F474633

General Info

Members Datasets Scaffolds Average Seq Length
678 281 1356 125

Family's Representative Sequence

Representative Sequence 3300005539|Ga0068853_101974408|Ga0068853_1019744081
Length 139
Sequence VQRFEPRAMIRAAVAVDLVIDIDNTPGALAAVAAAISDAGVNIAAATCIGPGDRAELHILVPHAEAARHSLAISHLAVSREREVVVVDVEDRPGVLADLTRRIARAGVDLDLVYVATRNRVVFGATDLPALRAALEGST

Samples

Sample ID Description Type Environment
1 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300012480 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
95 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
96 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
97 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
148 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
149 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
150 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
151 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
152 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
153 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
154 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
155 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
156 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
157 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
158 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
159 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
160 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
161 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
162 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
163 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
164 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
165 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
168 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
169 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
170 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
171 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
172 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
173 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
174 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
175 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
176 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
177 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
178 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
179 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
180 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
181 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
182 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
183 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
184 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
185 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
186 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
187 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
188 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
189 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
190 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
191 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
192 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
193 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
194 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
195 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
196 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
197 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
198 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
199 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
200 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
201 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
202 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
203 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
204 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
205 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
206 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
207 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
208 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
209 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
210 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
211 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
212 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
213 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
214 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
215 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
216 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
217 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
218 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
219 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
220 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
221 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
222 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
223 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
224 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
225 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
226 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
227 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
228 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
229 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
230 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
231 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
232 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
233 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
234 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
235 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
236 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
237 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
238 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
239 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
240 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
241 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
242 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
243 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
244 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
245 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
246 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
247 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
248 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
249 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
250 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
251 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
252 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
253 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
254 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
255 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
256 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
261 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
262 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
263 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
264 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
265 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
266 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
267 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
268 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
269 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
270 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
271 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
272 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
273 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
274 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
275 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
276 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
277 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
278 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
279 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
280 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
281 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.15
Nodule 0
Rhizoplane 14.6
Rhizosphere 79.79
Stem 0
Stem Tuber 0
Unclassified 9.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068853_101974408 3300005539 Bacteria 566
2 JGI24737J22298_10245153 3300001990 Bacteria 529
3 JGI25407J50210_10076613 3300003373 Unclassified 832
4 Ga0070683_100020231 3300005329 Bacteria 5921
5 Ga0070683_100273607 3300005329 Bacteria 1606
6 Ga0070683_100332171 3300005329 Unclassified 1447
7 Ga0070683_100848287 3300005329 Bacteria 876
8 Ga0070690_100217413 3300005330 Bacteria 1337
9 Ga0070690_101333084 3300005330 Bacteria 576
10 Ga0068869_100398030 3300005334 Bacteria 1132
11 Ga0070680_100405845 3300005336 Bacteria 1162
12 Ga0070682_100121324 3300005337 Bacteria 1755
13 Ga0068868_100007217 3300005338 Bacteria 7898
14 Ga0070660_101726375 3300005339 Bacteria 533
15 Ga0070689_100630579 3300005340 Bacteria 931
16 Ga0070691_10078552 3300005341 Bacteria 1612
17 Ga0070687_100627184 3300005343 Bacteria 742
18 Ga0070661_100259522 3300005344 Bacteria 1343
19 Ga0070661_100655914 3300005344 Bacteria 852
20 Ga0070661_100836542 3300005344 Bacteria 757
21 Ga0070692_10177826 3300005345 Bacteria 1231
22 Ga0070668_100098125 3300005347 Bacteria 2318
23 Ga0070668_100536570 3300005347 Bacteria 1017
24 Ga0070669_100420388 3300005353 Bacteria 1097
25 Ga0070671_100297864 3300005355 Bacteria 1373
26 Ga0070671_100671594 3300005355 Bacteria 898
27 Ga0070674_100149840 3300005356 Bacteria 1759
28 Ga0070674_100800303 3300005356 Bacteria 814
29 Ga0070673_100084629 3300005364 Bacteria 2580
30 Ga0070688_100528454 3300005365 Bacteria 894
31 Ga0070659_100136851 3300005366 Bacteria 1992
32 Ga0070659_100804338 3300005366 Bacteria 818
33 Ga0070714_100185559 3300005435 Unclassified 1895
34 Ga0070714_100443598 3300005435 Bacteria 1232
35 Ga0070714_100878787 3300005435 Unclassified 870
36 Ga0070714_101706813 3300005435 Bacteria 615
37 Ga0070713_100093414 3300005436 Bacteria 2592
38 Ga0070713_101277206 3300005436 Bacteria 711
39 Ga0070710_11304212 3300005437 Bacteria 540
40 Ga0070711_100030449 3300005439 Bacteria 3572
41 Ga0070705_100462853 3300005440 Bacteria 954
42 Ga0070700_100008366 3300005441 Bacteria 5632
43 Ga0070700_100057515 3300005441 Bacteria 2440
44 Ga0070700_100424478 3300005441 Bacteria 1005
45 Ga0070678_100270325 3300005456 Bacteria 1433
46 Ga0070678_100316160 3300005456 Bacteria 1332
47 Ga0070662_100730084 3300005457 Bacteria 839
48 Ga0068867_101124711 3300005459 Bacteria 718
49 Ga0070685_10016505 3300005466 Bacteria 3935
50 Ga0070684_100079013 3300005535 Bacteria 2908
51 Ga0070684_100116540 3300005535 Unclassified 2399
52 Ga0070684_100415756 3300005535 Bacteria 1241
53 Ga0070684_101131112 3300005535 Bacteria 736
54 Ga0070672_100150624 3300005543 Unclassified 1924
55 Ga0070672_100311759 3300005543 Unclassified 1336
56 Ga0070686_100057126 3300005544 Unclassified 2506
57 Ga0070693_100258532 3300005547 Bacteria 1157
58 Ga0070693_100345268 3300005547 Bacteria 1017
59 Ga0070665_101321045 3300005548 Bacteria 731
60 Ga0070704_100445841 3300005549 Bacteria 1113
61 Ga0070664_100172483 3300005564 Bacteria 1919
62 Ga0068857_100123931 3300005577 Bacteria 2328
63 Ga0068854_100024509 3300005578 Bacteria 4131
64 Ga0068856_100147700 3300005614 Bacteria 2359
65 Ga0068856_100671627 3300005614 Bacteria 1057
66 Ga0068856_101103686 3300005614 Bacteria 811
67 Ga0070702_100023875 3300005615 Bacteria 3255
68 Ga0070702_100876199 3300005615 Bacteria 701
69 Ga0068852_100499755 3300005616 Bacteria 1211
70 Ga0068852_100611244 3300005616 Bacteria 1095
71 Ga0068852_101481747 3300005616 Bacteria 701
72 Ga0068859_100732094 3300005617 Bacteria 1079
73 Ga0068859_100832931 3300005617 Bacteria 1009
74 Ga0068864_100045468 3300005618 Bacteria 3766
75 Ga0068864_100148829 3300005618 Unclassified 2119
76 Ga0068861_100366118 3300005719 Unclassified 1269
77 Ga0068870_10208900 3300005840 Bacteria 1188
78 Ga0068863_100358451 3300005841 Bacteria 1421
79 Ga0068863_100362827 3300005841 Bacteria 1412
80 Ga0068863_101682334 3300005841 Bacteria 644
81 Ga0068858_100257521 3300005842 Bacteria 1658
82 Ga0068858_100342214 3300005842 Bacteria 1432
83 Ga0068862_101470571 3300005844 Bacteria 686
84 Ga0081455_10262080 3300005937 Bacteria 1258
85 Ga0081455_10668523 3300005937 Bacteria 666
86 Ga0081538_10000161 3300005981 Bacteria 70862
87 Ga0081538_10001190 3300005981 Bacteria 27425
88 Ga0081538_10006492 3300005981 Bacteria 10289
89 Ga0081538_10009947 3300005981 Bacteria 7857
90 Ga0081538_10069293 3300005981 Bacteria 1955
91 Ga0081538_10099899 3300005981 Bacteria 1465
92 Ga0081539_10374604 3300005985 Bacteria 595
93 Ga0070717_10008123 3300006028 Bacteria 7830
94 Ga0070717_10045368 3300006028 Bacteria 3593
95 Ga0070717_10593148 3300006028 Bacteria 1005
96 Ga0070715_10010258 3300006163 Bacteria 3334
97 Ga0070716_100082410 3300006173 Bacteria 1924
98 Ga0070716_100960200 3300006173 Bacteria 673
99 Ga0070712_100017320 3300006175 Bacteria 4663
100 Ga0070712_100201769 3300006175 Bacteria 1563
101 Ga0070712_100628501 3300006175 Bacteria 911
102 Ga0068871_102103438 3300006358 Bacteria 538
103 Ga0075428_100036230 3300006844 Bacteria 5435
104 Ga0075428_100130460 3300006844 Bacteria 2734
105 Ga0075428_100234842 3300006844 Bacteria 1978
106 Ga0075428_100481931 3300006844 Bacteria 1328
107 Ga0075428_101948285 3300006844 Bacteria 610
108 Ga0075430_100000305 3300006846 Bacteria 34764
109 Ga0075430_100083700 3300006846 Bacteria 2672
110 Ga0075431_100134835 3300006847 Bacteria 2545
111 Ga0075431_100167777 3300006847 Bacteria 2256
112 Ga0075431_100179048 3300006847 Bacteria 2176
113 Ga0075433_10011882 3300006852 Bacteria 7015
114 Ga0075433_10040469 3300006852 Bacteria 4035
115 Ga0075434_100088233 3300006871 Bacteria 3102
116 Ga0075434_100201009 3300006871 Bacteria 2013
117 Ga0075429_100282687 3300006880 Bacteria 1453
118 Ga0075429_100328190 3300006880 Archaea 1339
119 Ga0068865_100806730 3300006881 Bacteria 810
120 Ga0068865_101830786 3300006881 Bacteria 549
121 Ga0075436_100084805 3300006914 Bacteria 2199
122 Ga0075436_100436643 3300006914 Bacteria 952
123 Ga0097620_100732116 3300006931 Bacteria 1079
124 Ga0097620_100832851 3300006931 Bacteria 1009
125 Ga0075435_100018936 3300007076 Bacteria 5246
126 Ga0075435_100085404 3300007076 Bacteria 2598
127 Ga0099795_10451939 3300007788 Bacteria 592
128 Ga0105240_10920323 3300009093 Bacteria 939
129 Ga0105240_11424564 3300009093 Bacteria 728
130 Ga0105240_12640729 3300009093 Bacteria 519
131 Ga0111539_10017887 3300009094 Bacteria 8779
132 Ga0111539_10022996 3300009094 Bacteria 7654
133 Ga0111539_10290803 3300009094 Bacteria 1901
134 Ga0111539_10487713 3300009094 Bacteria 1435
135 Ga0111539_11722470 3300009094 Bacteria 727
136 Ga0111539_12188711 3300009094 Bacteria 641
137 Ga0111539_12532706 3300009094 Bacteria 595
138 Ga0105245_10001866 3300009098 Bacteria 19157
139 Ga0105245_10807314 3300009098 Bacteria 976
140 Ga0105245_10907519 3300009098 Bacteria 923
141 Ga0105245_11232297 3300009098 Bacteria 796
142 Ga0105245_11327789 3300009098 Unclassified 768
143 Ga0105245_11555130 3300009098 Bacteria 713
144 Ga0105245_12485193 3300009098 Bacteria 571
145 Ga0114129_10003125 3300009147 Bacteria 23224
146 Ga0114129_10012141 3300009147 Bacteria 12265
147 Ga0114129_10071561 3300009147 Bacteria 4835
148 Ga0114129_10336941 3300009147 Bacteria 2002
149 Ga0114129_10526650 3300009147 Bacteria 1540
150 Ga0114129_10725583 3300009147 Bacteria 1275
151 Ga0114129_11045900 3300009147 Bacteria 1025
152 Ga0105243_10191599 3300009148 Bacteria 1786
153 Ga0105243_10218521 3300009148 Bacteria 1683
154 Ga0105243_10294335 3300009148 Bacteria 1468
155 Ga0105248_10940637 3300009177 Bacteria 976
156 Ga0105248_11317213 3300009177 Bacteria 817
157 Ga0105248_12092065 3300009177 Bacteria 644
158 Ga0105237_10146661 3300009545 Unclassified 2355
159 Ga0105249_10645564 3300009553 Bacteria 1116
160 Ga0105249_12313573 3300009553 Bacteria 610
161 Ga0105249_13456670 3300009553 Bacteria 508
162 Ga0105239_10015525 3300010375 Bacteria 8434
163 Ga0105239_10737353 3300010375 Bacteria 1127
164 Ga0105239_10883524 3300010375 Bacteria 1026
165 Ga0105239_11286551 3300010375 Bacteria 843
166 Ga0105239_12711301 3300010375 Bacteria 578
167 Ga0105246_10107149 3300011119 Bacteria 2046
168 Ga0105246_10128027 3300011119 Bacteria 1892
169 Ga0105246_10462375 3300011119 Bacteria 1069
170 Ga0157346_1009127 3300012480 Bacteria 696
171 Ga0157371_10792065 3300013102 Bacteria 714
172 Ga0157374_10014037 3300013296 Bacteria 7002
173 Ga0157374_10269193 3300013296 Bacteria 1679
174 Ga0157378_11301947 3300013297 Bacteria 768
175 Ga0157378_12337514 3300013297 Bacteria 586
176 Ga0163162_10880979 3300013306 Bacteria 1009
177 Ga0163162_11077762 3300013306 Bacteria 910
178 Ga0157372_10060642 3300013307 Bacteria 4233
179 Ga0157372_10169721 3300013307 Unclassified 2524
180 Ga0157372_10698180 3300013307 Bacteria 1181
181 Ga0157372_11202775 3300013307 Bacteria 876
182 Ga0157375_10290410 3300013308 Bacteria 1798
183 Ga0157375_10487017 3300013308 Bacteria 1398
184 Ga0157375_11872539 3300013308 Bacteria 712
185 Ga0157375_12623540 3300013308 Bacteria 602
186 Ga0163163_10030502 3300014325 Bacteria 5196
187 Ga0163163_10220694 3300014325 Bacteria 1944
188 Ga0163163_12563319 3300014325 Unclassified 568
189 Ga0157380_10039979 3300014326 Bacteria 3650
190 Ga0182008_10728228 3300014497 Unclassified 569
191 Ga0157377_10005356 3300014745 Bacteria 6022
192 Ga0157379_10300475 3300014968 Bacteria 1463
193 Ga0157379_10490355 3300014968 Bacteria 1138
194 Ga0157376_10507512 3300014969 Bacteria 1186
195 Ga0213874_10070790 3300021377 Bacteria 1112
196 Ga0213876_10014992 3300021384 Bacteria 4108
197 Ga0213876_10038519 3300021384 Bacteria 2524
198 Ga0213875_10008521 3300021388 Bacteria 5246
199 Ga0213875_10010406 3300021388 Bacteria 4656
200 Ga0213875_10053471 3300021388 Bacteria 1891
201 Ga0207656_10350308 3300025321 Bacteria 737
202 Ga0207653_10385013 3300025885 Bacteria 549
203 Ga0207692_10037722 3300025898 Bacteria 2366
204 Ga0207692_11033458 3300025898 Bacteria 543
205 Ga0207642_10050308 3300025899 Bacteria 1879
206 Ga0207642_10099637 3300025899 Bacteria 1455
207 Ga0207688_10121666 3300025901 Bacteria 1523
208 Ga0207685_10008603 3300025905 Bacteria 2918
209 Ga0207643_10587936 3300025908 Bacteria 716
210 Ga0207643_10747034 3300025908 Bacteria 633
211 Ga0207693_10006427 3300025915 Bacteria 9738
212 Ga0207693_10062053 3300025915 Bacteria 2928
213 Ga0207663_10148456 3300025916 Unclassified 1642
214 Ga0207663_10519961 3300025916 Bacteria 927
215 Ga0207663_10582186 3300025916 Bacteria 878
216 Ga0207663_10828401 3300025916 Bacteria 738
217 Ga0207660_10390453 3300025917 Bacteria 1120
218 Ga0207660_11017345 3300025917 Bacteria 676
219 Ga0207662_10170877 3300025918 Bacteria 1394
220 Ga0207662_10190050 3300025918 Bacteria 1325
221 Ga0207662_10256341 3300025918 Unclassified 1150
222 Ga0207662_10608934 3300025918 Bacteria 760
223 Ga0207657_10383435 3300025919 Bacteria 1106
224 Ga0207649_10330394 3300025920 Bacteria 1123
225 Ga0207681_10411000 3300025923 Bacteria 1095
226 Ga0207681_10515465 3300025923 Unclassified 981
227 Ga0207687_10078963 3300025927 Bacteria 2371
228 Ga0207687_10625738 3300025927 Bacteria 909
229 Ga0207700_10054490 3300025928 Bacteria 3002
230 Ga0207700_10872785 3300025928 Bacteria 805
231 Ga0207700_11379242 3300025928 Bacteria 627
232 Ga0207664_10570049 3300025929 Bacteria 1016
233 Ga0207664_11064896 3300025929 Unclassified 724
234 Ga0207664_11246010 3300025929 Bacteria 663
235 Ga0207644_10771813 3300025931 Bacteria 803
236 Ga0207690_10012872 3300025932 Bacteria 5013
237 Ga0207690_10281363 3300025932 Bacteria 1295
238 Ga0207706_10460200 3300025933 Bacteria 1100
239 Ga0207709_10414889 3300025935 Bacteria 1033
240 Ga0207669_10191239 3300025937 Bacteria 1477
241 Ga0207669_10688013 3300025937 Bacteria 839
242 Ga0207704_10292918 3300025938 Bacteria 1243
243 Ga0207665_10148908 3300025939 Bacteria 1675
244 Ga0207665_10493473 3300025939 Bacteria 945
245 Ga0207691_10145826 3300025940 Bacteria 2084
246 Ga0207691_10271783 3300025940 Bacteria 1459
247 Ga0207711_11034146 3300025941 Bacteria 761
248 Ga0207689_10273801 3300025942 Bacteria 1398
249 Ga0207661_10123490 3300025944 Bacteria 2208
250 Ga0207661_10224821 3300025944 Unclassified 1660
251 Ga0207661_10696422 3300025944 Bacteria 934
252 Ga0207661_10916794 3300025944 Bacteria 807
253 Ga0207661_11043160 3300025944 Bacteria 753
254 Ga0207679_10023065 3300025945 Bacteria 4249
255 Ga0207679_11022732 3300025945 Bacteria 758
256 Ga0207651_10189008 3300025960 Bacteria 1641
257 Ga0207712_10162550 3300025961 Bacteria 1737
258 Ga0207712_11189479 3300025961 Bacteria 680
259 Ga0207668_10281651 3300025972 Bacteria 1364
260 Ga0207668_10475021 3300025972 Bacteria 1071
261 Ga0207640_10133920 3300025981 Bacteria 1796
262 Ga0207640_10288955 3300025981 Bacteria 1292
263 Ga0207640_11590397 3300025981 Unclassified 589
264 Ga0207677_10532126 3300026023 Bacteria 1021
265 Ga0207703_10428016 3300026035 Bacteria 1233
266 Ga0207703_11470894 3300026035 Bacteria 655
267 Ga0207639_10448251 3300026041 Bacteria 1171
268 Ga0207678_10339140 3300026067 Bacteria 1295
269 Ga0207708_10001537 3300026075 Bacteria 17196
270 Ga0207708_10005798 3300026075 Bacteria 9129
271 Ga0207708_10298809 3300026075 Bacteria 1309
272 Ga0207708_10875154 3300026075 Bacteria 776
273 Ga0207708_11251568 3300026075 Bacteria 649
274 Ga0207702_10057259 3300026078 Bacteria 3312
275 Ga0207702_10904139 3300026078 Bacteria 875
276 Ga0207641_10201343 3300026088 Bacteria 1836
277 Ga0207648_10121599 3300026089 Bacteria 2296
278 Ga0207648_11110801 3300026089 Bacteria 742
279 Ga0207676_10571569 3300026095 Bacteria 1082
280 Ga0207676_11153659 3300026095 Bacteria 767
281 Ga0207674_10126205 3300026116 Bacteria 2525
282 Ga0207675_100240991 3300026118 Bacteria 1747
283 Ga0207675_100343531 3300026118 Bacteria 1461
284 Ga0207675_100695492 3300026118 Bacteria 1025
285 Ga0207683_10128331 3300026121 Bacteria 2280
286 Ga0207683_10206932 3300026121 Bacteria 1785
287 Ga0207683_10413586 3300026121 Bacteria 1241
288 Ga0207683_11091991 3300026121 Bacteria 740
289 Ga0207698_10022969 3300026142 Bacteria 4350
290 Ga0207698_10242834 3300026142 Bacteria 1643
291 Ga0207428_10070588 3300027907 Bacteria 2745
292 Ga0207428_10072907 3300027907 Bacteria 2695
293 Ga0207428_10246609 3300027907 Bacteria 1333
294 Ga0268266_11667792 3300028379 Bacteria 613
295 Ga0268265_10847859 3300028380 Bacteria 894
296 Ga0268264_10718872 3300028381 Bacteria 993
297 Ga0268264_10940332 3300028381 Bacteria 869
298 Ga0307408_100636769 3300031548 Bacteria 952
299 Ga0307408_100646630 3300031548 Unclassified 945
300 Ga0307405_10287430 3300031731 Bacteria 1241
301 Ga0307413_10134833 3300031824 Bacteria 1696
302 Ga0307413_10941934 3300031824 Bacteria 736
303 Ga0307406_10171016 3300031901 Bacteria 1572
304 Ga0307406_10275549 3300031901 Bacteria 1280
305 Ga0307406_10329772 3300031901 Bacteria 1184
306 Ga0307406_10386652 3300031901 Bacteria 1105
307 Ga0307406_10456929 3300031901 Bacteria 1026
308 Ga0307406_11461269 3300031901 Bacteria 601
309 Ga0307406_11895126 3300031901 Bacteria 531
310 Ga0307407_10368420 3300031903 Bacteria 1022
311 Ga0307409_100055649 3300031995 Bacteria 3056
312 Ga0307409_100148517 3300031995 Bacteria 2031
313 Ga0307409_100433921 3300031995 Bacteria 1264
314 Ga0307409_100731611 3300031995 Bacteria 992
315 Ga0307409_100832091 3300031995 Bacteria 933
316 Ga0307409_101429874 3300031995 Bacteria 718
317 Ga0307416_100216957 3300032002 Bacteria 1831
318 Ga0307416_100358835 3300032002 Bacteria 1479
319 Ga0307416_100566347 3300032002 Bacteria 1211
320 Ga0307416_100677924 3300032002 Bacteria 1118
321 Ga0307416_100682953 3300032002 Bacteria 1114
322 Ga0307416_100817570 3300032002 Bacteria 1028
323 Ga0307414_10571943 3300032004 Bacteria 1010
324 Ga0307414_10899848 3300032004 Bacteria 811
325 Ga0307411_10124704 3300032005 Bacteria 1871
326 Ga0307411_11270851 3300032005 Bacteria 670
327 Ga0307411_12065055 3300032005 Bacteria 533
328 Ga0307415_100001792 3300032126 Bacteria 10511
329 Ga0307415_100484712 3300032126 Bacteria 1077
330 Ga0307415_100556396 3300032126 Bacteria 1013
331 Ga0307415_100898829 3300032126 Bacteria 816
332 Ga0307415_100964487 3300032126 Bacteria 790
333 Ga0307415_101590569 3300032126 Bacteria 628
334 Ga0307415_102384137 3300032126 Bacteria 520
335 Ga0373952_0161641 3300035092 Bacteria 635
336 Ga0373956_0366322 3300035119 Unclassified 687
337 Ga0373943_0730724 3300035170 Bacteria 587
338 Ga0373946_0151863 3300035171 Unclassified 1081
339 Ga0373946_0283271 3300035171 Bacteria 816
340 Ga0373946_0490827 3300035171 Unclassified 629
341 Ga0373962_0347111 3300035242 Bacteria 536
342 Ga0373931_0852349 3300035691 Bacteria 610
343 Ga0373933_0083493 3300035724 Bacteria 1962
344 Ga0373947_0011479 3300035725 Bacteria 5081
345 Ga0373947_0256879 3300035725 Bacteria 1157
346 Ga0373947_0424147 3300035725 Unclassified 899
347 Ga0373937_0076403 3300036401 Bacteria 3093
348 Ga0373925_0744577 3300037068 Bacteria 808
349 Ga0373925_1347969 3300037068 Bacteria 585
350 Ga0395900_0644089 3300037418 Bacteria 997
351 Ga0395898_0191734 3300037466 Bacteria 1953
352 Ga0395898_1098524 3300037466 Bacteria 729
353 Ga0395898_1728396 3300037466 Unclassified 548
354 Ga0395905_0912325 3300037471 Bacteria 781
355 Ga0436364_0409665 3300037853 Bacteria 38199
356 Ga0436364_0635889 3300037853 Bacteria 1257
357 Ga0436364_0641931 3300037853 Bacteria 1633
358 Ga0436364_0744938 3300037853 Unclassified 1669
359 Ga0436364_1007040 3300037853 Bacteria 9318
360 Ga0436364_1243548 3300037853 Bacteria 5141
361 Ga0436364_1555211 3300037853 Bacteria 693
362 Ga0395901_0147054 3300038443 Bacteria 2477
363 Ga0395901_0604002 3300038443 Archaea 1106
364 Ga0436365_0104441 3300039437 Bacteria 6758
365 Ga0436365_0249140 3300039437 Unclassified 1286
366 Ga0436365_0451332 3300039437 Bacteria 705
367 Ga0436365_0472093 3300039437 Unclassified 4085
368 Ga0436365_0791442 3300039437 Unclassified 574
369 Ga0436365_1072604 3300039437 Bacteria 12891
370 Ga0436365_1105483 3300039437 Bacteria 1669
371 Ga0436365_1481009 3300039437 Bacteria 10435
372 Ga0436365_1845929 3300039437 Bacteria 618
373 Ga0436360_0923265 3300039438 Bacteria 985
374 Ga0436361_1041807 3300039447 Bacteria 692
375 Ga0436363_0368838 3300039450 Bacteria 1113
376 Ga0436363_0580895 3300039450 Bacteria 2014
377 Ga0436363_0630114 3300039450 Bacteria 901
378 Ga0436363_0802706 3300039450 Bacteria 1950
379 Ga0436363_0988986 3300039450 Unclassified 710
380 Ga0436363_1000230 3300039450 Bacteria 1170
381 Ga0436363_1099012 3300039450 Bacteria 6068
382 Ga0436363_1139452 3300039450 Bacteria 975
383 Ga0436363_1222598 3300039450 Bacteria 8059
384 Ga0436363_1324569 3300039450 Bacteria 605
385 Ga0436363_1372823 3300039450 Bacteria 724
386 Ga0436363_1586151 3300039450 Unclassified 1382
387 Ga0436363_1603745 3300039450 Bacteria 1522
388 Ga0436362_0949618 3300039453 Bacteria 1335
389 Ga0451853_1647767 3300041512 Bacteria 620
390 Ga0451853_2510223 3300041512 Bacteria 1160
391 Ga0439448_0169274 3300042005 Bacteria 762
392 Ga0439455_0044298 3300042012 Bacteria 1148
393 Ga0439463_018276 3300042016 Bacteria 1744
394 Ga0439458_0023283 3300042157 Bacteria 1444
395 Ga0439459_0005208 3300042438 Unclassified 2127
396 Ga0439464_0037414 3300042439 Bacteria 1376
397 Ga0439460_0029502 3300042461 Bacteria 1553
398 Ga0439460_0062954 3300042461 Unclassified 1136
399 Ga0439440_0026484 3300042993 Bacteria 1342
400 Ga0466969_0008292 3300044656 Bacteria 5513
401 Ga0466969_0046675 3300044656 Bacteria 2147
402 Ga0466969_0056957 3300044656 Bacteria 1907
403 Ga0466969_0110370 3300044656 Bacteria 1288
404 Ga0466969_0158352 3300044656 Bacteria 1041
405 Ga0466972_0225060 3300044658 Bacteria 878
406 Ga0466965_0027072 3300044683 Bacteria 2781
407 Ga0466965_0182205 3300044683 Bacteria 1108
408 Ga0466965_0286509 3300044683 Bacteria 891
409 Ga0466965_0480296 3300044683 Unclassified 695
410 Ga0466966_0210551 3300044684 Bacteria 1175
411 Ga0466966_0290821 3300044684 Bacteria 982
412 Ga0466966_0347403 3300044684 Bacteria 891
413 Ga0466966_0476050 3300044684 Unclassified 751
414 Ga0466961_0109054 3300044693 Bacteria 1742
415 Ga0466961_0388387 3300044693 Bacteria 847
416 Ga0466961_0447831 3300044693 Bacteria 781
417 Ga0466961_0789423 3300044693 Bacteria 567
418 Ga0466963_0011144 3300044694 Bacteria 5469
419 Ga0466963_0032270 3300044694 Bacteria 3390
420 Ga0466963_0319315 3300044694 Unclassified 1093
421 Ga0466963_0380501 3300044694 Bacteria 995
422 Ga0466963_0516440 3300044694 Bacteria 843
423 Ga0466964_0145124 3300044706 Bacteria 1095
424 Ga0466964_0149240 3300044706 Bacteria 1082
425 Ga0466964_0260235 3300044706 Bacteria 859
426 Ga0466971_0150589 3300044719 Bacteria 1086
427 Ga0466971_0269758 3300044719 Bacteria 813
428 Ga0466971_0316597 3300044719 Unclassified 751
429 Ga0466971_0560663 3300044719 Bacteria 567
430 Ga0466968_0021181 3300044735 Bacteria 2631
431 Ga0466968_0032781 3300044735 Bacteria 2162
432 Ga0466968_0147602 3300044735 Bacteria 1079
433 Ga0466968_0157043 3300044735 Unclassified 1048
434 Ga0466968_0201586 3300044735 Bacteria 932
435 Ga0466968_0710565 3300044735 Unclassified 514
436 Ga0466970_0022236 3300044765 Bacteria 3310
437 Ga0466970_0132391 3300044765 Bacteria 1370
438 Ga0466970_0201273 3300044765 Bacteria 1108
439 Ga0466970_0335441 3300044765 Bacteria 856
440 Ga0466957_0041772 3300044842 Bacteria 2773
441 Ga0466957_0041931 3300044842 Bacteria 2768
442 Ga0466957_0067561 3300044842 Bacteria 2205
443 Ga0466957_0168889 3300044842 Bacteria 1424
444 Ga0466957_0551961 3300044842 Bacteria 803
445 Ga0466957_0555344 3300044842 Bacteria 800
446 Ga0466960_0007698 3300044901 Bacteria 4389
447 Ga0466960_0011422 3300044901 Bacteria 3716
448 Ga0466960_0421395 3300044901 Unclassified 772
449 Ga0466959_0006761 3300045049 Bacteria 7987
450 Ga0466959_0070658 3300045049 Bacteria 2529
451 Ga0466959_0315441 3300045049 Unclassified 1069
452 Ga0466959_0340950 3300045049 Bacteria 1022
453 Ga0466959_0380840 3300045049 Bacteria 960
454 Ga0466959_0512163 3300045049 Bacteria 811
455 Ga0466959_0555121 3300045049 Unclassified 774
456 Ga0466959_1052815 3300045049 Unclassified 541
457 Ga0466958_0003671 3300045836 Bacteria 8008
458 Ga0466958_0010607 3300045836 Bacteria 5165
459 Ga0466958_0010653 3300045836 Bacteria 5156
460 Ga0466958_0017736 3300045836 Bacteria 4122
461 Ga0466958_0141807 3300045836 Bacteria 1513
462 Ga0466958_0181001 3300045836 Unclassified 1337
463 Ga0466958_0182266 3300045836 Bacteria 1333
464 Ga0466958_0320443 3300045836 Bacteria 996
465 Ga0466958_0424177 3300045836 Bacteria 860
466 Ga0466958_0493937 3300045836 Bacteria 794
467 Ga0466958_0606713 3300045836 Unclassified 712
468 Ga0466967_0023813 3300045976 Bacteria 5023
469 Ga0466967_0034816 3300045976 Bacteria 4279
470 Ga0466967_0068049 3300045976 Bacteria 3178
471 Ga0466967_0068481 3300045976 Bacteria 3170
472 Ga0466967_0119701 3300045976 Bacteria 2431
473 Ga0466967_0119867 3300045976 Bacteria 2429
474 Ga0466967_0170546 3300045976 Bacteria 2047
475 Ga0466967_0190308 3300045976 Bacteria 1939
476 Ga0466967_0679863 3300045976 Bacteria 1019
477 Ga0466967_0685921 3300045976 Bacteria 1014
478 Ga0466967_0715630 3300045976 Bacteria 992
479 Ga0466967_0734760 3300045976 Unclassified 978
480 Ga0466967_0782709 3300045976 Unclassified 947
481 Ga0466967_0823218 3300045976 Unclassified 922
482 Ga0466967_1032415 3300045976 Bacteria 819
483 Ga0466967_1655699 3300045976 Bacteria 637
484 Ga0495592_0153742 3300046454 Unclassified 1589
485 Ga0495603_0099624 3300046455 Bacteria 1697
486 Ga0495651_0039719 3300046462 Bacteria 3662
487 Ga0495653_0057879 3300046463 Bacteria 2948
488 Ga0495662_0223303 3300046476 Unclassified 929
489 Ga0495584_0591932 3300046491 Bacteria 565
490 Ga0495584_0739720 3300046491 Bacteria 502
491 Ga0495608_0007984 3300046511 Bacteria 7438
492 Ga0495618_0031659 3300046514 Bacteria 3310
493 Ga0495628_0150620 3300046516 Bacteria 1772
494 Ga0495630_0341295 3300046517 Unclassified 1146
495 Ga0495637_0257389 3300046520 Bacteria 627
496 Ga0495652_0147265 3300046529 Unclassified 1844
497 Ga0495640_0106189 3300046533 Unclassified 1839
498 Ga0495586_0226267 3300046535 Bacteria 1064
499 Ga0495587_0080180 3300046536 Bacteria 1892
500 Ga0495609_0352495 3300046538 Bacteria 594
501 Ga0495597_0233020 3300046542 Bacteria 728
502 Ga0495645_0166242 3300046543 Unclassified 1521
503 Ga0495667_0024394 3300046559 Bacteria 4072
504 Ga0495656_0147704 3300046615 Bacteria 1133
505 Ga0495656_0310873 3300046615 Bacteria 810
506 Ga0495668_0863439 3300046616 Bacteria 502
507 Ga0495634_0062567 3300046642 Bacteria 2471
508 Ga0495635_0138280 3300046663 Unclassified 1660
509 Ga0495657_0059495 3300046675 Bacteria 2534
510 Ga0495599_0107068 3300046678 Unclassified 1742
511 Ga0495646_0087171 3300046680 Bacteria 1809
512 Ga0495647_0466539 3300046681 Bacteria 586
513 Ga0495613_0268027 3300046689 Unclassified 1188
514 Ga0495670_0226429 3300046691 Bacteria 994
515 Ga0495589_0214764 3300046794 Bacteria 905
516 Ga0495600_0023682 3300046809 Bacteria 3950
517 Ga0495604_0011596 3300047317 Bacteria 7007
518 Ga0495604_0499852 3300047317 Bacteria 789
519 Ga0495674_0065709 3300047319 Bacteria 3150
520 Ga0495674_0500572 3300047319 Bacteria 972
521 Ga0495676_0261164 3300047321 Bacteria 1178
522 Ga0495680_0018892 3300047322 Bacteria 5836
523 Ga0495675_0015968 3300047444 Bacteria 4749
524 Ga0495684_0062498 3300047471 Bacteria 2832
525 Ga0495593_0099468 3300047673 Unclassified 1493
526 Ga0495602_0194274 3300048088 Unclassified 1553
527 Ga0496100_0005681 3300048903 Bacteria 6747
528 Ga0496100_0089864 3300048903 Bacteria 2093
529 Ga0496100_0119956 3300048903 Bacteria 1838
530 Ga0496100_0137310 3300048903 Bacteria 1729
531 Ga0496100_0231617 3300048903 Bacteria 1359
532 Ga0496101_0011343 3300048904 Bacteria 5910
533 Ga0496101_0013880 3300048904 Bacteria 5407
534 Ga0496101_0022304 3300048904 Bacteria 4357
535 Ga0496101_0147417 3300048904 Bacteria 1798
536 Ga0496101_0497061 3300048904 Bacteria 963
537 Ga0496102_0005015 3300048905 Bacteria 11209
538 Ga0496102_0020824 3300048905 Bacteria 5796
539 Ga0496102_0037992 3300048905 Bacteria 4343
540 Ga0496102_0080973 3300048905 Bacteria 2993
541 Ga0496102_0165775 3300048905 Bacteria 2079
542 Ga0496102_0203436 3300048905 Bacteria 1866
543 Ga0496102_0576138 3300048905 Bacteria 1048
544 Ga0496102_1863684 3300048905 Bacteria 518
545 Ga0496103_0042394 3300048906 Bacteria 2800
546 Ga0496103_0294797 3300048906 Bacteria 1043
547 Ga0496103_0328572 3300048906 Bacteria 984
548 Ga0496103_0540870 3300048906 Bacteria 744
549 Ga0496104_0070266 3300048907 Bacteria 3328
550 Ga0496104_0144440 3300048907 Bacteria 2285
551 Ga0496104_0163696 3300048907 Bacteria 2133
552 Ga0496104_1084398 3300048907 Bacteria 704
553 Ga0496105_0025180 3300048908 Bacteria 4840
554 Ga0496105_0039369 3300048908 Bacteria 3896
555 Ga0496105_0061213 3300048908 Bacteria 3106
556 Ga0496105_0227509 3300048908 Bacteria 1516
557 Ga0496105_0338715 3300048908 Bacteria 1203
558 Ga0496105_1124668 3300048908 Bacteria 582
559 Ga0496106_0000253 3300048909 Bacteria 37605
560 Ga0496106_0019190 3300048909 Bacteria 5070
561 Ga0496106_0058452 3300048909 Bacteria 2919
562 Ga0496106_0073626 3300048909 Bacteria 2613
563 Ga0496106_0193233 3300048909 Unclassified 1619
564 Ga0496106_0202436 3300048909 Bacteria 1580
565 Ga0496106_0246933 3300048909 Bacteria 1426
566 Ga0496106_1378118 3300048909 Bacteria 545
567 Ga0496106_1564413 3300048909 Bacteria 506
568 Ga0496107_0004575 3300048910 Bacteria 9377
569 Ga0496107_0006107 3300048910 Bacteria 8276
570 Ga0496107_0024583 3300048910 Bacteria 4262
571 Ga0496107_0026217 3300048910 Bacteria 4131
572 Ga0496107_0057831 3300048910 Bacteria 2803
573 Ga0496107_0083447 3300048910 Bacteria 2330
574 Ga0496108_0001266 3300048911 Bacteria 19766
575 Ga0496108_0028410 3300048911 Bacteria 4627
576 Ga0496108_0031267 3300048911 Bacteria 4416
577 Ga0496108_0031593 3300048911 Bacteria 4394
578 Ga0496108_0257207 3300048911 Bacteria 1519
579 Ga0496108_0744246 3300048911 Bacteria 848
580 Ga0496109_0012706 3300048912 Bacteria 7275
581 Ga0496109_0020724 3300048912 Bacteria 5806
582 Ga0496109_0024913 3300048912 Bacteria 5326
583 Ga0496109_0030376 3300048912 Bacteria 4843
584 Ga0496109_0139903 3300048912 Bacteria 2263
585 Ga0496109_0413434 3300048912 Bacteria 1274
586 Ga0496110_0021020 3300048913 Bacteria 5516
587 Ga0496110_0027789 3300048913 Bacteria 4852
588 Ga0496110_0040610 3300048913 Bacteria 4055
589 Ga0496110_0115009 3300048913 Bacteria 2421
590 Ga0496110_0277957 3300048913 Bacteria 1525
591 Ga0496110_0303331 3300048913 Bacteria 1455
592 Ga0496110_0564440 3300048913 Bacteria 1034
593 Ga0496110_0890215 3300048913 Bacteria 796
594 Ga0496110_1415445 3300048913 Bacteria 605
595 Ga0496111_0020329 3300048914 Bacteria 4621
596 Ga0496111_0054337 3300048914 Bacteria 2895
597 Ga0496111_0145573 3300048914 Bacteria 1756
598 Ga0496111_0248508 3300048914 Bacteria 1320
599 Ga0496111_0258526 3300048914 Bacteria 1292
600 Ga0496111_0311340 3300048914 Bacteria 1167
601 Ga0496111_0354182 3300048914 Bacteria 1086
602 Ga0496111_0906409 3300048914 Bacteria 635
603 Ga0496112_0047147 3300048915 Bacteria 4227
604 Ga0496112_0068682 3300048915 Bacteria 3500
605 Ga0496112_0087815 3300048915 Bacteria 3077
606 Ga0496112_0100354 3300048915 Bacteria 2864
607 Ga0496112_0124330 3300048915 Bacteria 2550
608 Ga0496112_0222448 3300048915 Bacteria 1843
609 Ga0496112_0924208 3300048915 Bacteria 794
610 Ga0496113_0018114 3300048916 Bacteria 4901
611 Ga0496113_0059438 3300048916 Bacteria 2879
612 Ga0496113_0098992 3300048916 Bacteria 2258
613 Ga0496113_0274225 3300048916 Bacteria 1348
614 Ga0496113_0489513 3300048916 Bacteria 988
615 Ga0496114_0001863 3300048917 Bacteria 15983
616 Ga0496114_0015567 3300048917 Bacteria 6114
617 Ga0496114_0047665 3300048917 Bacteria 3564
618 Ga0496114_0237159 3300048917 Bacteria 1603
619 Ga0496114_0288411 3300048917 Bacteria 1448
620 Ga0496114_1596228 3300048917 Bacteria 540
621 Ga0496115_0021068 3300048918 Bacteria 5030
622 Ga0496115_0070470 3300048918 Bacteria 2834
623 Ga0496115_0084488 3300048918 Bacteria 2588
624 Ga0496115_0102875 3300048918 Bacteria 2343
625 Ga0496115_0471540 3300048918 Bacteria 1012
626 Ga0501036_1387160 3300049572 Bacteria 570
627 Ga0501038_0941526 3300049574 Bacteria 636
628 Ga0501039_1264717 3300049575 Bacteria 570
629 Ga0501048_0342420 3300049582 Bacteria 1066
630 Ga0501067_0015305 3300049583 Bacteria 4244
631 Ga0501067_0458922 3300049583 Bacteria 712
632 Ga0501067_0558210 3300049583 Bacteria 641
633 Ga0501067_0679544 3300049583 Bacteria 578
634 Ga0501068_0195266 3300049584 Archaea 1283
635 Ga0501069_0037973 3300049585 Bacteria 2657
636 Ga0501070_1112969 3300049586 Bacteria 609
637 Ga0501075_0314126 3300049591 Bacteria 1194
638 Ga0501076_0850706 3300049592 Bacteria 752
639 Ga0501081_0478257 3300049743 Bacteria 927
640 nmdc:mga0yw44_391358_c1 3300050492 Bacteria 939
641 nmdc:mga05p37_1084015_c1 3300050507 Bacteria 841
642 nmdc:mga05p37_178188_c1 3300050507 Bacteria 1879
643 nmdc:mga05p37_19342_c1 3300050507 Bacteria 8237
644 nmdc:mga05p37_265080_c1 3300050507 Bacteria 2054
645 nmdc:mga05p37_523657_c1 3300050507 Bacteria 1355
646 nmdc:mga05p37_9802_c1 3300050507 Bacteria 11368
647 nmdc:mga09592_10135_c1 3300050508 Bacteria 7667
648 nmdc:mga09592_148067_c1 3300050508 Bacteria 2025
649 nmdc:mga09592_265008_c1 3300050508 Bacteria 1490
650 nmdc:mga0qj67_127016_c1 3300050509 Bacteria 2063
651 nmdc:mga0qj67_17754_c1 3300050509 Bacteria 5412
652 nmdc:mga0qj67_4527_c1 3300050509 Bacteria 10070
653 nmdc:mga06r32_125713_c1 3300050510 Bacteria 2533
654 nmdc:mga06r32_195672_c1 3300050510 Bacteria 2009
655 nmdc:mga06r32_401256_c1 3300050510 Bacteria 1353
656 nmdc:mga08y16_31265_c1 3300050511 Bacteria 5600
657 nmdc:mga08y16_604612_c1 3300050511 Bacteria 1105
658 nmdc:mga08y16_9688_c1 3300050511 Bacteria 10112
659 nmdc:mga0n895_15615_c1 3300050512 Bacteria 4316
660 nmdc:mga0n895_206982_c1 3300050512 Bacteria 1992
661 nmdc:mga0rr50_136874_c1 3300050513 Bacteria 1967
662 nmdc:mga0rr50_1805861_c1 3300050513 Unclassified 514
663 nmdc:mga0rr50_24356_c1 3300050513 Bacteria 4191
664 nmdc:mga08x19_62791_c1 3300050514 Bacteria 2409
665 nmdc:mga08x19_684666_c1 3300050514 Bacteria 728
666 nmdc:mga08x19_921852_c1 3300050514 Bacteria 621
667 nmdc:mga0a205_158521_c1 3300050515 Bacteria 2161
668 nmdc:mga0a205_16167_c1 3300050515 Bacteria 6987
669 Ga0495655_0114065 3300053083 Bacteria 815
670 Ga0495595_0011445 3300053084 Bacteria 3709
671 Ga0495595_0559732 3300053084 Bacteria 584
672 Ga0495619_0108770 3300053085 Unclassified 1892
673 Ga0466962_0156226 3300061719 Bacteria 1108
674 Ga0466962_0179586 3300061719 Bacteria 1032
675 Ga0466962_0201537 3300061719 Unclassified 972
676 Ga0466962_0328559 3300061719 Bacteria 759
677 Ga0466962_0600111 3300061719 Bacteria 561
678 Ga0530510_0042072 3300061734 Bacteria 3300
679 Ga0068853_101974408
680 JGI24737J22298_10245153
681 JGI25407J50210_10076613
682 Ga0070683_100020231
683 Ga0070683_100273607
684 Ga0070683_100332171
685 Ga0070683_100848287
686 Ga0070690_100217413
687 Ga0070690_101333084
688 Ga0068869_100398030
689 Ga0070680_100405845
690 Ga0070682_100121324
691 Ga0068868_100007217
692 Ga0070660_101726375
693 Ga0070689_100630579
694 Ga0070691_10078552
695 Ga0070687_100627184
696 Ga0070661_100259522
697 Ga0070661_100655914
698 Ga0070661_100836542
699 Ga0070692_10177826
700 Ga0070668_100098125
701 Ga0070668_100536570
702 Ga0070669_100420388
703 Ga0070671_100297864
704 Ga0070671_100671594
705 Ga0070674_100149840
706 Ga0070674_100800303
707 Ga0070673_100084629
708 Ga0070688_100528454
709 Ga0070659_100136851
710 Ga0070659_100804338
711 Ga0070714_100185559
712 Ga0070714_100443598
713 Ga0070714_100878787
714 Ga0070714_101706813
715 Ga0070713_100093414
716 Ga0070713_101277206
717 Ga0070710_11304212
718 Ga0070711_100030449
719 Ga0070705_100462853
720 Ga0070700_100008366
721 Ga0070700_100057515
722 Ga0070700_100424478
723 Ga0070678_100270325
724 Ga0070678_100316160
725 Ga0070662_100730084
726 Ga0068867_101124711
727 Ga0070685_10016505
728 Ga0070684_100079013
729 Ga0070684_100116540
730 Ga0070684_100415756
731 Ga0070684_101131112
732 Ga0070672_100150624
733 Ga0070672_100311759
734 Ga0070686_100057126
735 Ga0070693_100258532
736 Ga0070693_100345268
737 Ga0070665_101321045
738 Ga0070704_100445841
739 Ga0070664_100172483
740 Ga0068857_100123931
741 Ga0068854_100024509
742 Ga0068856_100147700
743 Ga0068856_100671627
744 Ga0068856_101103686
745 Ga0070702_100023875
746 Ga0070702_100876199
747 Ga0068852_100499755
748 Ga0068852_100611244
749 Ga0068852_101481747
750 Ga0068859_100732094
751 Ga0068859_100832931
752 Ga0068864_100045468
753 Ga0068864_100148829
754 Ga0068861_100366118
755 Ga0068870_10208900
756 Ga0068863_100358451
757 Ga0068863_100362827
758 Ga0068863_101682334
759 Ga0068858_100257521
760 Ga0068858_100342214
761 Ga0068862_101470571
762 Ga0081455_10262080
763 Ga0081455_10668523
764 Ga0081538_10000161
765 Ga0081538_10001190
766 Ga0081538_10006492
767 Ga0081538_10009947
768 Ga0081538_10069293
769 Ga0081538_10099899
770 Ga0081539_10374604
771 Ga0070717_10008123
772 Ga0070717_10045368
773 Ga0070717_10593148
774 Ga0070715_10010258
775 Ga0070716_100082410
776 Ga0070716_100960200
777 Ga0070712_100017320
778 Ga0070712_100201769
779 Ga0070712_100628501
780 Ga0068871_102103438
781 Ga0075428_100036230
782 Ga0075428_100130460
783 Ga0075428_100234842
784 Ga0075428_100481931
785 Ga0075428_101948285
786 Ga0075430_100000305
787 Ga0075430_100083700
788 Ga0075431_100134835
789 Ga0075431_100167777
790 Ga0075431_100179048
791 Ga0075433_10011882
792 Ga0075433_10040469
793 Ga0075434_100088233
794 Ga0075434_100201009
795 Ga0075429_100282687
796 Ga0075429_100328190
797 Ga0068865_100806730
798 Ga0068865_101830786
799 Ga0075436_100084805
800 Ga0075436_100436643
801 Ga0097620_100732116
802 Ga0097620_100832851
803 Ga0075435_100018936
804 Ga0075435_100085404
805 Ga0099795_10451939
806 Ga0105240_10920323
807 Ga0105240_11424564
808 Ga0105240_12640729
809 Ga0111539_10017887
810 Ga0111539_10022996
811 Ga0111539_10290803
812 Ga0111539_10487713
813 Ga0111539_11722470
814 Ga0111539_12188711
815 Ga0111539_12532706
816 Ga0105245_10001866
817 Ga0105245_10807314
818 Ga0105245_10907519
819 Ga0105245_11232297
820 Ga0105245_11327789
821 Ga0105245_11555130
822 Ga0105245_12485193
823 Ga0114129_10003125
824 Ga0114129_10012141
825 Ga0114129_10071561
826 Ga0114129_10336941
827 Ga0114129_10526650
828 Ga0114129_10725583
829 Ga0114129_11045900
830 Ga0105243_10191599
831 Ga0105243_10218521
832 Ga0105243_10294335
833 Ga0105248_10940637
834 Ga0105248_11317213
835 Ga0105248_12092065
836 Ga0105237_10146661
837 Ga0105249_10645564
838 Ga0105249_12313573
839 Ga0105249_13456670
840 Ga0105239_10015525
841 Ga0105239_10737353
842 Ga0105239_10883524
843 Ga0105239_11286551
844 Ga0105239_12711301
845 Ga0105246_10107149
846 Ga0105246_10128027
847 Ga0105246_10462375
848 Ga0157346_1009127
849 Ga0157371_10792065
850 Ga0157374_10014037
851 Ga0157374_10269193
852 Ga0157378_11301947
853 Ga0157378_12337514
854 Ga0163162_10880979
855 Ga0163162_11077762
856 Ga0157372_10060642
857 Ga0157372_10169721
858 Ga0157372_10698180
859 Ga0157372_11202775
860 Ga0157375_10290410
861 Ga0157375_10487017
862 Ga0157375_11872539
863 Ga0157375_12623540
864 Ga0163163_10030502
865 Ga0163163_10220694
866 Ga0163163_12563319
867 Ga0157380_10039979
868 Ga0182008_10728228
869 Ga0157377_10005356
870 Ga0157379_10300475
871 Ga0157379_10490355
872 Ga0157376_10507512
873 Ga0213874_10070790
874 Ga0213876_10014992
875 Ga0213876_10038519
876 Ga0213875_10008521
877 Ga0213875_10010406
878 Ga0213875_10053471
879 Ga0207656_10350308
880 Ga0207653_10385013
881 Ga0207692_10037722
882 Ga0207692_11033458
883 Ga0207642_10050308
884 Ga0207642_10099637
885 Ga0207688_10121666
886 Ga0207685_10008603
887 Ga0207643_10587936
888 Ga0207643_10747034
889 Ga0207693_10006427
890 Ga0207693_10062053
891 Ga0207663_10148456
892 Ga0207663_10519961
893 Ga0207663_10582186
894 Ga0207663_10828401
895 Ga0207660_10390453
896 Ga0207660_11017345
897 Ga0207662_10170877
898 Ga0207662_10190050
899 Ga0207662_10256341
900 Ga0207662_10608934
901 Ga0207657_10383435
902 Ga0207649_10330394
903 Ga0207681_10411000
904 Ga0207681_10515465
905 Ga0207687_10078963
906 Ga0207687_10625738
907 Ga0207700_10054490
908 Ga0207700_10872785
909 Ga0207700_11379242
910 Ga0207664_10570049
911 Ga0207664_11064896
912 Ga0207664_11246010
913 Ga0207644_10771813
914 Ga0207690_10012872
915 Ga0207690_10281363
916 Ga0207706_10460200
917 Ga0207709_10414889
918 Ga0207669_10191239
919 Ga0207669_10688013
920 Ga0207704_10292918
921 Ga0207665_10148908
922 Ga0207665_10493473
923 Ga0207691_10145826
924 Ga0207691_10271783
925 Ga0207711_11034146
926 Ga0207689_10273801
927 Ga0207661_10123490
928 Ga0207661_10224821
929 Ga0207661_10696422
930 Ga0207661_10916794
931 Ga0207661_11043160
932 Ga0207679_10023065
933 Ga0207679_11022732
934 Ga0207651_10189008
935 Ga0207712_10162550
936 Ga0207712_11189479
937 Ga0207668_10281651
938 Ga0207668_10475021
939 Ga0207640_10133920
940 Ga0207640_10288955
941 Ga0207640_11590397
942 Ga0207677_10532126
943 Ga0207703_10428016
944 Ga0207703_11470894
945 Ga0207639_10448251
946 Ga0207678_10339140
947 Ga0207708_10001537
948 Ga0207708_10005798
949 Ga0207708_10298809
950 Ga0207708_10875154
951 Ga0207708_11251568
952 Ga0207702_10057259
953 Ga0207702_10904139
954 Ga0207641_10201343
955 Ga0207648_10121599
956 Ga0207648_11110801
957 Ga0207676_10571569
958 Ga0207676_11153659
959 Ga0207674_10126205
960 Ga0207675_100240991
961 Ga0207675_100343531
962 Ga0207675_100695492
963 Ga0207683_10128331
964 Ga0207683_10206932
965 Ga0207683_10413586
966 Ga0207683_11091991
967 Ga0207698_10022969
968 Ga0207698_10242834
969 Ga0207428_10070588
970 Ga0207428_10072907
971 Ga0207428_10246609
972 Ga0268266_11667792
973 Ga0268265_10847859
974 Ga0268264_10718872
975 Ga0268264_10940332
976 Ga0307408_100636769
977 Ga0307408_100646630
978 Ga0307405_10287430
979 Ga0307413_10134833
980 Ga0307413_10941934
981 Ga0307406_10171016
982 Ga0307406_10275549
983 Ga0307406_10329772
984 Ga0307406_10386652
985 Ga0307406_10456929
986 Ga0307406_11461269
987 Ga0307406_11895126
988 Ga0307407_10368420
989 Ga0307409_100055649
990 Ga0307409_100148517
991 Ga0307409_100433921
992 Ga0307409_100731611
993 Ga0307409_100832091
994 Ga0307409_101429874
995 Ga0307416_100216957
996 Ga0307416_100358835
997 Ga0307416_100566347
998 Ga0307416_100677924
999 Ga0307416_100682953
1000 Ga0307416_100817570
1001 Ga0307414_10571943
1002 Ga0307414_10899848
1003 Ga0307411_10124704
1004 Ga0307411_11270851
1005 Ga0307411_12065055
1006 Ga0307415_100001792
1007 Ga0307415_100484712
1008 Ga0307415_100556396
1009 Ga0307415_100898829
1010 Ga0307415_100964487
1011 Ga0307415_101590569
1012 Ga0307415_102384137
1013 Ga0373952_0161641
1014 Ga0373956_0366322
1015 Ga0373943_0730724
1016 Ga0373946_0151863
1017 Ga0373946_0283271
1018 Ga0373946_0490827
1019 Ga0373962_0347111
1020 Ga0373931_0852349
1021 Ga0373933_0083493
1022 Ga0373947_0011479
1023 Ga0373947_0256879
1024 Ga0373947_0424147
1025 Ga0373937_0076403
1026 Ga0373925_0744577
1027 Ga0373925_1347969
1028 Ga0395900_0644089
1029 Ga0395898_0191734
1030 Ga0395898_1098524
1031 Ga0395898_1728396
1032 Ga0395905_0912325
1033 Ga0436364_0409665
1034 Ga0436364_0635889
1035 Ga0436364_0641931
1036 Ga0436364_0744938
1037 Ga0436364_1007040
1038 Ga0436364_1243548
1039 Ga0436364_1555211
1040 Ga0395901_0147054
1041 Ga0395901_0604002
1042 Ga0436365_0104441
1043 Ga0436365_0249140
1044 Ga0436365_0451332
1045 Ga0436365_0472093
1046 Ga0436365_0791442
1047 Ga0436365_1072604
1048 Ga0436365_1105483
1049 Ga0436365_1481009
1050 Ga0436365_1845929
1051 Ga0436360_0923265
1052 Ga0436361_1041807
1053 Ga0436363_0368838
1054 Ga0436363_0580895
1055 Ga0436363_0630114
1056 Ga0436363_0802706
1057 Ga0436363_0988986
1058 Ga0436363_1000230
1059 Ga0436363_1099012
1060 Ga0436363_1139452
1061 Ga0436363_1222598
1062 Ga0436363_1324569
1063 Ga0436363_1372823
1064 Ga0436363_1586151
1065 Ga0436363_1603745
1066 Ga0436362_0949618
1067 Ga0451853_1647767
1068 Ga0451853_2510223
1069 Ga0439448_0169274
1070 Ga0439455_0044298
1071 Ga0439463_018276
1072 Ga0439458_0023283
1073 Ga0439459_0005208
1074 Ga0439464_0037414
1075 Ga0439460_0029502
1076 Ga0439460_0062954
1077 Ga0439440_0026484
1078 Ga0466969_0008292
1079 Ga0466969_0046675
1080 Ga0466969_0056957
1081 Ga0466969_0110370
1082 Ga0466969_0158352
1083 Ga0466972_0225060
1084 Ga0466965_0027072
1085 Ga0466965_0182205
1086 Ga0466965_0286509
1087 Ga0466965_0480296
1088 Ga0466966_0210551
1089 Ga0466966_0290821
1090 Ga0466966_0347403
1091 Ga0466966_0476050
1092 Ga0466961_0109054
1093 Ga0466961_0388387
1094 Ga0466961_0447831
1095 Ga0466961_0789423
1096 Ga0466963_0011144
1097 Ga0466963_0032270
1098 Ga0466963_0319315
1099 Ga0466963_0380501
1100 Ga0466963_0516440
1101 Ga0466964_0145124
1102 Ga0466964_0149240
1103 Ga0466964_0260235
1104 Ga0466971_0150589
1105 Ga0466971_0269758
1106 Ga0466971_0316597
1107 Ga0466971_0560663
1108 Ga0466968_0021181
1109 Ga0466968_0032781
1110 Ga0466968_0147602
1111 Ga0466968_0157043
1112 Ga0466968_0201586
1113 Ga0466968_0710565
1114 Ga0466970_0022236
1115 Ga0466970_0132391
1116 Ga0466970_0201273
1117 Ga0466970_0335441
1118 Ga0466957_0041772
1119 Ga0466957_0041931
1120 Ga0466957_0067561
1121 Ga0466957_0168889
1122 Ga0466957_0551961
1123 Ga0466957_0555344
1124 Ga0466960_0007698
1125 Ga0466960_0011422
1126 Ga0466960_0421395
1127 Ga0466959_0006761
1128 Ga0466959_0070658
1129 Ga0466959_0315441
1130 Ga0466959_0340950
1131 Ga0466959_0380840
1132 Ga0466959_0512163
1133 Ga0466959_0555121
1134 Ga0466959_1052815
1135 Ga0466958_0003671
1136 Ga0466958_0010607
1137 Ga0466958_0010653
1138 Ga0466958_0017736
1139 Ga0466958_0141807
1140 Ga0466958_0181001
1141 Ga0466958_0182266
1142 Ga0466958_0320443
1143 Ga0466958_0424177
1144 Ga0466958_0493937
1145 Ga0466958_0606713
1146 Ga0466967_0023813
1147 Ga0466967_0034816
1148 Ga0466967_0068049
1149 Ga0466967_0068481
1150 Ga0466967_0119701
1151 Ga0466967_0119867
1152 Ga0466967_0170546
1153 Ga0466967_0190308
1154 Ga0466967_0679863
1155 Ga0466967_0685921
1156 Ga0466967_0715630
1157 Ga0466967_0734760
1158 Ga0466967_0782709
1159 Ga0466967_0823218
1160 Ga0466967_1032415
1161 Ga0466967_1655699
1162 Ga0495592_0153742
1163 Ga0495603_0099624
1164 Ga0495651_0039719
1165 Ga0495653_0057879
1166 Ga0495662_0223303
1167 Ga0495584_0591932
1168 Ga0495584_0739720
1169 Ga0495608_0007984
1170 Ga0495618_0031659
1171 Ga0495628_0150620
1172 Ga0495630_0341295
1173 Ga0495637_0257389
1174 Ga0495652_0147265
1175 Ga0495640_0106189
1176 Ga0495586_0226267
1177 Ga0495587_0080180
1178 Ga0495609_0352495
1179 Ga0495597_0233020
1180 Ga0495645_0166242
1181 Ga0495667_0024394
1182 Ga0495656_0147704
1183 Ga0495656_0310873
1184 Ga0495668_0863439
1185 Ga0495634_0062567
1186 Ga0495635_0138280
1187 Ga0495657_0059495
1188 Ga0495599_0107068
1189 Ga0495646_0087171
1190 Ga0495647_0466539
1191 Ga0495613_0268027
1192 Ga0495670_0226429
1193 Ga0495589_0214764
1194 Ga0495600_0023682
1195 Ga0495604_0011596
1196 Ga0495604_0499852
1197 Ga0495674_0065709
1198 Ga0495674_0500572
1199 Ga0495676_0261164
1200 Ga0495680_0018892
1201 Ga0495675_0015968
1202 Ga0495684_0062498
1203 Ga0495593_0099468
1204 Ga0495602_0194274
1205 Ga0496100_0005681
1206 Ga0496100_0089864
1207 Ga0496100_0119956
1208 Ga0496100_0137310
1209 Ga0496100_0231617
1210 Ga0496101_0011343
1211 Ga0496101_0013880
1212 Ga0496101_0022304
1213 Ga0496101_0147417
1214 Ga0496101_0497061
1215 Ga0496102_0005015
1216 Ga0496102_0020824
1217 Ga0496102_0037992
1218 Ga0496102_0080973
1219 Ga0496102_0165775
1220 Ga0496102_0203436
1221 Ga0496102_0576138
1222 Ga0496102_1863684
1223 Ga0496103_0042394
1224 Ga0496103_0294797
1225 Ga0496103_0328572
1226 Ga0496103_0540870
1227 Ga0496104_0070266
1228 Ga0496104_0144440
1229 Ga0496104_0163696
1230 Ga0496104_1084398
1231 Ga0496105_0025180
1232 Ga0496105_0039369
1233 Ga0496105_0061213
1234 Ga0496105_0227509
1235 Ga0496105_0338715
1236 Ga0496105_1124668
1237 Ga0496106_0000253
1238 Ga0496106_0019190
1239 Ga0496106_0058452
1240 Ga0496106_0073626
1241 Ga0496106_0193233
1242 Ga0496106_0202436
1243 Ga0496106_0246933
1244 Ga0496106_1378118
1245 Ga0496106_1564413
1246 Ga0496107_0004575
1247 Ga0496107_0006107
1248 Ga0496107_0024583
1249 Ga0496107_0026217
1250 Ga0496107_0057831
1251 Ga0496107_0083447
1252 Ga0496108_0001266
1253 Ga0496108_0028410
1254 Ga0496108_0031267
1255 Ga0496108_0031593
1256 Ga0496108_0257207
1257 Ga0496108_0744246
1258 Ga0496109_0012706
1259 Ga0496109_0020724
1260 Ga0496109_0024913
1261 Ga0496109_0030376
1262 Ga0496109_0139903
1263 Ga0496109_0413434
1264 Ga0496110_0021020
1265 Ga0496110_0027789
1266 Ga0496110_0040610
1267 Ga0496110_0115009
1268 Ga0496110_0277957
1269 Ga0496110_0303331
1270 Ga0496110_0564440
1271 Ga0496110_0890215
1272 Ga0496110_1415445
1273 Ga0496111_0020329
1274 Ga0496111_0054337
1275 Ga0496111_0145573
1276 Ga0496111_0248508
1277 Ga0496111_0258526
1278 Ga0496111_0311340
1279 Ga0496111_0354182
1280 Ga0496111_0906409
1281 Ga0496112_0047147
1282 Ga0496112_0068682
1283 Ga0496112_0087815
1284 Ga0496112_0100354
1285 Ga0496112_0124330
1286 Ga0496112_0222448
1287 Ga0496112_0924208
1288 Ga0496113_0018114
1289 Ga0496113_0059438
1290 Ga0496113_0098992
1291 Ga0496113_0274225
1292 Ga0496113_0489513
1293 Ga0496114_0001863
1294 Ga0496114_0015567
1295 Ga0496114_0047665
1296 Ga0496114_0237159
1297 Ga0496114_0288411
1298 Ga0496114_1596228
1299 Ga0496115_0021068
1300 Ga0496115_0070470
1301 Ga0496115_0084488
1302 Ga0496115_0102875
1303 Ga0496115_0471540
1304 Ga0501036_1387160
1305 Ga0501038_0941526
1306 Ga0501039_1264717
1307 Ga0501048_0342420
1308 Ga0501067_0015305
1309 Ga0501067_0458922
1310 Ga0501067_0558210
1311 Ga0501067_0679544
1312 Ga0501068_0195266
1313 Ga0501069_0037973
1314 Ga0501070_1112969
1315 Ga0501075_0314126
1316 Ga0501076_0850706
1317 Ga0501081_0478257
1318 nmdc:mga0yw44_391358_c1
1319 nmdc:mga05p37_1084015_c1
1320 nmdc:mga05p37_178188_c1
1321 nmdc:mga05p37_19342_c1
1322 nmdc:mga05p37_265080_c1
1323 nmdc:mga05p37_523657_c1
1324 nmdc:mga05p37_9802_c1
1325 nmdc:mga09592_10135_c1
1326 nmdc:mga09592_148067_c1
1327 nmdc:mga09592_265008_c1
1328 nmdc:mga0qj67_127016_c1
1329 nmdc:mga0qj67_17754_c1
1330 nmdc:mga0qj67_4527_c1
1331 nmdc:mga06r32_125713_c1
1332 nmdc:mga06r32_195672_c1
1333 nmdc:mga06r32_401256_c1
1334 nmdc:mga08y16_31265_c1
1335 nmdc:mga08y16_604612_c1
1336 nmdc:mga08y16_9688_c1
1337 nmdc:mga0n895_15615_c1
1338 nmdc:mga0n895_206982_c1
1339 nmdc:mga0rr50_136874_c1
1340 nmdc:mga0rr50_1805861_c1
1341 nmdc:mga0rr50_24356_c1
1342 nmdc:mga08x19_62791_c1
1343 nmdc:mga08x19_684666_c1
1344 nmdc:mga08x19_921852_c1
1345 nmdc:mga0a205_158521_c1
1346 nmdc:mga0a205_16167_c1
1347 Ga0495655_0114065
1348 Ga0495595_0011445
1349 Ga0495595_0559732
1350 Ga0495619_0108770
1351 Ga0466962_0156226
1352 Ga0466962_0179586
1353 Ga0466962_0201537
1354 Ga0466962_0328559
1355 Ga0466962_0600111
1356 Ga0530510_0042072

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01842

ACT

ACT domain

84

136

0.88

PF01842

ACT

ACT domain

16

76

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2f06-assembly1.cif.gz_A crystal structure of protein bt0572 from bacteroides thetaiotaomicron 0.7932 3 122
6n4a-assembly2.cif.gz_F pii-like sbtb from cyanobium sp pcc 7001 (apo) 0.7858 2 57
6mmq-assembly2.cif.gz_E carbon regulatory pii-like protein sbtb from cyanobium sp. 7001 bound to camp 0.7856 2 60
2f06-assembly1.cif.gz_A crystal structure of protein bt0572 from bacteroides thetaiotaomicron 0.7711 3 122
5drk-assembly1.cif.gz_C 2.3 angstrom structure of cpii, a nitrogen regulatory pii-like protein from thiomonas intermedia k12, bound to adp, amp and bicarbonate. 0.7269 1 61
ID Description Score Start End Superfamily
2f06B00 Alpha Beta;2-Layer Sandwich;VC0802-like;VC0802-like 0.7558 3 122 3.30.2130.10
3zz0B05 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7445 1 49 3.30.70.240
af_I1M9H5_373_429_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.7444 70 117 3.30.70.260
2pfdC01 Alpha Beta;2-Layer Sandwich;Formiminotransferase-cyclodeaminase; Chain B, domain 1;Formiminotransferase, N-terminal subdomain 0.7398 1 61 3.30.990.10
2f06B00 Alpha Beta;2-Layer Sandwich;VC0802-like;VC0802-like 0.735 3 122 3.30.2130.10
ID Description Score Start End GO Terms
AF-A0A7K2BVU7-F1-model_v4 ACT domain-containing protein 0.9913 69 122
AF-A0A7X5WUA1-F1-model_v4 Amino acid-binding protein 0.9693 65 122
AF-X7YQ07-F1-model_v4 ACT domain protein 0.937 45 123
AF-X7YQ07-F1-model_v4 ACT domain protein 0.9152 45 123
AF-A0A7T9IXV3-F1-model_v4 deleted 0.8942 1 122

Map