 Bacteria 3068
411 Ga0495651_0002382 3300046462 Archaea 14522
412 Ga0495653_0010001 3300046463 Bacteria 7760
413 Ga0495653_0031357 3300046463 Bacteria 4225
414 Ga0495653_0187578 3300046463 Bacteria 1414
415 Ga0495653_0319814 3300046463 Bacteria 1006
416 Ga0495580_0063174 3300046472 Bacteria 2597
417 Ga0495582_0085858 3300046473 Bacteria 1751
418 Ga0495582_0095508 3300046473 Bacteria 1660
419 Ga0495662_0097057 3300046476 Bacteria 1441
420 Ga0495662_0105490 3300046476 Bacteria 1379
421 Ga0495664_0012378 3300046477 Bacteria 4831
422 Ga0495664_0021689 3300046477 Bacteria 3711
423 Ga0495664_0358415 3300046477 Bacteria 878
424 Ga0495594_0048762 3300046499 Bacteria 2327
425 Ga0495608_0026859 3300046511 Bacteria 3922
426 Ga0495608_0046411 3300046511 Bacteria 2890
427 Ga0495608_0048229 3300046511 Archaea 2831
428 Ga0495608_0054731 3300046511 Bacteria 2638
429 Ga0495618_0001770 3300046514 Bacteria 14313
430 Ga0495618_0004418 3300046514 Bacteria 8648
431 Ga0495618_0014286 3300046514 Bacteria 4836
432 Ga0495618_0043997 3300046514 Bacteria 2817
433 Ga0495628_0001345 3300046516 Bacteria 22540
434 Ga0495628_0018358 3300046516 Archaea 5795
435 Ga0495628_0055839 3300046516 Bacteria 3110
436 Ga0495628_0095113 3300046516 Bacteria 2302
437 Ga0495628_0153363 3300046516 Bacteria 1754
438 Ga0495630_0012860 3300046517 Bacteria 6082
439 Ga0495630_0039674 3300046517 Bacteria 3520
440 Ga0495630_0077505 3300046517 Bacteria 2506
441 Ga0495630_0282068 3300046517 Bacteria 1269
442 Ga0495630_0569673 3300046517 Bacteria 868
443 Ga0495652_0002274 3300046529 Bacteria 20037
444 Ga0495652_0014446 3300046529 Archaea 7087
445 Ga0495652_0056844 3300046529 Bacteria 3321
446 Ga0495665_0011200 3300046531 Bacteria 4856
447 Ga0495665_0017651 3300046531 Bacteria 3837
448 Ga0495665_0180861 3300046531 Unclassified 1096
449 Ga0495640_0003597 3300046533 Bacteria 12449
450 Ga0495640_0040385 3300046533 Bacteria 3267
451 Ga0495640_0132946 3300046533 Unclassified 1609
452 Ga0495640_0278410 3300046533 Bacteria 1042
453 Ga0495586_0000556 3300046535 Bacteria 21644
454 Ga0495586_0005208 3300046535 Bacteria 6959
455 Ga0495587_0001446 3300046536 Archaea 15819
456 Ga0495587_0004255 3300046536 Bacteria 9462
457 Ga0495587_0256797 3300046536 Unclassified 982
458 Ga0495645_0001889 3300046543 Bacteria 14244
459 Ga0495645_0003114 3300046543 Bacteria 11239
460 Ga0495667_0002468 3300046559 Archaea 12353
461 Ga0495667_0011302 3300046559 Bacteria 6042
462 Ga0495667_0025419 3300046559 Bacteria 3990
463 Ga0495667_0070527 3300046559 Bacteria 2279
464 Ga0495667_0112034 3300046559 Bacteria 1763
465 Ga0495634_0001841 3300046642 Bacteria 18277
466 Ga0495634_0037035 3300046642 Bacteria 3334
467 Ga0495634_0195250 3300046642 Bacteria 1260
468 Ga0495634_0232663 3300046642 Bacteria 1133
469 Ga0495611_0261111 3300046648 Bacteria 802
470 Ga0495635_0027513 3300046663 Bacteria 3954
471 Ga0495635_0058994 3300046663 Bacteria 2639
472 Ga0495635_0216188 3300046663 Bacteria 1297
473 Ga0495635_0434270 3300046663 Unclassified 869
474 Ga0495657_0034108 3300046675 Bacteria 3537
475 Ga0495657_0076252 3300046675 Archaea 2178
476 Ga0495657_0236195 3300046675 Bacteria 1104
477 Ga0495599_0000629 3300046678 Bacteria 19951
478 Ga0495599_0058882 3300046678 Bacteria 2403
479 Ga0495623_0141139 3300046679 Archaea 1433
480 Ga0495646_0005274 3300046680 Archaea 8156
481 Ga0495658_0271253 3300046683 Bacteria 1069
482 Ga0495613_0006117 3300046689 Bacteria 9004
483 Ga0495613_0021367 3300046689 Bacteria 4826
484 Ga0495613_0034588 3300046689 Bacteria 3752
485 Ga0495613_0385968 3300046689 Bacteria 957
486 Ga0495600_0005405 3300046809 Bacteria 7701
487 Ga0495600_0017049 3300046809 Archaea 4617
488 Ga0495581_0006848 3300047315 Bacteria 6609
489 Ga0495581_0020614 3300047315 Bacteria 3824
490 Ga0495581_0029928 3300047315 Bacteria 3157
491 Ga0495604_0006039 3300047317 Bacteria 9609
492 Ga0495604_0010203 3300047317 Archaea 7440
493 Ga0495604_0255750 3300047317 Bacteria 1192
494 Ga0495674_0023726 3300047319 Bacteria 5649
495 Ga0495674_0036278 3300047319 Bacteria 4439
496 Ga0495674_0048110 3300047319 Bacteria 3776
497 Ga0495674_0104942 3300047319 Bacteria 2402
498 Ga0495676_0014858 3300047321 Bacteria 6951
499 Ga0495676_0052633 3300047321 Bacteria 3248
500 Ga0495676_0090553 3300047321 Bacteria 2289
501 Ga0495680_0121035 3300047322 Bacteria 1932
502 Ga0495680_0192063 3300047322 Unclassified 1469
503 Ga0495680_0750303 3300047322 Bacteria 641
504 Ga0495675_0176951 3300047444 Bacteria 1308
505 Ga0495684_0020936 3300047471 Bacteria 5038
506 Ga0495684_0029327 3300047471 Bacteria 4223
507 Ga0495684_0101244 3300047471 Unclassified 2178
508 Ga0495684_0161632 3300047471 Bacteria 1670
509 Ga0495684_0189348 3300047471 Unclassified 1522
510 Ga0495593_0127774 3300047673 Bacteria 1291
511 Ga0495602_0004005 3300048088 Archaea 15347
512 Ga0495602_0030037 3300048088 Bacteria 5163
513 Ga0495602_0097587 3300048088 Bacteria 2420
514 Ga0495614_0021870 3300048089 Bacteria 2761
515 Ga0496100_0164421 3300048903 Archaea 1593
516 Ga0496100_0197363 3300048903 Unclassified 1464
517 Ga0496100_0212847 3300048903 Bacteria 1414
518 Ga0496100_0399564 3300048903 Bacteria 1046
519 Ga0496101_0153006 3300048904 Bacteria 1765
520 Ga0496101_0183233 3300048904 Unclassified 1613
521 Ga0496102_0163814 3300048905 Archaea 2092
522 Ga0496102_0192435 3300048905 Archaea 1922
523 Ga0496103_0135144 3300048906 Archaea 1576
524 Ga0496104_0004130 3300048907 Bacteria 12604
525 Ga0496104_0134830 3300048907 Archaea 2372
526 Ga0496105_0017689 3300048908 Bacteria 5719
527 Ga0496106_0007113 3300048909 Archaea 8271
528 Ga0496106_0187926 3300048909 Archaea 1641
529 Ga0496107_0005511 3300048910 Archaea 8662
530 Ga0496107_0017876 3300048910 Archaea 4991
531 Ga0496108_0006271 3300048911 Bacteria 9634
532 Ga0496108_0031273 3300048911 Bacteria 4415
533 Ga0496108_0194539 3300048911 Archaea 1758
534 Ga0496109_0008574 3300048912 Bacteria 8698
535 Ga0496109_0088396 3300048912 Bacteria 2863
536 Ga0496109_0206729 3300048912 Bacteria 1846
537 Ga0496110_0000512 3300048913 Bacteria 26347
538 Ga0496110_0103131 3300048913 Bacteria 2558
539 Ga0496110_0220734 3300048913 Archaea 1724
540 Ga0496110_0634544 3300048913 Unclassified 967
541 Ga0496111_0000830 3300048914 Bacteria 16656
542 Ga0496111_0013057 3300048914 Archaea 5640
543 Ga0496111_0493528 3300048914 Bacteria 901
544 Ga0496112_0004649 3300048915 Bacteria 11669
545 Ga0496112_0017338 3300048915 Bacteria 6764
546 Ga0496112_0089615 3300048915 Bacteria 3044
547 Ga0496113_0093872 3300048916 Bacteria 2317
548 Ga0496113_0257263 3300048916 Archaea 1394
549 Ga0496114_0129505 3300048917 Archaea 2178
550 Ga0496114_0186043 3300048917 Bacteria 1815
551 Ga0496115_0003299 3300048918 Bacteria 11588
552 Ga0496115_0016433 3300048918 Bacteria 5637
553 Ga0496115_0033180 3300048918 Archaea 4075
554 Ga0496115_0143800 3300048918 Bacteria 1968
555 Ga0501306_013891 3300049127 Archaea 1056
556 Ga0501306_014245 3300049127 Archaea 1047
557 Ga0501308_006706 3300049128 Archaea 1188
558 Ga0501308_015753 3300049128 Unclassified 899
559 Ga0501320_012707 3300049536 Archaea 890
560 Ga0501321_011094 3300049537 Archaea 1000
561 Ga0501325_006673 3300049541 Archaea 956
562 Ga0501340_006801 3300049556 Unclassified 776
563 Ga0501031_0010445 3300049568 Archaea 6047
564 Ga0501031_0070222 3300049568 Archaea 2281
565 Ga0501033_0111651 3300049570 Archaea 1989
566 Ga0501036_0004319 3300049572 Archaea 11474
567 Ga0501036_0131346 3300049572 Archaea 2114
568 Ga0501037_0050537 3300049573 Archaea 3042
569 Ga0501038_0005327 3300049574 Archaea 11952
570 Ga0501038_0122597 3300049574 Archaea 2142
571 Ga0501039_0000173 3300049575 Archaea 45418
572 Ga0501039_0059433 3300049575 Archaea 2961
573 Ga0501040_0000300 3300049576 Archaea 28907
574 Ga0501040_0051106 3300049576 Archaea 2828
575 Ga0501041_0000128 3300049577 Archaea 32431
576 Ga0501041_0020044 3300049577 Archaea 3994
577 Ga0501042_0001676 3300049578 Archaea 13198
578 Ga0501042_0114539 3300049578 Archaea 1941
579 Ga0501042_0391926 3300049578 Archaea 1006
580 Ga0501043_0015828 3300049579 Archaea 5912
581 Ga0501046_0001528 3300049580 Archaea 22070
582 Ga0501046_0047443 3300049580 Archaea 3405
583 Ga0501048_0064870 3300049582 Archaea 2582
584 Ga0501048_0091661 3300049582 Archaea 2143
585 Ga0501067_0134152 3300049583 Archaea 1378
586 Ga0501068_0048477 3300049584 Archaea 2565
587 Ga0501070_0017278 3300049586 Archaea 6058
588 Ga0501071_0031484 3300049587 Archaea 3760
589 Ga0501072_0000027 3300049588 Archaea 138014
590 Ga0501072_0040399 3300049588 Archaea 3663
591 Ga0501073_0169861 3300049589 Archaea 1510
592 Ga0501074_0092994 3300049590 Archaea 2159
593 Ga0501075_0011341 3300049591 Archaea 6307
594 Ga0501075_0128015 3300049591 Archaea 1933
595 Ga0501076_0000174 3300049592 Archaea 37809
596 Ga0501076_0061059 3300049592 Archaea 2999
597 Ga0501076_0318805 3300049592 Archaea 1275
598 Ga0501077_0001793 3300049593 Archaea 12987
599 Ga0501077_0118363 3300049593 Archaea 1679
600 Ga0501198_007321 3300049649 Archaea 1586
601 Ga0501199_005936 3300049650 Archaea 1234
602 Ga0501202_010017 3300049652 Archaea 1751
603 Ga0501209_000303 3300049656 Archaea 5915
604 Ga0501224_016777 3300049664 Archaea 1087
605 Ga0501227_038436 3300049665 Archaea 1174
606 Ga0501257_029536 3300049686 Archaea 1318
607 Ga0501261_025946 3300049690 Archaea 865
608 Ga0501221_014093 3300049704 Archaea 1481
609 Ga0501225_0025313 3300049705 Archaea 1633
610 Ga0501079_0008813 3300049741 Archaea 7641
611 Ga0501079_0236835 3300049741 Archaea 1426
612 Ga0501080_0233855 3300049742 Archaea 1679
613 Ga0501081_0001043 3300049743 Archaea 16567
614 Ga0501081_0033311 3300049743 Archaea 3500
615 Ga0501083_0086061 3300049744 Archaea 2079
616 Ga0501279_028971 3300049775 Archaea 816
617 Ga0501035_0035288 3300049822 Archaea 4539
618 Ga0501035_0258053 3300049822 Archaea 1478
619 Ga0501045_0001462 3300049824 Archaea 15710
620 Ga0501045_0146676 3300049824 Archaea 1755
621 Ga0501212_006959 3300049851 Archaea 1538
622 Ga0501226_012996 3300049853 Archaea 920
623 nmdc:mga05p37_388814_c1 3300050507 Archaea 1632
624 nmdc:mga05p37_4648_c1 3300050507 Archaea 16050
625 nmdc:mga09592_2706_c1 3300050508 Archaea 14335
626 nmdc:mga09592_612547_c1 3300050508 Archaea 932
627 nmdc:mga09592_639437_c1 3300050508 Bacteria 909
628 nmdc:mga09592_99956_c1 3300050508 Archaea 2484
629 nmdc:mga0qj67_120664_c1 3300050509 Archaea 2121
630 nmdc:mga0qj67_612928_c1 3300050509 Archaea 870
631 nmdc:mga0qj67_6495_c1 3300050509 Archaea 8594
632 nmdc:mga06r32_2432_c1 3300050510 Archaea 16653
633 nmdc:mga06r32_414533_c1 3300050510 Archaea 1328
634 nmdc:mga06r32_439347_c1 3300050510 Archaea 1285
635 nmdc:mga08y16_172467_c1 3300050511 Archaea 2247
636 nmdc:mga08y16_27156_c1 3300050511 Bacteria 6032
637 nmdc:mga08y16_344722_c1 3300050511 Bacteria 1531
638 nmdc:mga08y16_5009_c1 3300050511 Archaea 13856
639 nmdc:mga0n895_105669_c1 3300050512 Bacteria 2828
640 nmdc:mga0n895_106370_c1 3300050512 Archaea 2819
641 nmdc:mga0n895_1233_c1 3300050512 Bacteria 18867
642 nmdc:mga0n895_31972_c1 3300050512 Bacteria 5046
643 nmdc:mga0n895_331859_c1 3300050512 Archaea 1541
644 nmdc:mga0n895_466153_c1 3300050512 Archaea 1275
645 nmdc:mga0n895_533370_c1 3300050512 Bacteria 1180
646 nmdc:mga0n895_646937_c1 3300050512 Bacteria 1056
647 nmdc:mga0rr50_125393_c1 3300050513 Archaea 2050
648 nmdc:mga0rr50_202191_c1 3300050513 Bacteria 1633
649 nmdc:mga0rr50_252220_c1 3300050513 Bacteria 1466
650 nmdc:mga0rr50_329452_c1 3300050513 Bacteria 1282
651 nmdc:mga0rr50_628144_c1 3300050513 Bacteria 916
652 nmdc:mga08x19_14121_c2 3300050514 Bacteria 894
653 nmdc:mga08x19_154688_c1 3300050514 Bacteria 1555
654 nmdc:mga08x19_34515_c1 3300050514 Archaea 3198
655 nmdc:mga08x19_75786_c1 3300050514 Bacteria 2200
656 nmdc:mga0a205_138527_c1 3300050515 Archaea 2333
657 nmdc:mga0a205_14043_c1 3300050515 Bacteria 7470
658 nmdc:mga0a205_164715_c1 3300050515 Archaea 2113
659 nmdc:mga0a205_259670_c1 3300050515 Bacteria 1615
660 nmdc:mga0a205_400171_c1 3300050515 Bacteria 1237
661 nmdc:mga0a205_506024_c1 3300050515 Bacteria 1065
662 Ga0495601_0016763 3300053077 Bacteria 4442
663 Ga0495601_0189035 3300053077 Bacteria 1346
664 Ga0495612_0004203 3300053078 Bacteria 5971
665 Ga0495612_0045075 3300053078 Bacteria 1805
666 Ga0495612_0139468 3300053078 Bacteria 1051
667 Ga0495595_0016118 3300053084 Bacteria 3192
668 Ga0495595_0038390 3300053084 Bacteria 2181
669 Ga0495595_0091961 3300053084 Bacteria 1456
670 Ga0495619_0001416 3300053085 Archaea 15755
671 Ga0495619_0049653 3300053085 Bacteria 2767
672 Ga0495619_0148728 3300053085 Archaea 1615
673 Ga0495619_0257092 3300053085 Bacteria 1210
674 Ga0501084_0012459 3300054114 Archaea 7046
675 Ga0501084_0122540 3300054114 Archaea 2187
676 Ga0587075_030162 3300059644 Unclassified 859
677 Ga0501082_0000992 3300060353 Archaea 25061
678 Ga0530510_0054664 3300061734 Archaea 2885
679 Ga0081455_10020536
680 MBSR1b_contig_11073137
681 JGI24743J22301_10014784
682 JGI25405J52794_10017387
683 Ga0065704_10077848
684 Ga0065712_10032451
685 Ga0065715_10097426
686 Ga0065707_10454408
687 Ga0070658_10166406
688 Ga0070683_100065833
689 Ga0070683_100157077
690 Ga0070683_100517954
691 Ga0070690_100083096
692 Ga0070670_100022660
693 Ga0070666_10184275
694 Ga0068868_100053603
695 Ga0068868_100257178
696 Ga0070669_100118237
697 Ga0070675_100115751
698 Ga0070671_100200302
699 Ga0070673_100673128
700 Ga0070688_100028336
701 Ga0070688_100071342
702 Ga0070659_100095132
703 Ga0070667_100583132
704 Ga0070709_10002045
705 Ga0070714_100067281
706 Ga0070714_100148134
707 Ga0070713_100069776
708 Ga0070713_100111232
709 Ga0070710_10144887
710 Ga0070711_100002189
711 Ga0070711_100026501
712 Ga0070711_100045818
713 Ga0070711_100105988
714 Ga0070700_100039617
715 Ga0070694_100029576
716 Ga0070708_100014377
717 Ga0070708_100045837
718 Ga0070708_100091090
719 Ga0070708_100234876
720 Ga0070708_100295025
721 Ga0070708_100542015
722 Ga0070662_100030067
723 Ga0070681_10543759
724 Ga0070706_100000541
725 Ga0070706_100013447
726 Ga0070706_100021256
727 Ga0070706_100044535
728 Ga0070706_100172669
729 Ga0070706_100446205
730 Ga0070707_100013210
731 Ga0070707_100029672
732 Ga0070707_100056567
733 Ga0070707_100444173
734 Ga0070698_100007827
735 Ga0070698_100097574
736 Ga0070698_100211761
737 Ga0070698_100220715
738 Ga0070698_100513406
739 Ga0070699_100026721
740 Ga0070699_100040935
741 Ga0070699_100049873
742 Ga0070699_100090655
743 Ga0070699_100102371
744 Ga0070699_100689727
745 Ga0070684_100075401
746 Ga0070684_100287536
747 Ga0070697_100125666
748 Ga0070697_100166065
749 Ga0070697_100187988
750 Ga0070697_100540616
751 Ga0070697_100563534
752 Ga0070686_100236181
753 Ga0070695_100089722
754 Ga0070695_100103548
755 Ga0070696_100314162
756 Ga0070693_100293523
757 Ga0070704_100177154
758 Ga0070704_100351815
759 Ga0070704_100392039
760 Ga0070664_100052638
761 Ga0068857_100019909
762 Ga0068854_100043935
763 Ga0068856_100153900
764 Ga0068856_101272641
765 Ga0070702_100157819
766 Ga0068852_100158782
767 Ga0068859_100094900
768 Ga0068859_100445557
769 Ga0068864_100097563
770 Ga0068864_100275050
771 Ga0068866_10050500
772 Ga0068861_100075663
773 Ga0068851_10213451
774 Ga0068863_100331802
775 Ga0068863_100601886
776 Ga0068863_100648705
777 Ga0068863_100651966
778 Ga0068858_100169012
779 Ga0068858_100196087
780 Ga0068858_100791880
781 Ga0068860_100837053
782 Ga0068862_100041880
783 Ga0068862_100275639
784 Ga0068862_100284815
785 Ga0081455_10022540
786 Ga0081538_10061701
787 Ga0081539_10002459
788 Ga0070717_10044160
789 Ga0070717_10097113
790 Ga0070717_10301410
791 Ga0070715_10000735
792 Ga0070716_100006023
793 Ga0070712_100030053
794 Ga0070712_100134486
795 Ga0070712_100188509
796 Ga0075427_10025744
797 Ga0097621_100013597
798 Ga0097621_100235743
799 Ga0068871_100001662
800 Ga0075428_100001149
801 Ga0075428_100132155
802 Ga0075428_100132922
803 Ga0075428_100171079
804 Ga0075428_100274066
805 Ga0075430_100000377
806 Ga0075431_100000590
807 Ga0075431_100026120
808 Ga0075431_100126454
809 Ga0075431_100352381
810 Ga0075431_100399775
811 Ga0075433_10079897
812 Ga0075433_10398404
813 Ga0075433_10566981
814 Ga0075434_100015304
815 Ga0075434_100169152
816 Ga0075434_100402058
817 Ga0075429_100000785
818 Ga0075429_100510313
819 Ga0075429_100627884
820 Ga0075436_100035385
821 Ga0075436_100044976
822 Ga0075436_100068712
823 Ga0097620_100094907
824 Ga0097620_100445599
825 Ga0075435_100022843
826 Ga0075435_100086777
827 Ga0075435_100298959
828 Ga0099794_10055806
829 Ga0099794_10200124
830 Ga0099794_10211555
831 Ga0105240_10040605
832 Ga0111539_10001324
833 Ga0111539_10111298
834 Ga0111539_10410541
835 Ga0105245_10018180
836 Ga0105245_10061383
837 Ga0105247_10097647
838 Ga0114129_10001372
839 Ga0114129_10036899
840 Ga0114129_10139689
841 Ga0114129_10309424
842 Ga0114129_10489218
843 Ga0114129_10691496
844 Ga0105243_10004675
845 Ga0105243_10107330
846 Ga0105242_10033082
847 Ga0105248_10541977
848 Ga0105237_10023753
849 Ga0105237_10156402
850 Ga0105237_10352757
851 Ga0105238_10420057
852 Ga0105249_10019174
853 Ga0105239_10315492
854 Ga0105239_10328855
855 Ga0105246_10055930
856 Ga0105246_10408890
857 Ga0157370_10083540
858 Ga0157369_10225650
859 Ga0157374_10165498
860 Ga0157378_10053443
861 Ga0163162_10626950
862 Ga0157372_10164039
863 Ga0157375_10000033
864 Ga0157375_10061259
865 Ga0157375_10476309
866 Ga0163163_10043841
867 Ga0163163_10544429
868 Ga0157380_10031564
869 Ga0182008_10061285
870 Ga0157377_10013713
871 Ga0157377_10078211
872 Ga0157379_10013124
873 Ga0157379_10174491
874 Ga0157376_11243896
875 Ga0182007_10009205
876 Ga0206351_10041059
877 Ga0213873_10036605
878 Ga0213872_10008944
879 Ga0213872_10017804
880 Ga0213872_10110080
881 Ga0213872_10129906
882 Ga0213875_10088927
883 Ga0213871_10015774
884 Ga0213871_10032274
885 Ga0207656_10089459
886 Ga0207688_10015307
887 Ga0207688_10103558
888 Ga0207647_10079693
889 Ga0207685_10065039
890 Ga0207699_10001080
891 Ga0207643_10094872
892 Ga0207705_10339296
893 Ga0207684_10000377
894 Ga0207684_10006621
895 Ga0207684_10013519
896 Ga0207684_10070301
897 Ga0207684_10134120
898 Ga0207695_10008692
899 Ga0207671_10240399
900 Ga0207693_10002488
901 Ga0207663_10000284
902 Ga0207663_10007079
903 Ga0207663_10012531
904 Ga0207663_10017048
905 Ga0207663_10100307
906 Ga0207663_10158173
907 Ga0207663_10608262
908 Ga0207662_10065614
909 Ga0207646_10003335
910 Ga0207646_10008911
911 Ga0207646_10026256
912 Ga0207694_10139808
913 Ga0207650_10039934
914 Ga0207687_10080943
915 Ga0207687_10097476
916 Ga0207700_10040003
917 Ga0207700_10068539
918 Ga0207700_10446407
919 Ga0207644_10633430
920 Ga0207690_10264921
921 Ga0207706_10098012
922 Ga0207704_10415531
923 Ga0207665_10001440
924 Ga0207665_10029591
925 Ga0207665_10041513
926 Ga0207665_10157007
927 Ga0207665_10326531
928 Ga0207679_10108498
929 Ga0207640_10111956
930 Ga0207677_10247591
931 Ga0207703_10140719
932 Ga0207703_10165118
933 Ga0207639_10037913
934 Ga0207708_10010849
935 Ga0207702_10211345
936 Ga0207641_10298840
937 Ga0207648_10074351
938 Ga0207648_10349312
939 Ga0207676_10039241
940 Ga0207676_10099753
941 Ga0207674_10031032
942 Ga0207675_100100680
943 Ga0207698_10270572
944 Ga0207428_10000268
945 Ga0207428_10053440
946 Ga0207428_10399174
947 Ga0268265_10049530
948 Ga0268265_10093570
949 Ga0268265_10314360
950 Ga0265337_1000188
951 Ga0265337_1004272
952 Ga0265337_1012638
953 Ga0265337_1018431
954 Ga0265326_10007043
955 Ga0265319_1000264
956 Ga0265319_1000318
957 Ga0265319_1002353
958 Ga0265319_1037876
959 Ga0265318_10000087
960 Ga0265318_10000088
961 Ga0265318_10002706
962 Ga0265318_10018197
963 Ga0265323_10003524
964 Ga0265336_10000240
965 Ga0265336_10000575
966 Ga0265336_10032391
967 Ga0265338_10001431
968 Ga0265338_10001776
969 Ga0265338_10006722
970 Ga0265338_10014824
971 Ga0265338_10016869
972 Ga0265338_10037565
973 Ga0265338_10038042
974 Ga0265338_10041639
975 Ga0265338_10060421
976 Ga0265338_10087858
977 Ga0265338_10121726
978 Ga0265324_10002482
979 Ga0265330_10000934
980 Ga0265330_10027789
981 Ga0265330_10036155
982 Ga0265332_10000049
983 Ga0265332_10171274
984 Ga0265328_10083281
985 Ga0265320_10000150
986 Ga0265320_10000449
987 Ga0265320_10000451
988 Ga0265320_10001231
989 Ga0265320_10001910
990 Ga0265320_10023524
991 Ga0265325_10007565
992 Ga0265325_10120331
993 Ga0265329_10000404
994 Ga0265340_10008141
995 Ga0265339_10007155
996 Ga0265331_10000430
997 Ga0265331_10013176
998 Ga0265327_10001819
999 Ga0265327_10010189
1000 Ga0265316_10000362
1001 Ga0265316_10008541
1002 Ga0265316_10010176
1003 Ga0265316_10047569
1004 Ga0265316_10428107
1005 Ga0265313_10000195
1006 Ga0265313_10006993
1007 Ga0265314_10000153
1008 Ga0265314_10002621
1009 Ga0265314_10044975
1010 Ga0265314_10194720
1011 Ga0265342_10001256
1012 Ga0265342_10117189
1013 Ga0307413_10143644
1014 Ga0307410_10119360
1015 Ga0307410_10431559
1016 Ga0307406_10083372
1017 Ga0307412_10261812
1018 Ga0307409_100129880
1019 Ga0307416_100345608
1020 Ga0307415_100509013
1021 Ga0307415_100655648
1022 Ga0373934_0014190
1023 Ga0373944_0020712
1024 Ga0373923_0021077
1025 Ga0373923_0049898
1026 Ga0373936_0153476
1027 Ga0373945_0012043
1028 Ga0373953_0000240
1029 Ga0373954_0000817
1030 Ga0373954_0067534
1031 Ga0373956_0005384
1032 Ga0373956_0037991
1033 Ga0373956_0042646
1034 Ga0373957_0001138
1035 Ga0373957_0053158
1036 Ga0373943_0010235
1037 Ga0373946_0030574
1038 Ga0373946_0039355
1039 Ga0373955_0001869
1040 Ga0373924_0005590
1041 Ga0373935_0018552
1042 Ga0373935_0034359
1043 Ga0373927_0039432
1044 Ga0373927_0088127
1045 Ga0373933_0001792
1046 Ga0373933_0021520
1047 Ga0373933_0377556
1048 Ga0373947_0231542
1049 Ga0373947_0299271
1050 Ga0373937_0012768
1051 Ga0373937_0030050
1052 Ga0373937_0061563
1053 Ga0373937_0149889
1054 Ga0373925_0013724
1055 Ga0373925_0345964
1056 Ga0395898_0004222
1057 Ga0436364_0129059
1058 Ga0436364_0810580
1059 Ga0395901_0036919
1060 Ga0242419_000107
1061 Ga0242420_000010
1062 Ga0436360_0192135
1063 Ga0436360_0256508
1064 Ga0436360_0497859
1065 Ga0436360_0590668
1066 Ga0436360_1034577
1067 Ga0436360_1282614
1068 Ga0436361_0025472
1069 Ga0436361_0075975
1070 Ga0436361_0221031
1071 Ga0436361_0314766
1072 Ga0436361_0466156
1073 Ga0436361_0910629
1074 Ga0436363_1515046
1075 Ga0439453_0027000
1076 Ga0451577_0028240
1077 Ga0451577_0066650
1078 Ga0451577_0385161
1079 Ga0453684_0183026
1080 Ga0451576_0377069
1081 Ga0495592_0000027
1082 Ga0495592_0013849
1083 Ga0495592_0116153
1084 Ga0495592_0144908
1085 Ga0495592_0177158
1086 Ga0495592_0177188
1087 Ga0495629_0178882
1088 Ga0495641_0023407
1089 Ga0495651_0002382
1090 Ga0495653_0010001
1091 Ga0495653_0031357
1092 Ga0495653_0187578
1093 Ga0495653_0319814
1094 Ga0495580_0063174
1095 Ga0495582_0085858
1096 Ga0495582_0095508
1097 Ga0495662_0097057
1098 Ga0495662_0105490
1099 Ga0495664_0012378
1100 Ga0495664_0021689
1101 Ga0495664_0358415
1102 Ga0495594_0048762
1103 Ga0495608_0026859
1104 Ga0495608_0046411
1105 Ga0495608_0048229
1106 Ga0495608_0054731
1107 Ga0495618_0001770
1108 Ga0495618_0004418
1109 Ga0495618_0014286
1110 Ga0495618_0043997
1111 Ga0495628_0001345
1112 Ga0495628_0018358
1113 Ga0495628_0055839
1114 Ga0495628_0095113
1115 Ga0495628_0153363
1116 Ga0495630_0012860
1117 Ga0495630_0039674
1118 Ga0495630_0077505
1119 Ga0495630_0282068
1120 Ga0495630_0569673
1121 Ga0495652_0002274
1122 Ga0495652_0014446
1123 Ga0495652_0056844
1124 Ga0495665_0011200
1125 Ga0495665_0017651
1126 Ga0495665_0180861
1127 Ga0495640_0003597
1128 Ga0495640_0040385
1129 Ga0495640_0132946
1130 Ga0495640_0278410
1131 Ga0495586_0000556
1132 Ga0495586_0005208
1133 Ga0495587_0001446
1134 Ga0495587_0004255
1135 Ga0495587_0256797
1136 Ga0495645_0001889
1137 Ga0495645_0003114
1138 Ga0495667_0002468
1139 Ga0495667_0011302
1140 Ga0495667_0025419
1141 Ga0495667_0070527
1142 Ga0495667_0112034
1143 Ga0495634_0001841
1144 Ga0495634_0037035
1145 Ga0495634_0195250
1146 Ga0495634_0232663
1147 Ga0495611_0261111
1148 Ga0495635_0027513
1149 Ga0495635_0058994
1150 Ga0495635_0216188
1151 Ga0495635_0434270
1152 Ga0495657_0034108
1153 Ga0495657_0076252
1154 Ga0495657_0236195
1155 Ga0495599_0000629
1156 Ga0495599_0058882
1157 Ga0495623_0141139
1158 Ga0495646_0005274
1159 Ga0495658_0271253
1160 Ga0495613_0006117
1161 Ga0495613_0021367
1162 Ga0495613_0034588
1163 Ga0495613_0385968
1164 Ga0495600_0005405
1165 Ga0495600_0017049
1166 Ga0495581_0006848
1167 Ga0495581_0020614
1168 Ga0495581_0029928
1169 Ga0495604_0006039
1170 Ga0495604_0010203
1171 Ga0495604_0255750
1172 Ga0495674_0023726
1173 Ga0495674_0036278
1174 Ga0495674_0048110
1175 Ga0495674_0104942
1176 Ga0495676_0014858
1177 Ga0495676_0052633
1178 Ga0495676_0090553
1179 Ga0495680_0121035
1180 Ga0495680_0192063
1181 Ga0495680_0750303
1182 Ga0495675_0176951
1183 Ga0495684_0020936
1184 Ga0495684_0029327
1185 Ga0495684_0101244
1186 Ga0495684_0161632
1187 Ga0495684_0189348
1188 Ga0495593_0127774
1189 Ga0495602_0004005
1190 Ga0495602_0030037
1191 Ga0495602_0097587
1192 Ga0495614_0021870
1193 Ga0496100_0164421
1194 Ga0496100_0197363
1195 Ga0496100_0212847
1196 Ga0496100_0399564
1197 Ga0496101_0153006
1198 Ga0496101_0183233
1199 Ga0496102_0163814
1200 Ga0496102_0192435
1201 Ga0496103_0135144
1202 Ga0496104_0004130
1203 Ga0496104_0134830
1204 Ga0496105_0017689
1205 Ga0496106_0007113
1206 Ga0496106_0187926
1207 Ga0496107_0005511
1208 Ga0496107_0017876
1209 Ga0496108_0006271
1210 Ga0496108_0031273
1211 Ga0496108_0194539
1212 Ga0496109_0008574
1213 Ga0496109_0088396
1214 Ga0496109_0206729
1215 Ga0496110_0000512
1216 Ga0496110_0103131
1217 Ga0496110_0220734
1218 Ga0496110_0634544
1219 Ga0496111_0000830
1220 Ga0496111_0013057
1221 Ga0496111_0493528
1222 Ga0496112_0004649
1223 Ga0496112_0017338
1224 Ga0496112_0089615
1225 Ga0496113_0093872
1226 Ga0496113_0257263
1227 Ga0496114_0129505
1228 Ga0496114_0186043
1229 Ga0496115_0003299
1230 Ga0496115_0016433
1231 Ga0496115_0033180
1232 Ga0496115_0143800
1233 Ga0501306_013891
1234 Ga0501306_014245
1235 Ga0501308_006706
1236 Ga0501308_015753
1237 Ga0501320_012707
1238 Ga0501321_011094
1239 Ga0501325_006673
1240 Ga0501340_006801
1241 Ga0501031_0010445
1242 Ga0501031_0070222
1243 Ga0501033_0111651
1244 Ga0501036_0004319
1245 Ga0501036_0131346
1246 Ga0501037_0050537
1247 Ga0501038_0005327
1248 Ga0501038_0122597
1249 Ga0501039_0000173
1250 Ga0501039_0059433
1251 Ga0501040_0000300
1252 Ga0501040_0051106
1253 Ga0501041_0000128
1254 Ga0501041_0020044
1255 Ga0501042_0001676
1256 Ga0501042_0114539
1257 Ga0501042_0391926
1258 Ga0501043_0015828
1259 Ga0501046_0001528
1260 Ga0501046_0047443
1261 Ga0501048_0064870
1262 Ga0501048_0091661
1263 Ga0501067_0134152
1264 Ga0501068_0048477
1265 Ga0501070_0017278
1266 Ga0501071_0031484
1267 Ga0501072_0000027
1268 Ga0501072_0040399
1269 Ga0501073_0169861
1270 Ga0501074_0092994
1271 Ga0501075_0011341
1272 Ga0501075_0128015
1273 Ga0501076_0000174
1274 Ga0501076_0061059
1275 Ga0501076_0318805
1276 Ga0501077_0001793
1277 Ga0501077_0118363
1278 Ga0501198_007321
1279 Ga0501199_005936
1280 Ga0501202_010017
1281 Ga0501209_000303
1282 Ga0501224_016777
1283 Ga0501227_038436
1284 Ga0501257_029536
1285 Ga0501261_025946
1286 Ga0501221_014093
1287 Ga0501225_0025313
1288 Ga0501079_0008813
1289 Ga0501079_0236835
1290 Ga0501080_0233855
1291 Ga0501081_0001043
1292 Ga0501081_0033311
1293 Ga0501083_0086061
1294 Ga0501279_028971
1295 Ga0501035_0035288
1296 Ga0501035_0258053
1297 Ga0501045_0001462
1298 Ga0501045_0146676
1299 Ga0501212_006959
1300 Ga0501226_012996
1301 nmdc:mga05p37_388814_c1
1302 nmdc:mga05p37_4648_c1
1303 nmdc:mga09592_2706_c1
1304 nmdc:mga09592_612547_c1
1305 nmdc:mga09592_639437_c1
1306 nmdc:mga09592_99956_c1
1307 nmdc:mga0qj67_120664_c1
1308 nmdc:mga0qj67_612928_c1
1309 nmdc:mga0qj67_6495_c1
1310 nmdc:mga06r32_2432_c1
1311 nmdc:mga06r32_414533_c1
1312 nmdc:mga06r32_439347_c1
1313 nmdc:mga08y16_172467_c1
1314 nmdc:mga08y16_27156_c1
1315 nmdc:mga08y16_344722_c1
1316 nmdc:mga08y16_5009_c1
1317 nmdc:mga0n895_105669_c1
1318 nmdc:mga0n895_106370_c1
1319 nmdc:mga0n895_1233_c1
1320 nmdc:mga0n895_31972_c1
1321 nmdc:mga0n895_331859_c1
1322 nmdc:mga0n895_466153_c1
1323 nmdc:mga0n895_533370_c1
1324 nmdc:mga0n895_646937_c1
1325 nmdc:mga0rr50_125393_c1
1326 nmdc:mga0rr50_202191_c1
1327 nmdc:mga0rr50_252220_c1
1328 nmdc:mga0rr50_329452_c1
1329 nmdc:mga0rr50_628144_c1
1330 nmdc:mga08x19_14121_c2
1331 nmdc:mga08x19_154688_c1
1332 nmdc:mga08x19_34515_c1
1333 nmdc:mga08x19_75786_c1
1334 nmdc:mga0a205_138527_c1
1335 nmdc:mga0a205_14043_c1
1336 nmdc:mga0a205_164715_c1
1337 nmdc:mga0a205_259670_c1
1338 nmdc:mga0a205_400171_c1
1339 nmdc:mga0a205_506024_c1
1340 Ga0495601_0016763
1341 Ga0495601_0189035
1342 Ga0495612_0004203
1343 Ga0495612_0045075
1344 Ga0495612_0139468
1345 Ga0495595_0016118
1346 Ga0495595_0038390
1347 Ga0495595_0091961
1348 Ga0495619_0001416
1349 Ga0495619_0049653
1350 Ga0495619_0148728
1351 Ga0495619_0257092
1352 Ga0501084_0012459
1353 Ga0501084_0122540
1354 Ga0587075_030162
1355 Ga0501082_0000992
1356 Ga0530510_0054664

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05988

DUF899

Bacterial protein of unknown function (DUF899)

20

251

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5io2-assembly1.cif.gz_A xanthomonas campestris peroxiredoxin q - c48s mutant 0.7414 75 214
5iph-assembly1.cif.gz_A xanthomonas campestris peroxiredoxin q - c84s mutant 0.7404 75 214
5imf-assembly1.cif.gz_A xanthomonas campestris peroxiredoxin q - structure f5 0.7375 75 214
5b6n-assembly2.cif.gz_D crystal structures of human peroxiredoxin 6 in sulfinic acid state 0.7189 67 215
3gkn-assembly1.cif.gz_A insights into the alkyl peroxide reduction activity of xanthomonas campestris bacterioferritin comigratory protein from the trapped intermediate/ligand complex structures 0.7122 75 200
ID Description Score Start End Superfamily
1px2A03 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.7576 194 216 3.30.470.20
5bpfD02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.7477 192 215 3.30.470.20
af_P21264_187_380_3.30.470.20 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.7468 187 214 3.30.470.20
af_Q9D1A0_27_140_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.744 75 173 3.40.30.10
af_A0A0R0K508_6_109_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.7313 71 161 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A534NQD4-F1-model_v4 DUF899 domain-containing protein 0.9724 30 188
AF-A0A535QUL9-F1-model_v4 DUF899 domain-containing protein 0.9704 28 218
AF-A0A529XNE9-F1-model_v4 DUF899 domain-containing protein 0.9635 28 201
AF-A0A2S6R5Q2-F1-model_v4 Thioredoxin domain-containing protein 0.9617 28 202
AF-A0A443G402-F1-model_v4 deleted 0.9589 30 187

Map