F474615
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 677 | 289 | 676 | 237 |
Family's Representative Sequence
| Representative Sequence | 3300053131|Ga0500652_020551|Ga0500652_020551_1010_1828 |
| Length | 272 |
| Sequence | VGNTFYKRCKTLIKNPFFAALKGVSPIKSLNGQSYMLPKYKRILVKLSGESLMGDKSFGMDPSILNQYAHDIKELVELGVQVAIVIGGGNIYRGMNEAETGIERAHGDYMGMLATVINGMAMQAMLEKIGVFTRLQSAIKMEQIAEPYIRRRAIRHVEKGRVVIFGAGTGNPYFTTDTAGSLRAIEIQADVILKGTRVDGIYTADPEKDPTAKKYESITFQECISKNLRVMDMTAFTLCMENNLPIIVFDMNKPGNLRRVACGERVGTLVKG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 2 | 2818991444 | Filimonas endophytica 3197 | Isolate | Unclassified |
| 3 | 3003233435 | Sphingobacterium shayense CrR18 | Isolate | Unclassified |
| 4 | 3300000545 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled | Metagenome | Rhizosphere |
| 5 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 6 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 7 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 8 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 9 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 10 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 12 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 20 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 23 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 42 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 54 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 56 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 57 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 58 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 59 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 60 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 61 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 62 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 63 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 64 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 65 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 66 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 67 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 68 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 70 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 72 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 73 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 74 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 75 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 76 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 77 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 107 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 163 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 166 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 167 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 168 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 169 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 170 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 171 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 172 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 173 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 174 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 175 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 176 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 177 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 178 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 179 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 180 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 181 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 182 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 183 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 184 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 185 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 186 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 187 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 188 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 189 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 190 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 191 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 192 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 193 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 194 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 195 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 196 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 197 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 198 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 199 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 200 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 201 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 202 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 203 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 204 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 205 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 206 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 207 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 208 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 209 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 210 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 211 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 212 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 213 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 214 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 224 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 225 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 226 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 227 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 228 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 230 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 231 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 233 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 234 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 235 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 239 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 242 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 247 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 250 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 251 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 252 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 253 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 254 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 257 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 262 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 263 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 264 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 268 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 269 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 270 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 271 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 272 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 273 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 274 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 275 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 276 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 277 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 278 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 279 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 280 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 281 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 282 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 283 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 284 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 285 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 286 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 289 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.56 |
| Metatranscriptomes | 0 |
| Isolates | 0.44 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.43 |
| Nodule | 0 |
| Rhizoplane | 0.89 |
| Rhizosphere | 90.4 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.28 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | CNXas_1002191 | 3300000545 | Bacteria | 1347 |
| 2 | JGI24751J29686_10000297 | 3300002459 | Bacteria | 18753 |
| 3 | rootH1_10038406 | 3300003316 | Bacteria | 5727 |
| 4 | rootH1_10038406 | 3300003323 | Bacteria | 17804 |
| 5 | rootH2_10007161 | 3300003320 | Bacteria | 44535 |
| 6 | rootL2_10009250 | 3300003322 | Bacteria | 1661 |
| 7 | rootH1_10001569 | 3300003323 | Bacteria | 19450 |
| 8 | rootH1_10010732 | 3300003316 | Bacteria | 3448 |
| 9 | rootH1_10010732 | 3300003323 | Bacteria | 14229 |
| 10 | Ga0065704_10117876 | 3300005289 | Bacteria | 1827 |
| 11 | Ga0065704_10134167 | 3300005289 | Bacteria | 1580 |
| 12 | Ga0065712_10006725 | 3300005290 | Bacteria | 2538 |
| 13 | Ga0065712_10069410 | 3300005290 | Bacteria | 7353 |
| 14 | Ga0065712_10102063 | 3300005290 | Bacteria | 1988 |
| 15 | Ga0065715_10020203 | 3300005293 | Bacteria | 2111 |
| 16 | Ga0065715_10097890 | 3300005293 | Bacteria | 3634 |
| 17 | Ga0065715_10131286 | 3300005293 | Bacteria | 2010 |
| 18 | Ga0065707_10099164 | 3300005295 | Bacteria | 3026 |
| 19 | Ga0065707_10113318 | 3300005295 | Bacteria | 2331 |
| 20 | Ga0065707_10481629 | 3300005295 | Bacteria | 773 |
| 21 | Ga0070658_10032384 | 3300005327 | Bacteria | 4202 |
| 22 | Ga0070658_10032704 | 3300005327 | Bacteria | 4182 |
| 23 | Ga0070658_10060952 | 3300005327 | Bacteria | 3073 |
| 24 | Ga0070658_10242787 | 3300005327 | Bacteria | 1527 |
| 25 | Ga0070683_100024991 | 3300005329 | Bacteria | 5358 |
| 26 | Ga0070690_100029757 | 3300005330 | Bacteria | 3390 |
| 27 | Ga0070690_100079437 | 3300005330 | Bacteria | 2145 |
| 28 | Ga0070690_100235141 | 3300005330 | Bacteria | 1290 |
| 29 | Ga0070670_100021507 | 3300005331 | Bacteria | 5549 |
| 30 | Ga0070670_100028923 | 3300005331 | Bacteria | 4770 |
| 31 | Ga0070670_100091548 | 3300005331 | Bacteria | 2615 |
| 32 | Ga0070670_100146190 | 3300005331 | Bacteria | 2045 |
| 33 | Ga0070670_100184343 | 3300005331 | Bacteria | 1812 |
| 34 | Ga0070670_100301478 | 3300005331 | Bacteria | 1402 |
| 35 | Ga0070677_10174143 | 3300005333 | Bacteria | 1020 |
| 36 | Ga0068869_100022861 | 3300005334 | Bacteria | 4312 |
| 37 | Ga0068869_100037645 | 3300005334 | Bacteria | 3441 |
| 38 | Ga0068869_100053761 | 3300005334 | Bacteria | 2929 |
| 39 | Ga0068869_100057863 | 3300005334 | Bacteria | 2832 |
| 40 | Ga0068869_100060326 | 3300005334 | Bacteria | 2780 |
| 41 | Ga0068869_100105840 | 3300005334 | Bacteria | 2134 |
| 42 | Ga0070666_10000072 | 3300005335 | Bacteria | 75356 |
| 43 | Ga0070666_10052394 | 3300005335 | Bacteria | 2750 |
| 44 | Ga0070666_10081514 | 3300005335 | Bacteria | 2212 |
| 45 | Ga0070666_10327654 | 3300005335 | Bacteria | 1093 |
| 46 | Ga0070680_100068203 | 3300005336 | Bacteria | 2919 |
| 47 | Ga0068868_100008885 | 3300005338 | Bacteria | 7202 |
| 48 | Ga0068868_100118841 | 3300005338 | Bacteria | 2155 |
| 49 | Ga0068868_100677507 | 3300005338 | Bacteria | 920 |
| 50 | Ga0070660_100000353 | 3300005339 | Bacteria | 30722 |
| 51 | Ga0070689_100083237 | 3300005340 | Bacteria | 2514 |
| 52 | Ga0070689_100150368 | 3300005340 | Bacteria | 1877 |
| 53 | Ga0070689_100295372 | 3300005340 | Bacteria | 1347 |
| 54 | Ga0070691_10207953 | 3300005341 | Bacteria | 1031 |
| 55 | Ga0070691_10225792 | 3300005341 | Bacteria | 994 |
| 56 | Ga0070687_100055049 | 3300005343 | Bacteria | 2076 |
| 57 | Ga0070661_100112590 | 3300005344 | Bacteria | 2033 |
| 58 | Ga0070668_100072324 | 3300005347 | Bacteria | 2687 |
| 59 | Ga0070669_100013179 | 3300005353 | Bacteria | 5876 |
| 60 | Ga0070669_100066732 | 3300005353 | Bacteria | 2653 |
| 61 | Ga0070669_100140846 | 3300005353 | Bacteria | 1859 |
| 62 | Ga0070669_100480030 | 3300005353 | Bacteria | 1028 |
| 63 | Ga0070675_100037007 | 3300005354 | Bacteria | 3973 |
| 64 | Ga0070675_100096076 | 3300005354 | Bacteria | 2489 |
| 65 | Ga0070675_100240237 | 3300005354 | Bacteria | 1583 |
| 66 | Ga0070675_100515595 | 3300005354 | Bacteria | 1078 |
| 67 | Ga0070671_100038078 | 3300005355 | Bacteria | 3992 |
| 68 | Ga0070671_100475351 | 3300005355 | Bacteria | 1073 |
| 69 | Ga0070673_100001930 | 3300005364 | Bacteria | 12471 |
| 70 | Ga0070673_100056888 | 3300005364 | Bacteria | 3088 |
| 71 | Ga0070673_100095119 | 3300005364 | Bacteria | 2443 |
| 72 | Ga0070688_100001768 | 3300005365 | Bacteria | 10813 |
| 73 | Ga0070688_100067168 | 3300005365 | Bacteria | 2283 |
| 74 | Ga0070688_100126961 | 3300005365 | Bacteria | 1715 |
| 75 | Ga0070688_100448606 | 3300005365 | Bacteria | 964 |
| 76 | Ga0070659_100461105 | 3300005366 | Bacteria | 1079 |
| 77 | Ga0070667_100031681 | 3300005367 | Bacteria | 4408 |
| 78 | Ga0070667_100123398 | 3300005367 | Bacteria | 2255 |
| 79 | Ga0070667_100346335 | 3300005367 | Bacteria | 1344 |
| 80 | Ga0070708_100196646 | 3300005445 | Bacteria | 1887 |
| 81 | Ga0070663_100047024 | 3300005455 | Bacteria | 3056 |
| 82 | Ga0070663_100293639 | 3300005455 | Bacteria | 1299 |
| 83 | Ga0070678_100042232 | 3300005456 | Bacteria | 3240 |
| 84 | Ga0070678_100096160 | 3300005456 | Bacteria | 2284 |
| 85 | Ga0070662_100059134 | 3300005457 | Bacteria | 2791 |
| 86 | Ga0070662_100200584 | 3300005457 | Bacteria | 1583 |
| 87 | Ga0070681_10032510 | 3300005458 | Bacteria | 5236 |
| 88 | Ga0068867_100016063 | 3300005459 | Bacteria | 5315 |
| 89 | Ga0068867_100359275 | 3300005459 | Unclassified | 1218 |
| 90 | Ga0070685_10008872 | 3300005466 | Bacteria | 5185 |
| 91 | Ga0070685_10045751 | 3300005466 | Bacteria | 2511 |
| 92 | Ga0070685_10119568 | 3300005466 | Bacteria | 1634 |
| 93 | Ga0070685_10423099 | 3300005466 | Bacteria | 927 |
| 94 | Ga0070706_100106836 | 3300005467 | Bacteria | 2604 |
| 95 | Ga0070707_100028019 | 3300005468 | Bacteria | 5358 |
| 96 | Ga0070707_100068849 | 3300005468 | Bacteria | 3407 |
| 97 | Ga0070707_100493878 | 3300005468 | Bacteria | 1186 |
| 98 | Ga0070698_100089668 | 3300005471 | Bacteria | 3058 |
| 99 | Ga0070699_100035304 | 3300005518 | Bacteria | 4322 |
| 100 | Ga0070679_100328890 | 3300005530 | Bacteria | 1477 |
| 101 | Ga0070684_100123300 | 3300005535 | Bacteria | 2332 |
| 102 | Ga0068853_100005414 | 3300005539 | Bacteria | 10003 |
| 103 | Ga0068853_100021530 | 3300005539 | Bacteria | 5377 |
| 104 | Ga0068853_100027012 | 3300005539 | Bacteria | 4823 |
| 105 | Ga0068853_100116726 | 3300005539 | Bacteria | 2377 |
| 106 | Ga0068853_100221793 | 3300005539 | Bacteria | 1727 |
| 107 | Ga0068853_100940301 | 3300005539 | Bacteria | 831 |
| 108 | Ga0070672_100034513 | 3300005543 | Bacteria | 3839 |
| 109 | Ga0070672_100104380 | 3300005543 | Bacteria | 2303 |
| 110 | Ga0070672_100125084 | 3300005543 | Bacteria | 2108 |
| 111 | Ga0070672_100178205 | 3300005543 | Bacteria | 1770 |
| 112 | Ga0070672_100426605 | 3300005543 | Bacteria | 1139 |
| 113 | Ga0070686_100155613 | 3300005544 | Bacteria | 1605 |
| 114 | Ga0070704_100261834 | 3300005549 | Bacteria | 1425 |
| 115 | Ga0068855_100001281 | 3300005563 | Bacteria | 31161 |
| 116 | Ga0068855_100001364 | 3300005563 | Bacteria | 30276 |
| 117 | Ga0068855_100005605 | 3300005563 | Bacteria | 15317 |
| 118 | Ga0068855_100061780 | 3300005563 | Bacteria | 4376 |
| 119 | Ga0068855_100170031 | 3300005563 | Bacteria | 2469 |
| 120 | Ga0068855_100224735 | 3300005563 | Bacteria | 2104 |
| 121 | Ga0070664_100025450 | 3300005564 | Bacteria | 4905 |
| 122 | Ga0068857_100040989 | 3300005577 | Bacteria | 4105 |
| 123 | Ga0068857_100475945 | 3300005577 | Bacteria | 1170 |
| 124 | Ga0068857_100504050 | 3300005577 | Bacteria | 1136 |
| 125 | Ga0068856_100025243 | 3300005614 | Bacteria | 5790 |
| 126 | Ga0068852_100011225 | 3300005616 | Bacteria | 6733 |
| 127 | Ga0068852_100223678 | 3300005616 | Bacteria | 1791 |
| 128 | Ga0068852_100463858 | 3300005616 | Bacteria | 1256 |
| 129 | Ga0068859_100000006 | 3300005617 | Bacteria | 421509 |
| 130 | Ga0068859_100043650 | 3300005617 | Bacteria | 4506 |
| 131 | Ga0068859_100055565 | 3300005617 | Bacteria | 3984 |
| 132 | Ga0068859_100076850 | 3300005617 | Bacteria | 3379 |
| 133 | Ga0068859_100090079 | 3300005617 | Bacteria | 3118 |
| 134 | Ga0068859_100276535 | 3300005617 | Bacteria | 1772 |
| 135 | Ga0068859_100441309 | 3300005617 | Bacteria | 1398 |
| 136 | Ga0068859_100470606 | 3300005617 | Bacteria | 1352 |
| 137 | Ga0068864_100000469 | 3300005618 | Bacteria | 34957 |
| 138 | Ga0068864_100013747 | 3300005618 | Bacteria | 6714 |
| 139 | Ga0068864_100026382 | 3300005618 | Bacteria | 4901 |
| 140 | Ga0068864_100038927 | 3300005618 | Bacteria | 4063 |
| 141 | Ga0068864_100075767 | 3300005618 | Bacteria | 2938 |
| 142 | Ga0068864_100160788 | 3300005618 | Bacteria | 2041 |
| 143 | Ga0068864_100186352 | 3300005618 | Bacteria | 1900 |
| 144 | Ga0068861_100004575 | 3300005719 | Bacteria | 9286 |
| 145 | Ga0068861_100006209 | 3300005719 | Bacteria | 8131 |
| 146 | Ga0068861_100025586 | 3300005719 | Bacteria | 4281 |
| 147 | Ga0068861_100130465 | 3300005719 | Bacteria | 2039 |
| 148 | Ga0068861_100865576 | 3300005719 | Bacteria | 853 |
| 149 | Ga0068851_10065975 | 3300005834 | Bacteria | 1864 |
| 150 | Ga0068851_10101144 | 3300005834 | Bacteria | 1530 |
| 151 | Ga0068851_10401648 | 3300005834 | Bacteria | 806 |
| 152 | Ga0068870_10137798 | 3300005840 | Bacteria | 1425 |
| 153 | Ga0068863_100002075 | 3300005841 | Bacteria | 19871 |
| 154 | Ga0068863_100428969 | 3300005841 | Bacteria | 1296 |
| 155 | Ga0068858_100000978 | 3300005842 | Bacteria | 29516 |
| 156 | Ga0068858_100227240 | 3300005842 | Bacteria | 1769 |
| 157 | Ga0068858_100659088 | 3300005842 | Bacteria | 1017 |
| 158 | Ga0068858_100838392 | 3300005842 | Bacteria | 898 |
| 159 | Ga0068860_100001713 | 3300005843 | Bacteria | 23427 |
| 160 | Ga0068860_100060453 | 3300005843 | Bacteria | 3601 |
| 161 | Ga0068860_100082085 | 3300005843 | Bacteria | 3066 |
| 162 | Ga0068860_100211746 | 3300005843 | Bacteria | 1880 |
| 163 | Ga0068862_100012568 | 3300005844 | Bacteria | 7011 |
| 164 | Ga0068862_100020995 | 3300005844 | Bacteria | 5457 |
| 165 | Ga0081540_1017706 | 3300005983 | Bacteria | 4399 |
| 166 | Ga0070716_100101830 | 3300006173 | Bacteria | 1762 |
| 167 | Ga0075366_10024460 | 3300006195 | Bacteria | 3523 |
| 168 | Ga0075366_10113143 | 3300006195 | Bacteria | 1634 |
| 169 | Ga0075366_10124486 | 3300006195 | Bacteria | 1554 |
| 170 | Ga0097621_100019677 | 3300006237 | Bacteria | 5187 |
| 171 | Ga0097621_100025089 | 3300006237 | Bacteria | 4661 |
| 172 | Ga0097621_100111731 | 3300006237 | Bacteria | 2310 |
| 173 | Ga0097621_100175542 | 3300006237 | Bacteria | 1849 |
| 174 | Ga0097621_100211165 | 3300006237 | Bacteria | 1689 |
| 175 | Ga0097621_100490485 | 3300006237 | Bacteria | 1112 |
| 176 | Ga0097621_100992207 | 3300006237 | Bacteria | 785 |
| 177 | Ga0068871_100036138 | 3300006358 | Bacteria | 3931 |
| 178 | Ga0068871_100053211 | 3300006358 | Bacteria | 3280 |
| 179 | Ga0068871_100252807 | 3300006358 | Bacteria | 1535 |
| 180 | Ga0068871_100347101 | 3300006358 | Bacteria | 1312 |
| 181 | Ga0068871_100402919 | 3300006358 | Bacteria | 1219 |
| 182 | Ga0068871_100828302 | 3300006358 | Bacteria | 854 |
| 183 | Ga0075428_100013757 | 3300006844 | Bacteria | 9011 |
| 184 | Ga0075428_100014688 | 3300006844 | Bacteria | 8698 |
| 185 | Ga0075430_100004920 | 3300006846 | Bacteria | 11237 |
| 186 | Ga0075431_100058710 | 3300006847 | Bacteria | 3971 |
| 187 | Ga0075431_100112689 | 3300006847 | Bacteria | 2807 |
| 188 | Ga0075429_100004785 | 3300006880 | Bacteria | 11657 |
| 189 | Ga0075429_100013242 | 3300006880 | Bacteria | 7152 |
| 190 | Ga0075429_100022401 | 3300006880 | Bacteria | 5479 |
| 191 | Ga0075429_100059697 | 3300006880 | Bacteria | 3322 |
| 192 | Ga0068865_100031052 | 3300006881 | Bacteria | 3559 |
| 193 | Ga0068865_100143641 | 3300006881 | Bacteria | 1802 |
| 194 | Ga0097620_100000006 | 3300006931 | Bacteria | 421509 |
| 195 | Ga0097620_100043648 | 3300006931 | Bacteria | 4506 |
| 196 | Ga0097620_100055565 | 3300006931 | Bacteria | 3984 |
| 197 | Ga0097620_100076849 | 3300006931 | Bacteria | 3379 |
| 198 | Ga0097620_100090075 | 3300006931 | Bacteria | 3118 |
| 199 | Ga0097620_100276522 | 3300006931 | Bacteria | 1772 |
| 200 | Ga0097620_100441314 | 3300006931 | Bacteria | 1398 |
| 201 | Ga0097620_100470639 | 3300006931 | Bacteria | 1352 |
| 202 | Ga0105240_10003164 | 3300009093 | Bacteria | 25888 |
| 203 | Ga0105240_10022849 | 3300009093 | Bacteria | 8285 |
| 204 | Ga0105240_10037496 | 3300009093 | Bacteria | 6230 |
| 205 | Ga0105240_10050750 | 3300009093 | Bacteria | 5227 |
| 206 | Ga0105240_10051677 | 3300009093 | Bacteria | 5170 |
| 207 | Ga0105240_10072721 | 3300009093 | Bacteria | 4249 |
| 208 | Ga0105240_10164462 | 3300009093 | Bacteria | 2633 |
| 209 | Ga0111539_10209325 | 3300009094 | Bacteria | 2272 |
| 210 | Ga0111539_10417824 | 3300009094 | Bacteria | 1562 |
| 211 | Ga0111539_10556141 | 3300009094 | Bacteria | 1336 |
| 212 | Ga0111539_10774045 | 3300009094 | Bacteria | 1117 |
| 213 | Ga0105247_10004725 | 3300009101 | Bacteria | 8673 |
| 214 | Ga0105247_10007492 | 3300009101 | Bacteria | 6691 |
| 215 | Ga0114129_10001062 | 3300009147 | Bacteria | 36084 |
| 216 | Ga0114129_10290216 | 3300009147 | Bacteria | 2183 |
| 217 | Ga0105243_10184436 | 3300009148 | Bacteria | 1817 |
| 218 | Ga0105243_10248409 | 3300009148 | Bacteria | 1587 |
| 219 | Ga0105241_10000324 | 3300009174 | Bacteria | 36128 |
| 220 | Ga0105241_10002036 | 3300009174 | Bacteria | 15289 |
| 221 | Ga0105241_10006293 | 3300009174 | Bacteria | 8755 |
| 222 | Ga0105241_10042016 | 3300009174 | Bacteria | 3457 |
| 223 | Ga0105241_10417594 | 3300009174 | Bacteria | 1180 |
| 224 | Ga0105242_10005785 | 3300009176 | Bacteria | 9521 |
| 225 | Ga0105242_10028617 | 3300009176 | Bacteria | 4438 |
| 226 | Ga0105242_10058511 | 3300009176 | Bacteria | 3160 |
| 227 | Ga0105242_10238699 | 3300009176 | Bacteria | 1633 |
| 228 | Ga0105248_10236734 | 3300009177 | Bacteria | 2055 |
| 229 | Ga0105248_10445460 | 3300009177 | Bacteria | 1459 |
| 230 | Ga0105237_10000144 | 3300009545 | Bacteria | 100105 |
| 231 | Ga0105237_10003823 | 3300009545 | Bacteria | 17699 |
| 232 | Ga0105237_10006111 | 3300009545 | Bacteria | 13458 |
| 233 | Ga0105237_10033838 | 3300009545 | Bacteria | 5178 |
| 234 | Ga0105237_10346767 | 3300009545 | Bacteria | 1489 |
| 235 | Ga0105238_10005010 | 3300009551 | Bacteria | 13090 |
| 236 | Ga0105238_10256291 | 3300009551 | Bacteria | 1728 |
| 237 | Ga0105238_10259217 | 3300009551 | Bacteria | 1718 |
| 238 | Ga0105249_10001056 | 3300009553 | Bacteria | 24413 |
| 239 | Ga0105249_10002054 | 3300009553 | Bacteria | 17468 |
| 240 | Ga0105249_10007493 | 3300009553 | Bacteria | 9521 |
| 241 | Ga0105249_10011216 | 3300009553 | Bacteria | 7870 |
| 242 | Ga0105249_10053452 | 3300009553 | Bacteria | 3692 |
| 243 | Ga0105249_10075154 | 3300009553 | Bacteria | 3129 |
| 244 | Ga0105249_10742256 | 3300009553 | Bacteria | 1043 |
| 245 | Ga0105239_10000488 | 3300010375 | Bacteria | 57554 |
| 246 | Ga0105239_10000925 | 3300010375 | Bacteria | 41596 |
| 247 | Ga0105239_10010461 | 3300010375 | Bacteria | 10371 |
| 248 | Ga0105239_10011188 | 3300010375 | Bacteria | 10015 |
| 249 | Ga0105239_10016597 | 3300010375 | Bacteria | 8140 |
| 250 | Ga0105239_10020600 | 3300010375 | Bacteria | 7276 |
| 251 | Ga0105239_10090488 | 3300010375 | Bacteria | 3376 |
| 252 | Ga0105246_10091029 | 3300011119 | Bacteria | 2198 |
| 253 | Ga0105246_10363290 | 3300011119 | Bacteria | 1190 |
| 254 | Ga0157373_10008679 | 3300013100 | Bacteria | 7542 |
| 255 | Ga0157371_10000451 | 3300013102 | Bacteria | 50405 |
| 256 | Ga0157371_10001626 | 3300013102 | Bacteria | 22988 |
| 257 | Ga0157371_10152895 | 3300013102 | Bacteria | 1646 |
| 258 | Ga0157371_10230889 | 3300013102 | Bacteria | 1330 |
| 259 | Ga0157371_10577840 | 3300013102 | Bacteria | 834 |
| 260 | Ga0157370_10003865 | 3300013104 | Bacteria | 17457 |
| 261 | Ga0157370_10006839 | 3300013104 | Bacteria | 12493 |
| 262 | Ga0157370_10007606 | 3300013104 | Bacteria | 11766 |
| 263 | Ga0157370_10089403 | 3300013104 | Bacteria | 2893 |
| 264 | Ga0157370_10175065 | 3300013104 | Bacteria | 1994 |
| 265 | Ga0157370_10391791 | 3300013104 | Bacteria | 1279 |
| 266 | Ga0157370_10743179 | 3300013104 | Bacteria | 894 |
| 267 | Ga0157369_10007223 | 3300013105 | Bacteria | 12797 |
| 268 | Ga0157369_10037669 | 3300013105 | Bacteria | 5293 |
| 269 | Ga0157369_10227713 | 3300013105 | Bacteria | 1950 |
| 270 | Ga0157374_10000013 | 3300013296 | Bacteria | 461240 |
| 271 | Ga0157374_10024890 | 3300013296 | Bacteria | 5370 |
| 272 | Ga0157374_10107475 | 3300013296 | Bacteria | 2681 |
| 273 | Ga0157374_10398592 | 3300013296 | Bacteria | 1373 |
| 274 | Ga0157378_10048214 | 3300013297 | Bacteria | 3787 |
| 275 | Ga0157378_10091377 | 3300013297 | Bacteria | 2767 |
| 276 | Ga0157378_10171743 | 3300013297 | Bacteria | 2033 |
| 277 | Ga0157378_10268289 | 3300013297 | Bacteria | 1640 |
| 278 | Ga0163162_10000112 | 3300013306 | Bacteria | 72032 |
| 279 | Ga0163162_10000253 | 3300013306 | Bacteria | 48450 |
| 280 | Ga0163162_10002447 | 3300013306 | Bacteria | 17518 |
| 281 | Ga0163162_11301536 | 3300013306 | Bacteria | 826 |
| 282 | Ga0157372_10000667 | 3300013307 | Bacteria | 37793 |
| 283 | Ga0157372_10071033 | 3300013307 | Bacteria | 3919 |
| 284 | Ga0157372_10327274 | 3300013307 | Bacteria | 1784 |
| 285 | Ga0157372_10349849 | 3300013307 | Bacteria | 1721 |
| 286 | Ga0157375_10088688 | 3300013308 | Bacteria | 3148 |
| 287 | Ga0157375_10154229 | 3300013308 | Bacteria | 2434 |
| 288 | Ga0157375_10209843 | 3300013308 | Bacteria | 2105 |
| 289 | Ga0157375_10361412 | 3300013308 | Bacteria | 1618 |
| 290 | Ga0157375_10400674 | 3300013308 | Bacteria | 1539 |
| 291 | Ga0163163_10470739 | 3300014325 | Bacteria | 1317 |
| 292 | Ga0157380_10004180 | 3300014326 | Bacteria | 9977 |
| 293 | Ga0157380_10055627 | 3300014326 | Bacteria | 3144 |
| 294 | Ga0157380_10099713 | 3300014326 | Bacteria | 2416 |
| 295 | Ga0157380_10101875 | 3300014326 | Bacteria | 2393 |
| 296 | Ga0157380_10281935 | 3300014326 | Bacteria | 1521 |
| 297 | Ga0157380_10431861 | 3300014326 | Bacteria | 1259 |
| 298 | Ga0157377_10017312 | 3300014745 | Bacteria | 3725 |
| 299 | Ga0157377_10017363 | 3300014745 | Bacteria | 3720 |
| 300 | Ga0157377_10504318 | 3300014745 | Bacteria | 846 |
| 301 | Ga0157379_10005275 | 3300014968 | Bacteria | 11097 |
| 302 | Ga0157379_10029944 | 3300014968 | Bacteria | 4841 |
| 303 | Ga0157379_10380303 | 3300014968 | Bacteria | 1295 |
| 304 | Ga0157376_10001570 | 3300014969 | Bacteria | 15087 |
| 305 | Ga0157376_10070136 | 3300014969 | Bacteria | 2974 |
| 306 | Ga0157376_10152746 | 3300014969 | Bacteria | 2084 |
| 307 | Ga0157376_10153384 | 3300014969 | Bacteria | 2080 |
| 308 | Ga0157376_10230195 | 3300014969 | Bacteria | 1721 |
| 309 | Ga0163161_10040483 | 3300017792 | Bacteria | 3347 |
| 310 | Ga0163161_10068270 | 3300017792 | Bacteria | 2597 |
| 311 | Ga0163161_10075295 | 3300017792 | Bacteria | 2476 |
| 312 | Ga0163161_10157142 | 3300017792 | Bacteria | 1732 |
| 313 | Ga0163161_10237323 | 3300017792 | Bacteria | 1417 |
| 314 | Ga0163161_10288960 | 3300017792 | Bacteria | 1288 |
| 315 | Ga0163161_10719308 | 3300017792 | Bacteria | 833 |
| 316 | Ga0213876_10016061 | 3300021384 | Bacteria | 3960 |
| 317 | Ga0207426_1000059 | 3300025302 | Bacteria | 363842 |
| 318 | Ga0207697_10013942 | 3300025315 | Bacteria | 3346 |
| 319 | Ga0207656_10085275 | 3300025321 | Bacteria | 1426 |
| 320 | Ga0207682_10161128 | 3300025893 | Bacteria | 1016 |
| 321 | Ga0207642_10054219 | 3300025899 | Bacteria | 1828 |
| 322 | Ga0207710_10002364 | 3300025900 | Bacteria | 8816 |
| 323 | Ga0207680_10020915 | 3300025903 | Bacteria | 3533 |
| 324 | Ga0207680_10324646 | 3300025903 | Bacteria | 1077 |
| 325 | Ga0207647_10064086 | 3300025904 | Bacteria | 2234 |
| 326 | Ga0207647_10108484 | 3300025904 | Bacteria | 1642 |
| 327 | Ga0207685_10114091 | 3300025905 | Bacteria | 1176 |
| 328 | Ga0207645_10020710 | 3300025907 | Bacteria | 4300 |
| 329 | Ga0207645_10027483 | 3300025907 | Bacteria | 3673 |
| 330 | Ga0207645_10121810 | 3300025907 | Bacteria | 1693 |
| 331 | Ga0207643_10012716 | 3300025908 | Bacteria | 4549 |
| 332 | Ga0207643_10091760 | 3300025908 | Bacteria | 1772 |
| 333 | Ga0207705_10216977 | 3300025909 | Bacteria | 1452 |
| 334 | Ga0207654_10002079 | 3300025911 | Bacteria | 10262 |
| 335 | Ga0207654_10009816 | 3300025911 | Bacteria | 4867 |
| 336 | Ga0207654_10055609 | 3300025911 | Bacteria | 2292 |
| 337 | Ga0207695_10000056 | 3300025913 | Bacteria | 382433 |
| 338 | Ga0207695_10001122 | 3300025913 | Bacteria | 46534 |
| 339 | Ga0207695_10010840 | 3300025913 | Bacteria | 11105 |
| 340 | Ga0207695_10027732 | 3300025913 | Bacteria | 6301 |
| 341 | Ga0207695_10028609 | 3300025913 | Bacteria | 6173 |
| 342 | Ga0207695_10063527 | 3300025913 | Bacteria | 3806 |
| 343 | Ga0207671_10000453 | 3300025914 | Bacteria | 56447 |
| 344 | Ga0207671_10001502 | 3300025914 | Bacteria | 26900 |
| 345 | Ga0207671_10001511 | 3300025914 | Bacteria | 26769 |
| 346 | Ga0207671_10085996 | 3300025914 | Bacteria | 2363 |
| 347 | Ga0207660_10072945 | 3300025917 | Bacteria | 2502 |
| 348 | Ga0207662_10014896 | 3300025918 | Bacteria | 4368 |
| 349 | Ga0207662_10060356 | 3300025918 | Bacteria | 2274 |
| 350 | Ga0207657_10005517 | 3300025919 | Bacteria | 13209 |
| 351 | Ga0207657_10046739 | 3300025919 | Bacteria | 3790 |
| 352 | Ga0207657_10115053 | 3300025919 | Bacteria | 2217 |
| 353 | Ga0207649_10179546 | 3300025920 | Bacteria | 1481 |
| 354 | Ga0207649_10208190 | 3300025920 | Bacteria | 1386 |
| 355 | Ga0207652_10009486 | 3300025921 | Bacteria | 7824 |
| 356 | Ga0207652_10405891 | 3300025921 | Bacteria | 1229 |
| 357 | Ga0207646_10012637 | 3300025922 | Bacteria | 8105 |
| 358 | Ga0207646_10212194 | 3300025922 | Bacteria | 1748 |
| 359 | Ga0207646_10473547 | 3300025922 | Bacteria | 1129 |
| 360 | Ga0207681_10057701 | 3300025923 | Bacteria | 2654 |
| 361 | Ga0207681_10564845 | 3300025923 | Bacteria | 937 |
| 362 | Ga0207694_10106310 | 3300025924 | Bacteria | 2229 |
| 363 | Ga0207650_10012500 | 3300025925 | Bacteria | 5861 |
| 364 | Ga0207650_10047529 | 3300025925 | Bacteria | 3162 |
| 365 | Ga0207650_10103533 | 3300025925 | Bacteria | 2195 |
| 366 | Ga0207650_10170423 | 3300025925 | Bacteria | 1730 |
| 367 | Ga0207659_10004571 | 3300025926 | Bacteria | 8368 |
| 368 | Ga0207659_10012861 | 3300025926 | Bacteria | 5344 |
| 369 | Ga0207659_10477265 | 3300025926 | Bacteria | 1053 |
| 370 | Ga0207644_10123395 | 3300025931 | Bacteria | 1975 |
| 371 | Ga0207644_10354278 | 3300025931 | Bacteria | 1192 |
| 372 | Ga0207690_10317204 | 3300025932 | Bacteria | 1224 |
| 373 | Ga0207706_10067636 | 3300025933 | Bacteria | 3143 |
| 374 | Ga0207706_10228136 | 3300025933 | Bacteria | 1630 |
| 375 | Ga0207686_10000351 | 3300025934 | Bacteria | 32797 |
| 376 | Ga0207686_10169185 | 3300025934 | Bacteria | 1539 |
| 377 | Ga0207709_10169214 | 3300025935 | Bacteria | 1532 |
| 378 | Ga0207670_10048806 | 3300025936 | Bacteria | 2827 |
| 379 | Ga0207670_10062784 | 3300025936 | Bacteria | 2540 |
| 380 | Ga0207670_10432955 | 3300025936 | Bacteria | 1057 |
| 381 | Ga0207670_10523278 | 3300025936 | Bacteria | 966 |
| 382 | Ga0207669_10817614 | 3300025937 | Bacteria | 774 |
| 383 | Ga0207704_10126127 | 3300025938 | Bacteria | 1763 |
| 384 | Ga0207704_10134502 | 3300025938 | Bacteria | 1718 |
| 385 | Ga0207691_10055953 | 3300025940 | Bacteria | 3595 |
| 386 | Ga0207691_10075209 | 3300025940 | Bacteria | 3045 |
| 387 | Ga0207691_10081826 | 3300025940 | Bacteria | 2901 |
| 388 | Ga0207691_10145305 | 3300025940 | Bacteria | 2088 |
| 389 | Ga0207691_10300203 | 3300025940 | Bacteria | 1380 |
| 390 | Ga0207691_10320367 | 3300025940 | Bacteria | 1329 |
| 391 | Ga0207711_10078140 | 3300025941 | Bacteria | 2886 |
| 392 | Ga0207689_10001492 | 3300025942 | Bacteria | 22339 |
| 393 | Ga0207689_10086393 | 3300025942 | Bacteria | 2578 |
| 394 | Ga0207689_10104175 | 3300025942 | Bacteria | 2331 |
| 395 | Ga0207661_10803567 | 3300025944 | Bacteria | 866 |
| 396 | Ga0207679_10029827 | 3300025945 | Bacteria | 3802 |
| 397 | Ga0207667_10007821 | 3300025949 | Bacteria | 12775 |
| 398 | Ga0207667_10075292 | 3300025949 | Bacteria | 3505 |
| 399 | Ga0207667_10134911 | 3300025949 | Bacteria | 2542 |
| 400 | Ga0207667_10150742 | 3300025949 | Bacteria | 2393 |
| 401 | Ga0207667_10155683 | 3300025949 | Bacteria | 2352 |
| 402 | Ga0207651_10109139 | 3300025960 | Bacteria | 2072 |
| 403 | Ga0207651_10147807 | 3300025960 | Bacteria | 1825 |
| 404 | Ga0207651_10168833 | 3300025960 | Bacteria | 1723 |
| 405 | Ga0207651_10232759 | 3300025960 | Bacteria | 1497 |
| 406 | Ga0207651_10586049 | 3300025960 | Bacteria | 973 |
| 407 | Ga0207712_10001599 | 3300025961 | Bacteria | 15251 |
| 408 | Ga0207712_10003428 | 3300025961 | Bacteria | 10019 |
| 409 | Ga0207712_10005438 | 3300025961 | Bacteria | 8039 |
| 410 | Ga0207712_10014496 | 3300025961 | Bacteria | 5074 |
| 411 | Ga0207712_10031442 | 3300025961 | Bacteria | 3576 |
| 412 | Ga0207712_10319151 | 3300025961 | Bacteria | 1281 |
| 413 | Ga0207668_10333519 | 3300025972 | Bacteria | 1263 |
| 414 | Ga0207668_10435833 | 3300025972 | Bacteria | 1115 |
| 415 | Ga0207658_10010564 | 3300025986 | Bacteria | 6273 |
| 416 | Ga0207658_10032675 | 3300025986 | Bacteria | 3706 |
| 417 | Ga0207658_10042638 | 3300025986 | Bacteria | 3293 |
| 418 | Ga0207677_10045716 | 3300026023 | Bacteria | 2925 |
| 419 | Ga0207677_10153583 | 3300026023 | Bacteria | 1779 |
| 420 | Ga0207677_10229345 | 3300026023 | Bacteria | 1495 |
| 421 | Ga0207703_10002804 | 3300026035 | Bacteria | 14887 |
| 422 | Ga0207639_10012512 | 3300026041 | Bacteria | 5911 |
| 423 | Ga0207639_10054200 | 3300026041 | Bacteria | 3064 |
| 424 | Ga0207639_10085015 | 3300026041 | Bacteria | 2515 |
| 425 | Ga0207639_10088393 | 3300026041 | Bacteria | 2472 |
| 426 | Ga0207639_10142613 | 3300026041 | Bacteria | 1998 |
| 427 | Ga0207639_10160505 | 3300026041 | Bacteria | 1894 |
| 428 | Ga0207639_10413219 | 3300026041 | Bacteria | 1218 |
| 429 | Ga0207708_10120038 | 3300026075 | Bacteria | 2048 |
| 430 | Ga0207708_10348786 | 3300026075 | Bacteria | 1214 |
| 431 | Ga0207702_10230502 | 3300026078 | Bacteria | 1731 |
| 432 | Ga0207641_10000058 | 3300026088 | Bacteria | 166385 |
| 433 | Ga0207641_10043574 | 3300026088 | Bacteria | 3769 |
| 434 | Ga0207641_10166367 | 3300026088 | Bacteria | 2009 |
| 435 | Ga0207648_10022185 | 3300026089 | Bacteria | 5703 |
| 436 | Ga0207648_10102681 | 3300026089 | Bacteria | 2506 |
| 437 | Ga0207648_10118817 | 3300026089 | Bacteria | 2323 |
| 438 | Ga0207648_10185389 | 3300026089 | Unclassified | 1843 |
| 439 | Ga0207676_10014686 | 3300026095 | Bacteria | 5641 |
| 440 | Ga0207676_10045785 | 3300026095 | Bacteria | 3382 |
| 441 | Ga0207676_10238300 | 3300026095 | Bacteria | 1630 |
| 442 | Ga0207676_10282148 | 3300026095 | Bacteria | 1508 |
| 443 | Ga0207674_10008410 | 3300026116 | Bacteria | 11925 |
| 444 | Ga0207674_10008703 | 3300026116 | Bacteria | 11683 |
| 445 | Ga0207674_10101275 | 3300026116 | Bacteria | 2861 |
| 446 | Ga0207674_10787100 | 3300026116 | Bacteria | 918 |
| 447 | Ga0207675_100000153 | 3300026118 | Bacteria | 60593 |
| 448 | Ga0207675_100003754 | 3300026118 | Bacteria | 14797 |
| 449 | Ga0207675_100027008 | 3300026118 | Bacteria | 5344 |
| 450 | Ga0207675_100100301 | 3300026118 | Bacteria | 2727 |
| 451 | Ga0207675_100140758 | 3300026118 | Bacteria | 2292 |
| 452 | Ga0207683_10011891 | 3300026121 | Bacteria | 7428 |
| 453 | Ga0207683_10037605 | 3300026121 | Bacteria | 4215 |
| 454 | Ga0207683_10245750 | 3300026121 | Bacteria | 1632 |
| 455 | Ga0207683_10390413 | 3300026121 | Bacteria | 1280 |
| 456 | Ga0207698_10007272 | 3300026142 | Bacteria | 6937 |
| 457 | Ga0207698_10055959 | 3300026142 | Bacteria | 3043 |
| 458 | Ga0207698_10063132 | 3300026142 | Bacteria | 2897 |
| 459 | Ga0207698_10172973 | 3300026142 | Bacteria | 1904 |
| 460 | Ga0207698_10391926 | 3300026142 | Bacteria | 1325 |
| 461 | Ga0207428_10033842 | 3300027907 | Bacteria | 4192 |
| 462 | Ga0268265_10006773 | 3300028380 | Bacteria | 7752 |
| 463 | Ga0268265_10082385 | 3300028380 | Bacteria | 2544 |
| 464 | Ga0268265_10144805 | 3300028380 | Bacteria | 1995 |
| 465 | Ga0268265_10195834 | 3300028380 | Bacteria | 1749 |
| 466 | Ga0268264_10000726 | 3300028381 | Bacteria | 37807 |
| 467 | Ga0268264_10063815 | 3300028381 | Bacteria | 3098 |
| 468 | Ga0268264_10490517 | 3300028381 | Bacteria | 1196 |
| 469 | Ga0268264_10597587 | 3300028381 | Bacteria | 1087 |
| 470 | Ga0307517_10219728 | 3300028786 | Bacteria | 1157 |
| 471 | Ga0307515_10000059 | 3300028794 | Bacteria | 257520 |
| 472 | Ga0307515_10192629 | 3300028794 | Bacteria | 1943 |
| 473 | Ga0307511_10000181 | 3300030521 | Bacteria | 62420 |
| 474 | Ga0265327_10000172 | 3300031251 | Bacteria | 139400 |
| 475 | Ga0307513_10030476 | 3300031456 | Bacteria | 6128 |
| 476 | Ga0307513_10348214 | 3300031456 | Bacteria | 1230 |
| 477 | Ga0307513_10377596 | 3300031456 | Bacteria | 1158 |
| 478 | Ga0307509_10013918 | 3300031507 | Bacteria | 9490 |
| 479 | Ga0307509_10093902 | 3300031507 | Bacteria | 3060 |
| 480 | Ga0307509_10151950 | 3300031507 | Bacteria | 2229 |
| 481 | Ga0307408_100285963 | 3300031548 | Bacteria | 1375 |
| 482 | Ga0307508_10000485 | 3300031616 | Bacteria | 47975 |
| 483 | Ga0307508_10057484 | 3300031616 | Bacteria | 3442 |
| 484 | Ga0307516_10170989 | 3300031730 | Bacteria | 1914 |
| 485 | Ga0307516_10202111 | 3300031730 | Bacteria | 1706 |
| 486 | Ga0307405_10054867 | 3300031731 | Bacteria | 2490 |
| 487 | Ga0307405_10184986 | 3300031731 | Bacteria | 1499 |
| 488 | Ga0307413_10048737 | 3300031824 | Bacteria | 2534 |
| 489 | Ga0307412_10524207 | 3300031911 | Bacteria | 990 |
| 490 | Ga0307409_100256882 | 3300031995 | Bacteria | 1601 |
| 491 | Ga0307416_100007276 | 3300032002 | Bacteria | 7019 |
| 492 | Ga0307414_10050346 | 3300032004 | Bacteria | 2885 |
| 493 | Ga0373935_0088048 | 3300035692 | Bacteria | 2028 |
| 494 | Ga0395900_0456266 | 3300037418 | Bacteria | 1234 |
| 495 | Ga0395898_0658837 | 3300037466 | Bacteria | 989 |
| 496 | Ga0395905_0000002 | 3300037471 | Bacteria | 1356358 |
| 497 | Ga0436364_1006406 | 3300037853 | Bacteria | 1339 |
| 498 | Ga0395901_0002140 | 3300038443 | Bacteria | 20188 |
| 499 | Ga0395901_0838566 | 3300038443 | Bacteria | 905 |
| 500 | Ga0436365_1001352 | 3300039437 | Bacteria | 8242 |
| 501 | Ga0439436_0004748 | 3300041404 | Bacteria | 4167 |
| 502 | Ga0439439_0001927 | 3300041406 | Bacteria | 4289 |
| 503 | Ga0439439_0080627 | 3300041406 | Bacteria | 880 |
| 504 | Ga0439465_0108527 | 3300041413 | Bacteria | 964 |
| 505 | Ga0451791_1381310 | 3300041451 | Bacteria | 1453 |
| 506 | Ga0451800_1146729 | 3300041459 | Bacteria | 995 |
| 507 | Ga0451800_1377849 | 3300041459 | Bacteria | 1738 |
| 508 | Ga0451807_0414922 | 3300041486 | Bacteria | 1737 |
| 509 | Ga0451841_1354039 | 3300041498 | Bacteria | 877 |
| 510 | Ga0451845_0011729 | 3300041501 | Bacteria | 1045 |
| 511 | Ga0451847_0209969 | 3300041503 | Bacteria | 865 |
| 512 | Ga0451853_2563909 | 3300041512 | Bacteria | 7170 |
| 513 | Ga0439442_039304 | 3300042002 | Bacteria | 992 |
| 514 | Ga0439449_0015126 | 3300042007 | Bacteria | 2899 |
| 515 | Ga0439457_000277 | 3300042014 | Bacteria | 14123 |
| 516 | Ga0439462_0062632 | 3300042015 | Bacteria | 1007 |
| 517 | Ga0439434_0130367 | 3300042435 | Bacteria | 825 |
| 518 | Ga0451577_0001932 | 3300042876 | Bacteria | 26161 |
| 519 | Ga0451577_0210143 | 3300042876 | Bacteria | 1758 |
| 520 | Ga0466969_0000190 | 3300044656 | Bacteria | 33133 |
| 521 | Ga0466969_0054828 | 3300044656 | Bacteria | 1952 |
| 522 | Ga0466972_0000168 | 3300044658 | Bacteria | 51759 |
| 523 | Ga0466972_0000337 | 3300044658 | Bacteria | 25976 |
| 524 | Ga0466972_0007731 | 3300044658 | Bacteria | 5397 |
| 525 | Ga0453683_0083947 | 3300044673 | Bacteria | 1996 |
| 526 | Ga0466966_0013541 | 3300044684 | Bacteria | 5398 |
| 527 | Ga0466966_0075817 | 3300044684 | Bacteria | 2100 |
| 528 | Ga0466966_0395256 | 3300044684 | Bacteria | 831 |
| 529 | Ga0466961_0064427 | 3300044693 | Bacteria | 2329 |
| 530 | Ga0466961_0110285 | 3300044693 | Bacteria | 1731 |
| 531 | Ga0466961_0119342 | 3300044693 | Bacteria | 1656 |
| 532 | Ga0453684_0318611 | 3300044712 | Bacteria | 1762 |
| 533 | Ga0466971_0003048 | 3300044719 | Bacteria | 7120 |
| 534 | Ga0466971_0167919 | 3300044719 | Bacteria | 1029 |
| 535 | Ga0466970_0018702 | 3300044765 | Bacteria | 3590 |
| 536 | Ga0466970_0018946 | 3300044765 | Bacteria | 3566 |
| 537 | Ga0466957_0000428 | 3300044842 | Bacteria | 20729 |
| 538 | Ga0466957_0001546 | 3300044842 | Bacteria | 12103 |
| 539 | Ga0466959_0000003 | 3300045049 | Bacteria | 285164 |
| 540 | Ga0466959_0000488 | 3300045049 | Bacteria | 23122 |
| 541 | Ga0466959_0067262 | 3300045049 | Bacteria | 2598 |
| 542 | Ga0466967_0269720 | 3300045976 | Bacteria | 1631 |
| 543 | Ga0466967_0527085 | 3300045976 | Bacteria | 1161 |
| 544 | Ga0495638_0120656 | 3300046460 | Bacteria | 1550 |
| 545 | Ga0495580_0401459 | 3300046472 | Bacteria | 924 |
| 546 | Ga0495642_0016639 | 3300046528 | Bacteria | 2869 |
| 547 | Ga0495668_0000302 | 3300046616 | Bacteria | 68079 |
| 548 | Ga0495611_0000061 | 3300046648 | Bacteria | 77533 |
| 549 | Ga0495635_0153703 | 3300046663 | Bacteria | 1566 |
| 550 | Ga0495600_0411156 | 3300046809 | Bacteria | 841 |
| 551 | Ga0495672_0005682 | 3300047320 | Bacteria | 9829 |
| 552 | Ga0495672_0018449 | 3300047320 | Bacteria | 4630 |
| 553 | Ga0495672_0234052 | 3300047320 | Bacteria | 900 |
| 554 | Ga0495686_0000010 | 3300047472 | Bacteria | 573229 |
| 555 | Ga0495686_0012477 | 3300047472 | Bacteria | 5941 |
| 556 | Ga0495686_0284601 | 3300047472 | Bacteria | 918 |
| 557 | Ga0496110_0589746 | 3300048913 | Bacteria | 1009 |
| 558 | Ga0496115_0008884 | 3300048918 | Bacteria | 7448 |
| 559 | Ga0501031_0303091 | 3300049568 | Bacteria | 1035 |
| 560 | Ga0501032_0010324 | 3300049569 | Bacteria | 6737 |
| 561 | Ga0501033_0385959 | 3300049570 | Bacteria | 978 |
| 562 | Ga0501033_0398674 | 3300049570 | Bacteria | 960 |
| 563 | Ga0501034_0000004 | 3300049571 | Bacteria | 382255 |
| 564 | Ga0501034_0013427 | 3300049571 | Bacteria | 8430 |
| 565 | Ga0501034_0043155 | 3300049571 | Bacteria | 4565 |
| 566 | Ga0501034_0061010 | 3300049571 | Bacteria | 3788 |
| 567 | Ga0501034_0148138 | 3300049571 | Bacteria | 2323 |
| 568 | Ga0501034_0459750 | 3300049571 | Bacteria | 1190 |
| 569 | Ga0501036_0022006 | 3300049572 | Bacteria | 5361 |
| 570 | Ga0501036_0568815 | 3300049572 | Bacteria | 941 |
| 571 | Ga0501036_0639647 | 3300049572 | Bacteria | 881 |
| 572 | Ga0501037_0131682 | 3300049573 | Bacteria | 1793 |
| 573 | Ga0501037_0348103 | 3300049573 | Bacteria | 1023 |
| 574 | Ga0501038_0015262 | 3300049574 | Bacteria | 6984 |
| 575 | Ga0501038_0226201 | 3300049574 | Bacteria | 1491 |
| 576 | Ga0501039_0040701 | 3300049575 | Bacteria | 3587 |
| 577 | Ga0501039_0076399 | 3300049575 | Bacteria | 2604 |
| 578 | Ga0501040_0024014 | 3300049576 | Bacteria | 4090 |
| 579 | Ga0501040_0138935 | 3300049576 | Bacteria | 1710 |
| 580 | Ga0501042_0049268 | 3300049578 | Bacteria | 3005 |
| 581 | Ga0501042_0203698 | 3300049578 | Bacteria | 1427 |
| 582 | Ga0501043_0010690 | 3300049579 | Bacteria | 7189 |
| 583 | Ga0501043_0117068 | 3300049579 | Bacteria | 2091 |
| 584 | Ga0501043_0572441 | 3300049579 | Bacteria | 837 |
| 585 | Ga0501046_0005998 | 3300049580 | Bacteria | 10807 |
| 586 | Ga0501046_0055861 | 3300049580 | Bacteria | 3100 |
| 587 | Ga0501046_0214974 | 3300049580 | Bacteria | 1426 |
| 588 | Ga0501047_0009030 | 3300049581 | Bacteria | 9412 |
| 589 | Ga0501047_0019423 | 3300049581 | Bacteria | 6520 |
| 590 | Ga0501047_0156907 | 3300049581 | Bacteria | 2149 |
| 591 | Ga0501047_0170288 | 3300049581 | Bacteria | 2047 |
| 592 | Ga0501048_0267987 | 3300049582 | Bacteria | 1213 |
| 593 | Ga0501067_0278172 | 3300049583 | Bacteria | 932 |
| 594 | Ga0501068_0078592 | 3300049584 | Bacteria | 2022 |
| 595 | Ga0501068_0191671 | 3300049584 | Bacteria | 1295 |
| 596 | Ga0501070_0006613 | 3300049586 | Bacteria | 9866 |
| 597 | Ga0501070_0019796 | 3300049586 | Bacteria | 5644 |
| 598 | Ga0501071_0010198 | 3300049587 | Bacteria | 6287 |
| 599 | Ga0501072_0004554 | 3300049588 | Bacteria | 10543 |
| 600 | Ga0501072_0164130 | 3300049588 | Bacteria | 1772 |
| 601 | Ga0501073_0100011 | 3300049589 | Bacteria | 2013 |
| 602 | Ga0501074_0004746 | 3300049590 | Bacteria | 9743 |
| 603 | Ga0501074_0453491 | 3300049590 | Bacteria | 909 |
| 604 | Ga0501075_0007589 | 3300049591 | Bacteria | 7526 |
| 605 | Ga0501076_0103654 | 3300049592 | Bacteria | 2295 |
| 606 | Ga0501076_0528909 | 3300049592 | Bacteria | 972 |
| 607 | Ga0501077_0009648 | 3300049593 | Bacteria | 6000 |
| 608 | Ga0501077_0083098 | 3300049593 | Bacteria | 2029 |
| 609 | Ga0501206_019297 | 3300049653 | Bacteria | 964 |
| 610 | Ga0501207_000200 | 3300049654 | Bacteria | 5921 |
| 611 | Ga0501243_037238 | 3300049675 | Bacteria | 845 |
| 612 | Ga0501219_000321 | 3300049703 | Bacteria | 8334 |
| 613 | Ga0501225_0003367 | 3300049705 | Bacteria | 4855 |
| 614 | Ga0501079_0005805 | 3300049741 | Bacteria | 9227 |
| 615 | Ga0501079_0042780 | 3300049741 | Bacteria | 3497 |
| 616 | Ga0501079_0177956 | 3300049741 | Bacteria | 1659 |
| 617 | Ga0501080_0033622 | 3300049742 | Bacteria | 4786 |
| 618 | Ga0501080_0057387 | 3300049742 | Bacteria | 3624 |
| 619 | Ga0501081_0006944 | 3300049743 | Bacteria | 7357 |
| 620 | Ga0501083_0041069 | 3300049744 | Bacteria | 3138 |
| 621 | Ga0501083_0074150 | 3300049744 | Bacteria | 2261 |
| 622 | Ga0501083_0129585 | 3300049744 | Bacteria | 1653 |
| 623 | Ga0501035_0023355 | 3300049822 | Bacteria | 5672 |
| 624 | Ga0501035_0028623 | 3300049822 | Bacteria | 5086 |
| 625 | Ga0501035_0038469 | 3300049822 | Bacteria | 4331 |
| 626 | Ga0501035_0110505 | 3300049822 | Bacteria | 2409 |
| 627 | Ga0501044_0009878 | 3300049823 | Bacteria | 10371 |
| 628 | Ga0501044_0081954 | 3300049823 | Bacteria | 3265 |
| 629 | Ga0501044_0095326 | 3300049823 | Bacteria | 2999 |
| 630 | Ga0501045_0574996 | 3300049824 | Bacteria | 835 |
| 631 | Ga0501284_00001 | 3300050005 | Bacteria | 261916 |
| 632 | nmdc:mga0k408_47296_c1 | 3300050493 | Bacteria | 2486 |
| 633 | nmdc:mga0k408_53148_c1 | 3300050493 | Bacteria | 2347 |
| 634 | nmdc:mga0k408_54390_c1 | 3300050493 | Bacteria | 2320 |
| 635 | nmdc:mga0k408_55646_c1 | 3300050493 | Bacteria | 2294 |
| 636 | nmdc:mga0k408_68441_c1 | 3300050493 | Bacteria | 2071 |
| 637 | nmdc:mga07m45_365277_c1 | 3300050496 | Bacteria | 838 |
| 638 | nmdc:mga05p37_235046_c1 | 3300050507 | Bacteria | 2206 |
| 639 | nmdc:mga05p37_482_c1 | 3300050507 | Bacteria | 43621 |
| 640 | nmdc:mga09592_17643_c1 | 3300050508 | Bacteria | 5850 |
| 641 | nmdc:mga09592_5311_c1 | 3300050508 | Bacteria | 10470 |
| 642 | nmdc:mga0qj67_4695_c1 | 3300050509 | Bacteria | 9918 |
| 643 | nmdc:mga0qj67_71409_c1 | 3300050509 | Bacteria | 2771 |
| 644 | nmdc:mga06r32_13475_c1 | 3300050510 | Bacteria | 7408 |
| 645 | nmdc:mga06r32_28324_c1 | 3300050510 | Bacteria | 5240 |
| 646 | nmdc:mga06r32_352998_c1 | 3300050510 | Bacteria | 1455 |
| 647 | nmdc:mga08y16_295698_c1 | 3300050511 | Bacteria | 1669 |
| 648 | nmdc:mga08y16_360998_c1 | 3300050511 | Bacteria | 1491 |
| 649 | nmdc:mga08y16_54079_c1 | 3300050511 | Bacteria | 4196 |
| 650 | nmdc:mga08y16_733552_c1 | 3300050511 | Bacteria | 985 |
| 651 | Ga0500578_0001290 | 3300053086 | Bacteria | 25877 |
| 652 | Ga0500578_0129817 | 3300053086 | Bacteria | 1581 |
| 653 | Ga0500644_0157097 | 3300053088 | Bacteria | 916 |
| 654 | Ga0500646_0007918 | 3300053090 | Bacteria | 2716 |
| 655 | Ga0500583_0000019 | 3300053092 | Bacteria | 130534 |
| 656 | Ga0500583_0004286 | 3300053092 | Bacteria | 4628 |
| 657 | Ga0500651_0181427 | 3300053093 | Bacteria | 1250 |
| 658 | Ga0500554_040399 | 3300053102 | Bacteria | 1429 |
| 659 | Ga0500594_0063049 | 3300053118 | Bacteria | 1073 |
| 660 | Ga0500652_020551 | 3300053131 | Bacteria | 2472 |
| 661 | Ga0500658_0045886 | 3300053134 | Bacteria | 1768 |
| 662 | Ga0500568_0000208 | 3300053139 | Bacteria | 51266 |
| 663 | Ga0500573_0138055 | 3300053140 | Bacteria | 1345 |
| 664 | Ga0500588_0125342 | 3300053146 | Bacteria | 910 |
| 665 | Ga0500588_0163015 | 3300053146 | Bacteria | 812 |
| 666 | Ga0500616_0276094 | 3300053153 | Bacteria | 707 |
| 667 | Ga0500622_0160846 | 3300053156 | Bacteria | 1053 |
| 668 | Ga0500636_0156465 | 3300053177 | Bacteria | 1247 |
| 669 | Ga0500637_0010936 | 3300053178 | Bacteria | 4669 |
| 670 | Ga0500611_000001 | 3300053727 | Bacteria | 385744 |
| 671 | Ga0501084_0041252 | 3300054114 | Bacteria | 3861 |
| 672 | Ga0501084_0108657 | 3300054114 | Bacteria | 2330 |
| 673 | Ga0501084_0118061 | 3300054114 | Bacteria | 2230 |
| 674 | Ga0501082_0005462 | 3300060353 | Bacteria | 11037 |
| 675 | Ga0466962_0001581 | 3300061719 | Bacteria | 10654 |
| 676 | Ga0530510_0079881 | 3300061734 | Bacteria | 2379 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049592 | Ga0501076_0103654 | Ga0501076_0103654_1262_1966 | 216 |
| 2 | 3300025905 | Ga0207685_10114091 | Ga0207685_101140912 | 217 |
| 3 | 3300003323 | rootH1_10010732 | rootH1_100107322 | 219 |
| 4 | 3300005293 | Ga0065715_10020203 | Ga0065715_100202031 | 219 |
| 5 | 3300005617 | Ga0068859_100470606 | Ga0068859_1004706062 | 219 |
| 6 | 3300005834 | Ga0068851_10065975 | Ga0068851_100659751 | 219 |
| 7 | 3300006931 | Ga0097620_100470639 | Ga0097620_1004706392 | 219 |
| 8 | 3300013102 | Ga0157371_10001626 | Ga0157371_1000162611 | 219 |
| 9 | 3300025925 | Ga0207650_10047529 | Ga0207650_100475292 | 219 |
| 10 | 3300031251 | Ga0265327_10000172 | Ga0265327_1000017215 | 219 |
| 11 | 3300031456 | Ga0307513_10377596 | Ga0307513_103775962 | 219 |
| 12 | 3300046528 | Ga0495642_0016639 | Ga0495642_0016639_841_1500 | 219 |
| 13 | 3300048918 | Ga0496115_0008884 | Ga0496115_0008884_1251_1910 | 219 |
| 14 | 3300050496 | nmdc:mga07m45_365277_c1 | nmdc:mga07m45_365277_c1_149_817 | 219 |
| 15 | 3300005334 | Ga0068869_100060326 | Ga0068869_1000603263 | 220 |
| 16 | 3300005338 | Ga0068868_100677507 | Ga0068868_1006775071 | 220 |
| 17 | 3300005353 | Ga0070669_100066732 | Ga0070669_1000667322 | 220 |
| 18 | 3300005539 | Ga0068853_100005414 | Ga0068853_1000054149 | 220 |
| 19 | 3300005719 | Ga0068861_100006209 | Ga0068861_1000062094 | 220 |
| 20 | 3300006358 | Ga0068871_100252807 | Ga0068871_1002528072 | 220 |
| 21 | 3300009174 | Ga0105241_10006293 | Ga0105241_100062938 | 220 |
| 22 | 3300010375 | Ga0105239_10011188 | Ga0105239_1001118810 | 220 |
| 23 | 3300013105 | Ga0157369_10007223 | Ga0157369_1000722313 | 220 |
| 24 | 3300013306 | Ga0163162_10002447 | Ga0163162_1000244713 | 220 |
| 25 | 3300013308 | Ga0157375_10154229 | Ga0157375_101542292 | 220 |
| 26 | 3300014745 | Ga0157377_10504318 | Ga0157377_105043182 | 220 |
| 27 | 3300014968 | Ga0157379_10005275 | Ga0157379_100052756 | 220 |
| 28 | 3300014969 | Ga0157376_10070136 | Ga0157376_100701363 | 220 |
| 29 | 3300017792 | Ga0163161_10075295 | Ga0163161_100752953 | 220 |
| 30 | 3300017792 | Ga0163161_10237323 | Ga0163161_102373231 | 220 |
| 31 | 3300025914 | Ga0207671_10085996 | Ga0207671_100859961 | 220 |
| 32 | 3300025920 | Ga0207649_10179546 | Ga0207649_101795462 | 220 |
| 33 | 3300025936 | Ga0207670_10062784 | Ga0207670_100627842 | 220 |
| 34 | 3300025940 | Ga0207691_10300203 | Ga0207691_103002031 | 220 |
| 35 | 3300026088 | Ga0207641_10166367 | Ga0207641_101663672 | 220 |
| 36 | 3300026089 | Ga0207648_10102681 | Ga0207648_101026812 | 220 |
| 37 | 3300026118 | Ga0207675_100003754 | Ga0207675_1000037543 | 220 |
| 38 | 3300028381 | Ga0268264_10490517 | Ga0268264_104905171 | 220 |
| 39 | 3300031548 | Ga0307408_100285963 | Ga0307408_1002859632 | 220 |
| 40 | 3300031731 | Ga0307405_10054867 | Ga0307405_100548672 | 220 |
| 41 | 3300031824 | Ga0307413_10048737 | Ga0307413_100487372 | 220 |
| 42 | 3300031911 | Ga0307412_10524207 | Ga0307412_105242071 | 220 |
| 43 | 3300031995 | Ga0307409_100256882 | Ga0307409_1002568821 | 220 |
| 44 | 3300032002 | Ga0307416_100007276 | Ga0307416_1000072767 | 220 |
| 45 | 3300037466 | Ga0395898_0658837 | Ga0395898_0658837_295_957 | 220 |
| 46 | 3300038443 | Ga0395901_0838566 | Ga0395901_0838566_24_686 | 220 |
| 47 | 3300042002 | Ga0439442_039304 | Ga0439442_039304_312_974 | 220 |
| 48 | 3300042015 | Ga0439462_0062632 | Ga0439462_0062632_51_713 | 220 |
| 49 | 3300042435 | Ga0439434_0130367 | Ga0439434_0130367_116_778 | 220 |
| 50 | 3300047320 | Ga0495672_0234052 | Ga0495672_0234052_31_693 | 220 |
| 51 | 3300049654 | Ga0501207_000200 | Ga0501207_000200_2298_2960 | 220 |
| 52 | 3300050493 | nmdc:mga0k408_55646_c1 | nmdc:mga0k408_55646_c1_20_682 | 220 |
| 53 | 3300053146 | Ga0500588_0163015 | Ga0500588_0163015_48_710 | 220 |
| 54 | 3300053153 | Ga0500616_0276094 | Ga0500616_0276094_18_680 | 220 |
| 55 | 3300005456 | Ga0070678_100096160 | Ga0070678_1000961602 | 221 |
| 56 | 3300026121 | Ga0207683_10245750 | Ga0207683_102457502 | 221 |
| 57 | 3300031507 | Ga0307509_10151950 | Ga0307509_101519501 | 221 |
| 58 | 3300005334 | Ga0068869_100057863 | Ga0068869_1000578633 | 225 |
| 59 | 3300009148 | Ga0105243_10184436 | Ga0105243_101844362 | 225 |
| 60 | 3300009176 | Ga0105242_10028617 | Ga0105242_100286174 | 225 |
| 61 | 3300025899 | Ga0207642_10054219 | Ga0207642_100542192 | 225 |
| 62 | 3300025907 | Ga0207645_10027483 | Ga0207645_100274832 | 225 |
| 63 | 3300025935 | Ga0207709_10169214 | Ga0207709_101692142 | 225 |
| 64 | 3300025942 | Ga0207689_10086393 | Ga0207689_100863932 | 225 |
| 65 | 3300026118 | Ga0207675_100100301 | Ga0207675_1001003012 | 225 |
| 66 | 3300028380 | Ga0268265_10144805 | Ga0268265_101448053 | 225 |
| 67 | 3300028381 | Ga0268264_10597587 | Ga0268264_105975871 | 225 |
| 68 | 3300050493 | nmdc:mga0k408_53148_c1 | nmdc:mga0k408_53148_c1_318_1031 | 225 |
| 69 | 3300006237 | Ga0097621_100211165 | Ga0097621_1002111652 | 226 |
| 70 | 3300026121 | Ga0207683_10037605 | Ga0207683_100376055 | 226 |
| 71 | 3300049653 | Ga0501206_019297 | Ga0501206_019297_22_711 | 229 |
| 72 | 3300053156 | Ga0500622_0160846 | Ga0500622_0160846_10_699 | 229 |
| 73 | 3300046663 | Ga0495635_0153703 | Ga0495635_0153703_24_737 | 230 |
| 74 | iso_pu_bacteria | 3003233435 | 3003235196 | 230 |
| 75 | 3300005330 | Ga0070690_100079437 | Ga0070690_1000794372 | 231 |
| 76 | 3300005334 | Ga0068869_100022861 | Ga0068869_1000228612 | 231 |
| 77 | 3300005338 | Ga0068868_100118841 | Ga0068868_1001188412 | 231 |
| 78 | 3300005340 | Ga0070689_100083237 | Ga0070689_1000832373 | 231 |
| 79 | 3300005344 | Ga0070661_100112590 | Ga0070661_1001125902 | 231 |
| 80 | 3300005354 | Ga0070675_100096076 | Ga0070675_1000960763 | 231 |
| 81 | 3300005355 | Ga0070671_100475351 | Ga0070671_1004753511 | 231 |
| 82 | 3300005366 | Ga0070659_100461105 | Ga0070659_1004611052 | 231 |
| 83 | 3300005539 | Ga0068853_100940301 | Ga0068853_1009403011 | 231 |
| 84 | 3300005543 | Ga0070672_100104380 | Ga0070672_1001043802 | 231 |
| 85 | 3300005564 | Ga0070664_100025450 | Ga0070664_1000254503 | 231 |
| 86 | 3300005719 | Ga0068861_100865576 | Ga0068861_1008655761 | 231 |
| 87 | 3300005842 | Ga0068858_100659088 | Ga0068858_1006590881 | 231 |
| 88 | 3300006237 | Ga0097621_100490485 | Ga0097621_1004904851 | 231 |
| 89 | 3300006358 | Ga0068871_100347101 | Ga0068871_1003471012 | 231 |
| 90 | 3300009177 | Ga0105248_10445460 | Ga0105248_104454601 | 231 |
| 91 | 3300017792 | Ga0163161_10719308 | Ga0163161_107193081 | 231 |
| 92 | 3300025907 | Ga0207645_10020710 | Ga0207645_100207102 | 231 |
| 93 | 3300025918 | Ga0207662_10060356 | Ga0207662_100603561 | 231 |
| 94 | 3300025920 | Ga0207649_10208190 | Ga0207649_102081901 | 231 |
| 95 | 3300025931 | Ga0207644_10354278 | Ga0207644_103542781 | 231 |
| 96 | 3300025940 | Ga0207691_10055953 | Ga0207691_100559532 | 231 |
| 97 | 3300025945 | Ga0207679_10029827 | Ga0207679_100298272 | 231 |
| 98 | iso_pu_bacteria | 2818991444 | 2819585597 | 232 |
| 99 | 3300006237 | Ga0097621_100992207 | Ga0097621_1009922071 | 233 |
| 100 | iso_pu_bacteria | 2738541278 | 2738725043 | 233 |
| 101 | 3300006358 | Ga0068871_100828302 | Ga0068871_1008283021 | 234 |
| 102 | 3300037471 | Ga0395905_0000002 | Ga0395905_0000002_1251055_1251762 | 234 |
| 103 | 3300049572 | Ga0501036_0639647 | Ga0501036_0639647_131_835 | 234 |
| 104 | 3300005295 | Ga0065707_10481629 | Ga0065707_104816291 | 235 |
| 105 | 3300009147 | Ga0114129_10290216 | Ga0114129_102902163 | 235 |
| 106 | 3300037853 | Ga0436364_1006406 | Ga0436364_1006406_25_744 | 235 |
| 107 | 3300050507 | nmdc:mga05p37_235046_c1 | nmdc:mga05p37_235046_c1_1172_1903 | 235 |
| 108 | 3300005327 | Ga0070658_10060952 | Ga0070658_100609522 | 236 |
| 109 | 3300005330 | Ga0070690_100235141 | Ga0070690_1002351411 | 236 |
| 110 | 3300005331 | Ga0070670_100091548 | Ga0070670_1000915482 | 236 |
| 111 | 3300005331 | Ga0070670_100184343 | Ga0070670_1001843432 | 236 |
| 112 | 3300005335 | Ga0070666_10000072 | Ga0070666_1000007264 | 236 |
| 113 | 3300005338 | Ga0068868_100008885 | Ga0068868_1000088856 | 236 |
| 114 | 3300005347 | Ga0070668_100072324 | Ga0070668_1000723242 | 236 |
| 115 | 3300005355 | Ga0070671_100038078 | Ga0070671_1000380786 | 236 |
| 116 | 3300005364 | Ga0070673_100056888 | Ga0070673_1000568884 | 236 |
| 117 | 3300005367 | Ga0070667_100123398 | Ga0070667_1001233982 | 236 |
| 118 | 3300005467 | Ga0070706_100106836 | Ga0070706_1001068362 | 236 |
| 119 | 3300005468 | Ga0070707_100028019 | Ga0070707_1000280194 | 236 |
| 120 | 3300005539 | Ga0068853_100021530 | Ga0068853_1000215302 | 236 |
| 121 | 3300005543 | Ga0070672_100034513 | Ga0070672_1000345135 | 236 |
| 122 | 3300005616 | Ga0068852_100011225 | Ga0068852_10001122510 | 236 |
| 123 | 3300005617 | Ga0068859_100000006 | Ga0068859_10000000663 | 236 |
| 124 | 3300005617 | Ga0068859_100090079 | Ga0068859_1000900792 | 236 |
| 125 | 3300005618 | Ga0068864_100000469 | Ga0068864_10000046926 | 236 |
| 126 | 3300005618 | Ga0068864_100160788 | Ga0068864_1001607883 | 236 |
| 127 | 3300005841 | Ga0068863_100002075 | Ga0068863_10000207512 | 236 |
| 128 | 3300005842 | Ga0068858_100000978 | Ga0068858_10000097820 | 236 |
| 129 | 3300005843 | Ga0068860_100001713 | Ga0068860_10000171326 | 236 |
| 130 | 3300005843 | Ga0068860_100082085 | Ga0068860_1000820853 | 236 |
| 131 | 3300006237 | Ga0097621_100025089 | Ga0097621_1000250898 | 236 |
| 132 | 3300006358 | Ga0068871_100036138 | Ga0068871_1000361384 | 236 |
| 133 | 3300006846 | Ga0075430_100004920 | Ga0075430_1000049208 | 236 |
| 134 | 3300006847 | Ga0075431_100112689 | Ga0075431_1001126893 | 236 |
| 135 | 3300006880 | Ga0075429_100013242 | Ga0075429_1000132427 | 236 |
| 136 | 3300006880 | Ga0075429_100022401 | Ga0075429_1000224015 | 236 |
| 137 | 3300006881 | Ga0068865_100031052 | Ga0068865_1000310521 | 236 |
| 138 | 3300006931 | Ga0097620_100000006 | Ga0097620_10000000663 | 236 |
| 139 | 3300006931 | Ga0097620_100090075 | Ga0097620_1000900752 | 236 |
| 140 | 3300009094 | Ga0111539_10774045 | Ga0111539_107740452 | 236 |
| 141 | 3300009101 | Ga0105247_10004725 | Ga0105247_1000472511 | 236 |
| 142 | 3300009174 | Ga0105241_10000324 | Ga0105241_1000032411 | 236 |
| 143 | 3300009176 | Ga0105242_10238699 | Ga0105242_102386991 | 236 |
| 144 | 3300009545 | Ga0105237_10006111 | Ga0105237_1000611113 | 236 |
| 145 | 3300009545 | Ga0105237_10346767 | Ga0105237_103467673 | 236 |
| 146 | 3300009551 | Ga0105238_10259217 | Ga0105238_102592171 | 236 |
| 147 | 3300009553 | Ga0105249_10002054 | Ga0105249_100020547 | 236 |
| 148 | 3300010375 | Ga0105239_10010461 | Ga0105239_1001046110 | 236 |
| 149 | 3300011119 | Ga0105246_10091029 | Ga0105246_100910291 | 236 |
| 150 | 3300011119 | Ga0105246_10363290 | Ga0105246_103632901 | 236 |
| 151 | 3300013296 | Ga0157374_10024890 | Ga0157374_100248907 | 236 |
| 152 | 3300013296 | Ga0157374_10107475 | Ga0157374_101074754 | 236 |
| 153 | 3300013296 | Ga0157374_10398592 | Ga0157374_103985922 | 236 |
| 154 | 3300013297 | Ga0157378_10048214 | Ga0157378_100482146 | 236 |
| 155 | 3300013297 | Ga0157378_10091377 | Ga0157378_100913772 | 236 |
| 156 | 3300013297 | Ga0157378_10171743 | Ga0157378_101717432 | 236 |
| 157 | 3300013297 | Ga0157378_10268289 | Ga0157378_102682892 | 236 |
| 158 | 3300013306 | Ga0163162_10000112 | Ga0163162_1000011247 | 236 |
| 159 | 3300013308 | Ga0157375_10209843 | Ga0157375_102098431 | 236 |
| 160 | 3300013308 | Ga0157375_10361412 | Ga0157375_103614123 | 236 |
| 161 | 3300014968 | Ga0157379_10029944 | Ga0157379_100299443 | 236 |
| 162 | 3300014969 | Ga0157376_10001570 | Ga0157376_100015709 | 236 |
| 163 | 3300021384 | Ga0213876_10016061 | Ga0213876_100160613 | 236 |
| 164 | 3300025302 | Ga0207426_1000059 | Ga0207426_1000059254 | 236 |
| 165 | 3300025904 | Ga0207647_10108484 | Ga0207647_101084842 | 236 |
| 166 | 3300025909 | Ga0207705_10216977 | Ga0207705_102169771 | 236 |
| 167 | 3300025911 | Ga0207654_10009816 | Ga0207654_100098167 | 236 |
| 168 | 3300025914 | Ga0207671_10000453 | Ga0207671_1000045331 | 236 |
| 169 | 3300025922 | Ga0207646_10012637 | Ga0207646_100126376 | 236 |
| 170 | 3300025940 | Ga0207691_10145305 | Ga0207691_101453051 | 236 |
| 171 | 3300025942 | Ga0207689_10001492 | Ga0207689_100014927 | 236 |
| 172 | 3300025960 | Ga0207651_10168833 | Ga0207651_101688332 | 236 |
| 173 | 3300025961 | Ga0207712_10005438 | Ga0207712_100054386 | 236 |
| 174 | 3300025972 | Ga0207668_10435833 | Ga0207668_104358331 | 236 |
| 175 | 3300025986 | Ga0207658_10010564 | Ga0207658_100105647 | 236 |
| 176 | 3300025986 | Ga0207658_10032675 | Ga0207658_100326753 | 236 |
| 177 | 3300026023 | Ga0207677_10045716 | Ga0207677_100457162 | 236 |
| 178 | 3300026035 | Ga0207703_10002804 | Ga0207703_100028048 | 236 |
| 179 | 3300026041 | Ga0207639_10088393 | Ga0207639_100883933 | 236 |
| 180 | 3300026041 | Ga0207639_10142613 | Ga0207639_101426132 | 236 |
| 181 | 3300026088 | Ga0207641_10000058 | Ga0207641_1000005815 | 236 |
| 182 | 3300026095 | Ga0207676_10282148 | Ga0207676_102821481 | 236 |
| 183 | 3300026121 | Ga0207683_10390413 | Ga0207683_103904132 | 236 |
| 184 | 3300026142 | Ga0207698_10007272 | Ga0207698_100072723 | 236 |
| 185 | 3300028381 | Ga0268264_10000726 | Ga0268264_1000072628 | 236 |
| 186 | 3300028381 | Ga0268264_10063815 | Ga0268264_100638152 | 236 |
| 187 | 3300028794 | Ga0307515_10000059 | Ga0307515_10000059206 | 236 |
| 188 | 3300028794 | Ga0307515_10192629 | Ga0307515_101926292 | 236 |
| 189 | 3300031456 | Ga0307513_10030476 | Ga0307513_100304765 | 236 |
| 190 | 3300031507 | Ga0307509_10093902 | Ga0307509_100939024 | 236 |
| 191 | 3300031616 | Ga0307508_10000485 | Ga0307508_1000048511 | 236 |
| 192 | 3300031616 | Ga0307508_10057484 | Ga0307508_100574842 | 236 |
| 193 | 3300031731 | Ga0307405_10184986 | Ga0307405_101849862 | 236 |
| 194 | 3300037418 | Ga0395900_0456266 | Ga0395900_0456266_375_1094 | 236 |
| 195 | 3300039437 | Ga0436365_1001352 | Ga0436365_1001352_3255_3983 | 236 |
| 196 | 3300044658 | Ga0466972_0000168 | Ga0466972_0000168_45040_45759 | 236 |
| 197 | 3300044684 | Ga0466966_0013541 | Ga0466966_0013541_3752_4480 | 236 |
| 198 | 3300044684 | Ga0466966_0395256 | Ga0466966_0395256_86_817 | 236 |
| 199 | 3300044693 | Ga0466961_0064427 | Ga0466961_0064427_1205_1933 | 236 |
| 200 | 3300044765 | Ga0466970_0018702 | Ga0466970_0018702_2327_3046 | 236 |
| 201 | 3300045049 | Ga0466959_0067262 | Ga0466959_0067262_230_958 | 236 |
| 202 | 3300049570 | Ga0501033_0385959 | Ga0501033_0385959_217_960 | 236 |
| 203 | 3300049570 | Ga0501033_0398674 | Ga0501033_0398674_188_931 | 236 |
| 204 | 3300049571 | Ga0501034_0000004 | Ga0501034_0000004_154069_154779 | 236 |
| 205 | 3300049571 | Ga0501034_0148138 | Ga0501034_0148138_846_1556 | 236 |
| 206 | 3300049572 | Ga0501036_0568815 | Ga0501036_0568815_145_888 | 236 |
| 207 | 3300049575 | Ga0501039_0076399 | Ga0501039_0076399_534_1277 | 236 |
| 208 | 3300049576 | Ga0501040_0024014 | Ga0501040_0024014_1384_2127 | 236 |
| 209 | 3300049576 | Ga0501040_0138935 | Ga0501040_0138935_683_1426 | 236 |
| 210 | 3300049578 | Ga0501042_0049268 | Ga0501042_0049268_677_1420 | 236 |
| 211 | 3300049579 | Ga0501043_0572441 | Ga0501043_0572441_23_766 | 236 |
| 212 | 3300049580 | Ga0501046_0005998 | Ga0501046_0005998_5152_5895 | 236 |
| 213 | 3300049580 | Ga0501046_0214974 | Ga0501046_0214974_203_946 | 236 |
| 214 | 3300049583 | Ga0501067_0278172 | Ga0501067_0278172_68_796 | 236 |
| 215 | 3300049584 | Ga0501068_0078592 | Ga0501068_0078592_386_1129 | 236 |
| 216 | 3300049584 | Ga0501068_0191671 | Ga0501068_0191671_358_1101 | 236 |
| 217 | 3300049587 | Ga0501071_0010198 | Ga0501071_0010198_2834_3577 | 236 |
| 218 | 3300049588 | Ga0501072_0004554 | Ga0501072_0004554_1650_2393 | 236 |
| 219 | 3300049588 | Ga0501072_0164130 | Ga0501072_0164130_969_1712 | 236 |
| 220 | 3300049590 | Ga0501074_0453491 | Ga0501074_0453491_15_743 | 236 |
| 221 | 3300049591 | Ga0501075_0007589 | Ga0501075_0007589_1411_2154 | 236 |
| 222 | 3300049593 | Ga0501077_0009648 | Ga0501077_0009648_4433_5176 | 236 |
| 223 | 3300049593 | Ga0501077_0083098 | Ga0501077_0083098_709_1452 | 236 |
| 224 | 3300049741 | Ga0501079_0005805 | Ga0501079_0005805_2042_2785 | 236 |
| 225 | 3300049741 | Ga0501079_0177956 | Ga0501079_0177956_424_1167 | 236 |
| 226 | 3300049742 | Ga0501080_0033622 | Ga0501080_0033622_3084_3827 | 236 |
| 227 | 3300049743 | Ga0501081_0006944 | Ga0501081_0006944_1400_2143 | 236 |
| 228 | 3300049744 | Ga0501083_0074150 | Ga0501083_0074150_563_1306 | 236 |
| 229 | 3300049824 | Ga0501045_0574996 | Ga0501045_0574996_16_741 | 236 |
| 230 | 3300050508 | nmdc:mga09592_17643_c1 | nmdc:mga09592_17643_c1_2763_3506 | 236 |
| 231 | 3300050509 | nmdc:mga0qj67_71409_c1 | nmdc:mga0qj67_71409_c1_1724_2467 | 236 |
| 232 | 3300050510 | nmdc:mga06r32_13475_c1 | nmdc:mga06r32_13475_c1_4451_5194 | 236 |
| 233 | 3300050511 | nmdc:mga08y16_733552_c1 | nmdc:mga08y16_733552_c1_161_904 | 236 |
| 234 | 3300053118 | Ga0500594_0063049 | Ga0500594_0063049_182_892 | 236 |
| 235 | 3300054114 | Ga0501084_0041252 | Ga0501084_0041252_2922_3665 | 236 |
| 236 | 3300054114 | Ga0501084_0108657 | Ga0501084_0108657_517_1260 | 236 |
| 237 | 3300060353 | Ga0501082_0005462 | Ga0501082_0005462_9213_9956 | 236 |
| 238 | 3300061734 | Ga0530510_0079881 | Ga0530510_0079881_560_1303 | 236 |
| 239 | 3300000545 | CNXas_1002191 | CNXas_10021911 | 237 |
| 240 | 3300002459 | JGI24751J29686_10000297 | JGI24751J29686_100002974 | 237 |
| 241 | 3300003316 | rootH1_10038406 | rootH1_100384062 | 237 |
| 242 | 3300003320 | rootH2_10007161 | rootH2_1000716124 | 237 |
| 243 | 3300003322 | rootL2_10009250 | rootL2_100092501 | 237 |
| 244 | 3300003323 | rootH1_10001569 | rootH1_100015694 | 237 |
| 245 | 3300005289 | Ga0065704_10117876 | Ga0065704_101178761 | 237 |
| 246 | 3300005289 | Ga0065704_10134167 | Ga0065704_101341672 | 237 |
| 247 | 3300005290 | Ga0065712_10006725 | Ga0065712_100067253 | 237 |
| 248 | 3300005290 | Ga0065712_10069410 | Ga0065712_100694104 | 237 |
| 249 | 3300005290 | Ga0065712_10102063 | Ga0065712_101020632 | 237 |
| 250 | 3300005293 | Ga0065715_10097890 | Ga0065715_100978905 | 237 |
| 251 | 3300005293 | Ga0065715_10131286 | Ga0065715_101312862 | 237 |
| 252 | 3300005295 | Ga0065707_10099164 | Ga0065707_100991642 | 237 |
| 253 | 3300005295 | Ga0065707_10113318 | Ga0065707_101133182 | 237 |
| 254 | 3300005327 | Ga0070658_10032384 | Ga0070658_100323845 | 237 |
| 255 | 3300005327 | Ga0070658_10032704 | Ga0070658_100327044 | 237 |
| 256 | 3300005327 | Ga0070658_10242787 | Ga0070658_102427873 | 237 |
| 257 | 3300005329 | Ga0070683_100024991 | Ga0070683_1000249913 | 237 |
| 258 | 3300005330 | Ga0070690_100029757 | Ga0070690_1000297573 | 237 |
| 259 | 3300005331 | Ga0070670_100021507 | Ga0070670_1000215074 | 237 |
| 260 | 3300005331 | Ga0070670_100028923 | Ga0070670_1000289233 | 237 |
| 261 | 3300005331 | Ga0070670_100146190 | Ga0070670_1001461902 | 237 |
| 262 | 3300005331 | Ga0070670_100301478 | Ga0070670_1003014781 | 237 |
| 263 | 3300005333 | Ga0070677_10174143 | Ga0070677_101741431 | 237 |
| 264 | 3300005334 | Ga0068869_100037645 | Ga0068869_1000376455 | 237 |
| 265 | 3300005334 | Ga0068869_100053761 | Ga0068869_1000537613 | 237 |
| 266 | 3300005334 | Ga0068869_100105840 | Ga0068869_1001058402 | 237 |
| 267 | 3300005335 | Ga0070666_10052394 | Ga0070666_100523942 | 237 |
| 268 | 3300005335 | Ga0070666_10081514 | Ga0070666_100815142 | 237 |
| 269 | 3300005335 | Ga0070666_10327654 | Ga0070666_103276541 | 237 |
| 270 | 3300005336 | Ga0070680_100068203 | Ga0070680_1000682031 | 237 |
| 271 | 3300005339 | Ga0070660_100000353 | Ga0070660_10000035310 | 237 |
| 272 | 3300005340 | Ga0070689_100150368 | Ga0070689_1001503682 | 237 |
| 273 | 3300005340 | Ga0070689_100295372 | Ga0070689_1002953722 | 237 |
| 274 | 3300005341 | Ga0070691_10207953 | Ga0070691_102079532 | 237 |
| 275 | 3300005341 | Ga0070691_10225792 | Ga0070691_102257922 | 237 |
| 276 | 3300005343 | Ga0070687_100055049 | Ga0070687_1000550492 | 237 |
| 277 | 3300005353 | Ga0070669_100013179 | Ga0070669_1000131795 | 237 |
| 278 | 3300005353 | Ga0070669_100140846 | Ga0070669_1001408461 | 237 |
| 279 | 3300005353 | Ga0070669_100480030 | Ga0070669_1004800302 | 237 |
| 280 | 3300005354 | Ga0070675_100037007 | Ga0070675_1000370075 | 237 |
| 281 | 3300005354 | Ga0070675_100240237 | Ga0070675_1002402371 | 237 |
| 282 | 3300005354 | Ga0070675_100515595 | Ga0070675_1005155952 | 237 |
| 283 | 3300005364 | Ga0070673_100001930 | Ga0070673_1000019307 | 237 |
| 284 | 3300005364 | Ga0070673_100095119 | Ga0070673_1000951192 | 237 |
| 285 | 3300005365 | Ga0070688_100001768 | Ga0070688_1000017685 | 237 |
| 286 | 3300005365 | Ga0070688_100067168 | Ga0070688_1000671682 | 237 |
| 287 | 3300005365 | Ga0070688_100126961 | Ga0070688_1001269611 | 237 |
| 288 | 3300005365 | Ga0070688_100448606 | Ga0070688_1004486061 | 237 |
| 289 | 3300005367 | Ga0070667_100031681 | Ga0070667_1000316816 | 237 |
| 290 | 3300005367 | Ga0070667_100346335 | Ga0070667_1003463351 | 237 |
| 291 | 3300005445 | Ga0070708_100196646 | Ga0070708_1001966462 | 237 |
| 292 | 3300005455 | Ga0070663_100047024 | Ga0070663_1000470242 | 237 |
| 293 | 3300005455 | Ga0070663_100293639 | Ga0070663_1002936392 | 237 |
| 294 | 3300005456 | Ga0070678_100042232 | Ga0070678_1000422322 | 237 |
| 295 | 3300005457 | Ga0070662_100059134 | Ga0070662_1000591341 | 237 |
| 296 | 3300005457 | Ga0070662_100200584 | Ga0070662_1002005842 | 237 |
| 297 | 3300005458 | Ga0070681_10032510 | Ga0070681_100325102 | 237 |
| 298 | 3300005459 | Ga0068867_100016063 | Ga0068867_1000160634 | 237 |
| 299 | 3300005459 | Ga0068867_100359275 | Ga0068867_1003592752 | 237 |
| 300 | 3300005466 | Ga0070685_10008872 | Ga0070685_100088724 | 237 |
| 301 | 3300005466 | Ga0070685_10045751 | Ga0070685_100457513 | 237 |
| 302 | 3300005466 | Ga0070685_10119568 | Ga0070685_101195682 | 237 |
| 303 | 3300005466 | Ga0070685_10423099 | Ga0070685_104230991 | 237 |
| 304 | 3300005468 | Ga0070707_100068849 | Ga0070707_1000688494 | 237 |
| 305 | 3300005468 | Ga0070707_100493878 | Ga0070707_1004938781 | 237 |
| 306 | 3300005471 | Ga0070698_100089668 | Ga0070698_1000896683 | 237 |
| 307 | 3300005518 | Ga0070699_100035304 | Ga0070699_1000353044 | 237 |
| 308 | 3300005530 | Ga0070679_100328890 | Ga0070679_1003288902 | 237 |
| 309 | 3300005535 | Ga0070684_100123300 | Ga0070684_1001233002 | 237 |
| 310 | 3300005539 | Ga0068853_100027012 | Ga0068853_1000270122 | 237 |
| 311 | 3300005539 | Ga0068853_100116726 | Ga0068853_1001167263 | 237 |
| 312 | 3300005539 | Ga0068853_100221793 | Ga0068853_1002217931 | 237 |
| 313 | 3300005543 | Ga0070672_100125084 | Ga0070672_1001250842 | 237 |
| 314 | 3300005543 | Ga0070672_100178205 | Ga0070672_1001782052 | 237 |
| 315 | 3300005543 | Ga0070672_100426605 | Ga0070672_1004266052 | 237 |
| 316 | 3300005544 | Ga0070686_100155613 | Ga0070686_1001556132 | 237 |
| 317 | 3300005549 | Ga0070704_100261834 | Ga0070704_1002618342 | 237 |
| 318 | 3300005563 | Ga0068855_100001281 | Ga0068855_10000128120 | 237 |
| 319 | 3300005563 | Ga0068855_100001364 | Ga0068855_10000136415 | 237 |
| 320 | 3300005563 | Ga0068855_100005605 | Ga0068855_10000560512 | 237 |
| 321 | 3300005563 | Ga0068855_100061780 | Ga0068855_1000617807 | 237 |
| 322 | 3300005563 | Ga0068855_100170031 | Ga0068855_1001700312 | 237 |
| 323 | 3300005563 | Ga0068855_100224735 | Ga0068855_1002247352 | 237 |
| 324 | 3300005577 | Ga0068857_100040989 | Ga0068857_1000409893 | 237 |
| 325 | 3300005577 | Ga0068857_100475945 | Ga0068857_1004759452 | 237 |
| 326 | 3300005577 | Ga0068857_100504050 | Ga0068857_1005040502 | 237 |
| 327 | 3300005614 | Ga0068856_100025243 | Ga0068856_1000252438 | 237 |
| 328 | 3300005616 | Ga0068852_100223678 | Ga0068852_1002236782 | 237 |
| 329 | 3300005616 | Ga0068852_100463858 | Ga0068852_1004638582 | 237 |
| 330 | 3300005617 | Ga0068859_100043650 | Ga0068859_1000436504 | 237 |
| 331 | 3300005617 | Ga0068859_100055565 | Ga0068859_1000555652 | 237 |
| 332 | 3300005617 | Ga0068859_100076850 | Ga0068859_1000768505 | 237 |
| 333 | 3300005617 | Ga0068859_100276535 | Ga0068859_1002765351 | 237 |
| 334 | 3300005617 | Ga0068859_100441309 | Ga0068859_1004413092 | 237 |
| 335 | 3300005618 | Ga0068864_100013747 | Ga0068864_1000137478 | 237 |
| 336 | 3300005618 | Ga0068864_100026382 | Ga0068864_1000263826 | 237 |
| 337 | 3300005618 | Ga0068864_100038927 | Ga0068864_1000389274 | 237 |
| 338 | 3300005618 | Ga0068864_100075767 | Ga0068864_1000757672 | 237 |
| 339 | 3300005618 | Ga0068864_100186352 | Ga0068864_1001863522 | 237 |
| 340 | 3300005719 | Ga0068861_100004575 | Ga0068861_10000457511 | 237 |
| 341 | 3300005719 | Ga0068861_100025586 | Ga0068861_1000255862 | 237 |
| 342 | 3300005719 | Ga0068861_100130465 | Ga0068861_1001304652 | 237 |
| 343 | 3300005834 | Ga0068851_10101144 | Ga0068851_101011442 | 237 |
| 344 | 3300005834 | Ga0068851_10401648 | Ga0068851_104016481 | 237 |
| 345 | 3300005840 | Ga0068870_10137798 | Ga0068870_101377982 | 237 |
| 346 | 3300005841 | Ga0068863_100428969 | Ga0068863_1004289691 | 237 |
| 347 | 3300005842 | Ga0068858_100227240 | Ga0068858_1002272402 | 237 |
| 348 | 3300005842 | Ga0068858_100838392 | Ga0068858_1008383922 | 237 |
| 349 | 3300005843 | Ga0068860_100060453 | Ga0068860_1000604535 | 237 |
| 350 | 3300005843 | Ga0068860_100211746 | Ga0068860_1002117462 | 237 |
| 351 | 3300005844 | Ga0068862_100012568 | Ga0068862_1000125683 | 237 |
| 352 | 3300005844 | Ga0068862_100020995 | Ga0068862_1000209957 | 237 |
| 353 | 3300005983 | Ga0081540_1017706 | Ga0081540_10177063 | 237 |
| 354 | 3300006173 | Ga0070716_100101830 | Ga0070716_1001018302 | 237 |
| 355 | 3300006195 | Ga0075366_10024460 | Ga0075366_100244602 | 237 |
| 356 | 3300006195 | Ga0075366_10113143 | Ga0075366_101131433 | 237 |
| 357 | 3300006195 | Ga0075366_10124486 | Ga0075366_101244861 | 237 |
| 358 | 3300006237 | Ga0097621_100019677 | Ga0097621_1000196771 | 237 |
| 359 | 3300006237 | Ga0097621_100111731 | Ga0097621_1001117313 | 237 |
| 360 | 3300006237 | Ga0097621_100175542 | Ga0097621_1001755423 | 237 |
| 361 | 3300006358 | Ga0068871_100053211 | Ga0068871_1000532112 | 237 |
| 362 | 3300006358 | Ga0068871_100402919 | Ga0068871_1004029192 | 237 |
| 363 | 3300006844 | Ga0075428_100013757 | Ga0075428_1000137578 | 237 |
| 364 | 3300006844 | Ga0075428_100014688 | Ga0075428_1000146886 | 237 |
| 365 | 3300006847 | Ga0075431_100058710 | Ga0075431_1000587105 | 237 |
| 366 | 3300006880 | Ga0075429_100004785 | Ga0075429_1000047859 | 237 |
| 367 | 3300006880 | Ga0075429_100059697 | Ga0075429_1000596971 | 237 |
| 368 | 3300006881 | Ga0068865_100143641 | Ga0068865_1001436411 | 237 |
| 369 | 3300006931 | Ga0097620_100043648 | Ga0097620_1000436484 | 237 |
| 370 | 3300006931 | Ga0097620_100055565 | Ga0097620_1000555652 | 237 |
| 371 | 3300006931 | Ga0097620_100076849 | Ga0097620_1000768495 | 237 |
| 372 | 3300006931 | Ga0097620_100276522 | Ga0097620_1002765221 | 237 |
| 373 | 3300006931 | Ga0097620_100441314 | Ga0097620_1004413142 | 237 |
| 374 | 3300009093 | Ga0105240_10003164 | Ga0105240_1000316415 | 237 |
| 375 | 3300009093 | Ga0105240_10022849 | Ga0105240_100228494 | 237 |
| 376 | 3300009093 | Ga0105240_10037496 | Ga0105240_100374965 | 237 |
| 377 | 3300009093 | Ga0105240_10050750 | Ga0105240_100507505 | 237 |
| 378 | 3300009093 | Ga0105240_10051677 | Ga0105240_100516773 | 237 |
| 379 | 3300009093 | Ga0105240_10072721 | Ga0105240_100727212 | 237 |
| 380 | 3300009093 | Ga0105240_10164462 | Ga0105240_101644622 | 237 |
| 381 | 3300009094 | Ga0111539_10209325 | Ga0111539_102093252 | 237 |
| 382 | 3300009094 | Ga0111539_10417824 | Ga0111539_104178241 | 237 |
| 383 | 3300009094 | Ga0111539_10556141 | Ga0111539_105561411 | 237 |
| 384 | 3300009101 | Ga0105247_10007492 | Ga0105247_100074925 | 237 |
| 385 | 3300009147 | Ga0114129_10001062 | Ga0114129_1000106210 | 237 |
| 386 | 3300009148 | Ga0105243_10248409 | Ga0105243_102484092 | 237 |
| 387 | 3300009174 | Ga0105241_10002036 | Ga0105241_1000203613 | 237 |
| 388 | 3300009174 | Ga0105241_10042016 | Ga0105241_100420162 | 237 |
| 389 | 3300009174 | Ga0105241_10417594 | Ga0105241_104175942 | 237 |
| 390 | 3300009176 | Ga0105242_10005785 | Ga0105242_1000578512 | 237 |
| 391 | 3300009176 | Ga0105242_10058511 | Ga0105242_100585112 | 237 |
| 392 | 3300009177 | Ga0105248_10236734 | Ga0105248_102367341 | 237 |
| 393 | 3300009545 | Ga0105237_10000144 | Ga0105237_1000014423 | 237 |
| 394 | 3300009545 | Ga0105237_10003823 | Ga0105237_1000382315 | 237 |
| 395 | 3300009545 | Ga0105237_10033838 | Ga0105237_100338384 | 237 |
| 396 | 3300009551 | Ga0105238_10005010 | Ga0105238_1000501012 | 237 |
| 397 | 3300009551 | Ga0105238_10256291 | Ga0105238_102562912 | 237 |
| 398 | 3300009553 | Ga0105249_10001056 | Ga0105249_1000105613 | 237 |
| 399 | 3300009553 | Ga0105249_10007493 | Ga0105249_100074934 | 237 |
| 400 | 3300009553 | Ga0105249_10011216 | Ga0105249_100112164 | 237 |
| 401 | 3300009553 | Ga0105249_10053452 | Ga0105249_100534523 | 237 |
| 402 | 3300009553 | Ga0105249_10075154 | Ga0105249_100751542 | 237 |
| 403 | 3300009553 | Ga0105249_10742256 | Ga0105249_107422561 | 237 |
| 404 | 3300010375 | Ga0105239_10000488 | Ga0105239_100004885 | 237 |
| 405 | 3300010375 | Ga0105239_10000925 | Ga0105239_1000092534 | 237 |
| 406 | 3300010375 | Ga0105239_10016597 | Ga0105239_100165975 | 237 |
| 407 | 3300010375 | Ga0105239_10020600 | Ga0105239_100206009 | 237 |
| 408 | 3300010375 | Ga0105239_10090488 | Ga0105239_100904883 | 237 |
| 409 | 3300013100 | Ga0157373_10008679 | Ga0157373_100086799 | 237 |
| 410 | 3300013102 | Ga0157371_10000451 | Ga0157371_1000045122 | 237 |
| 411 | 3300013102 | Ga0157371_10152895 | Ga0157371_101528951 | 237 |
| 412 | 3300013102 | Ga0157371_10230889 | Ga0157371_102308892 | 237 |
| 413 | 3300013102 | Ga0157371_10577840 | Ga0157371_105778401 | 237 |
| 414 | 3300013104 | Ga0157370_10003865 | Ga0157370_100038657 | 237 |
| 415 | 3300013104 | Ga0157370_10006839 | Ga0157370_100068394 | 237 |
| 416 | 3300013104 | Ga0157370_10007606 | Ga0157370_100076066 | 237 |
| 417 | 3300013104 | Ga0157370_10089403 | Ga0157370_100894032 | 237 |
| 418 | 3300013104 | Ga0157370_10175065 | Ga0157370_101750652 | 237 |
| 419 | 3300013104 | Ga0157370_10391791 | Ga0157370_103917912 | 237 |
| 420 | 3300013104 | Ga0157370_10743179 | Ga0157370_107431791 | 237 |
| 421 | 3300013105 | Ga0157369_10037669 | Ga0157369_100376698 | 237 |
| 422 | 3300013105 | Ga0157369_10227713 | Ga0157369_102277132 | 237 |
| 423 | 3300013296 | Ga0157374_10000013 | Ga0157374_10000013323 | 237 |
| 424 | 3300013306 | Ga0163162_10000253 | Ga0163162_1000025312 | 237 |
| 425 | 3300013306 | Ga0163162_11301536 | Ga0163162_113015361 | 237 |
| 426 | 3300013307 | Ga0157372_10000667 | Ga0157372_1000066728 | 237 |
| 427 | 3300013307 | Ga0157372_10071033 | Ga0157372_100710333 | 237 |
| 428 | 3300013307 | Ga0157372_10327274 | Ga0157372_103272742 | 237 |
| 429 | 3300013307 | Ga0157372_10349849 | Ga0157372_103498492 | 237 |
| 430 | 3300013308 | Ga0157375_10088688 | Ga0157375_100886882 | 237 |
| 431 | 3300013308 | Ga0157375_10400674 | Ga0157375_104006742 | 237 |
| 432 | 3300014325 | Ga0163163_10470739 | Ga0163163_104707392 | 237 |
| 433 | 3300014326 | Ga0157380_10004180 | Ga0157380_100041808 | 237 |
| 434 | 3300014326 | Ga0157380_10055627 | Ga0157380_100556274 | 237 |
| 435 | 3300014326 | Ga0157380_10099713 | Ga0157380_100997133 | 237 |
| 436 | 3300014326 | Ga0157380_10101875 | Ga0157380_101018753 | 237 |
| 437 | 3300014326 | Ga0157380_10281935 | Ga0157380_102819352 | 237 |
| 438 | 3300014326 | Ga0157380_10431861 | Ga0157380_104318612 | 237 |
| 439 | 3300014745 | Ga0157377_10017312 | Ga0157377_100173123 | 237 |
| 440 | 3300014745 | Ga0157377_10017363 | Ga0157377_100173635 | 237 |
| 441 | 3300014968 | Ga0157379_10380303 | Ga0157379_103803032 | 237 |
| 442 | 3300014969 | Ga0157376_10152746 | Ga0157376_101527462 | 237 |
| 443 | 3300014969 | Ga0157376_10153384 | Ga0157376_101533842 | 237 |
| 444 | 3300014969 | Ga0157376_10230195 | Ga0157376_102301952 | 237 |
| 445 | 3300017792 | Ga0163161_10040483 | Ga0163161_100404833 | 237 |
| 446 | 3300017792 | Ga0163161_10068270 | Ga0163161_100682701 | 237 |
| 447 | 3300017792 | Ga0163161_10157142 | Ga0163161_101571421 | 237 |
| 448 | 3300017792 | Ga0163161_10288960 | Ga0163161_102889602 | 237 |
| 449 | 3300025315 | Ga0207697_10013942 | Ga0207697_100139422 | 237 |
| 450 | 3300025321 | Ga0207656_10085275 | Ga0207656_100852751 | 237 |
| 451 | 3300025893 | Ga0207682_10161128 | Ga0207682_101611281 | 237 |
| 452 | 3300025900 | Ga0207710_10002364 | Ga0207710_100023647 | 237 |
| 453 | 3300025903 | Ga0207680_10020915 | Ga0207680_100209153 | 237 |
| 454 | 3300025903 | Ga0207680_10324646 | Ga0207680_103246461 | 237 |
| 455 | 3300025904 | Ga0207647_10064086 | Ga0207647_100640862 | 237 |
| 456 | 3300025907 | Ga0207645_10121810 | Ga0207645_101218102 | 237 |
| 457 | 3300025908 | Ga0207643_10012716 | Ga0207643_100127162 | 237 |
| 458 | 3300025908 | Ga0207643_10091760 | Ga0207643_100917602 | 237 |
| 459 | 3300025911 | Ga0207654_10002079 | Ga0207654_1000207911 | 237 |
| 460 | 3300025911 | Ga0207654_10055609 | Ga0207654_100556092 | 237 |
| 461 | 3300025913 | Ga0207695_10000056 | Ga0207695_10000056315 | 237 |
| 462 | 3300025913 | Ga0207695_10001122 | Ga0207695_1000112234 | 237 |
| 463 | 3300025913 | Ga0207695_10010840 | Ga0207695_100108409 | 237 |
| 464 | 3300025913 | Ga0207695_10027732 | Ga0207695_100277325 | 237 |
| 465 | 3300025913 | Ga0207695_10028609 | Ga0207695_100286095 | 237 |
| 466 | 3300025913 | Ga0207695_10063527 | Ga0207695_100635272 | 237 |
| 467 | 3300025914 | Ga0207671_10001502 | Ga0207671_1000150218 | 237 |
| 468 | 3300025914 | Ga0207671_10001511 | Ga0207671_1000151128 | 237 |
| 469 | 3300025917 | Ga0207660_10072945 | Ga0207660_100729452 | 237 |
| 470 | 3300025918 | Ga0207662_10014896 | Ga0207662_100148962 | 237 |
| 471 | 3300025919 | Ga0207657_10005517 | Ga0207657_100055174 | 237 |
| 472 | 3300025919 | Ga0207657_10046739 | Ga0207657_100467393 | 237 |
| 473 | 3300025919 | Ga0207657_10115053 | Ga0207657_101150533 | 237 |
| 474 | 3300025921 | Ga0207652_10009486 | Ga0207652_100094867 | 237 |
| 475 | 3300025921 | Ga0207652_10405891 | Ga0207652_104058911 | 237 |
| 476 | 3300025922 | Ga0207646_10212194 | Ga0207646_102121943 | 237 |
| 477 | 3300025922 | Ga0207646_10473547 | Ga0207646_104735472 | 237 |
| 478 | 3300025923 | Ga0207681_10057701 | Ga0207681_100577012 | 237 |
| 479 | 3300025923 | Ga0207681_10564845 | Ga0207681_105648451 | 237 |
| 480 | 3300025924 | Ga0207694_10106310 | Ga0207694_101063102 | 237 |
| 481 | 3300025925 | Ga0207650_10012500 | Ga0207650_100125002 | 237 |
| 482 | 3300025925 | Ga0207650_10103533 | Ga0207650_101035332 | 237 |
| 483 | 3300025925 | Ga0207650_10170423 | Ga0207650_101704232 | 237 |
| 484 | 3300025926 | Ga0207659_10004571 | Ga0207659_100045718 | 237 |
| 485 | 3300025926 | Ga0207659_10012861 | Ga0207659_100128614 | 237 |
| 486 | 3300025926 | Ga0207659_10477265 | Ga0207659_104772651 | 237 |
| 487 | 3300025931 | Ga0207644_10123395 | Ga0207644_101233952 | 237 |
| 488 | 3300025932 | Ga0207690_10317204 | Ga0207690_103172042 | 237 |
| 489 | 3300025933 | Ga0207706_10067636 | Ga0207706_100676363 | 237 |
| 490 | 3300025933 | Ga0207706_10228136 | Ga0207706_102281362 | 237 |
| 491 | 3300025934 | Ga0207686_10000351 | Ga0207686_1000035124 | 237 |
| 492 | 3300025934 | Ga0207686_10169185 | Ga0207686_101691852 | 237 |
| 493 | 3300025936 | Ga0207670_10048806 | Ga0207670_100488061 | 237 |
| 494 | 3300025936 | Ga0207670_10432955 | Ga0207670_104329552 | 237 |
| 495 | 3300025936 | Ga0207670_10523278 | Ga0207670_105232782 | 237 |
| 496 | 3300025937 | Ga0207669_10817614 | Ga0207669_108176141 | 237 |
| 497 | 3300025938 | Ga0207704_10126127 | Ga0207704_101261272 | 237 |
| 498 | 3300025938 | Ga0207704_10134502 | Ga0207704_101345022 | 237 |
| 499 | 3300025940 | Ga0207691_10075209 | Ga0207691_100752092 | 237 |
| 500 | 3300025940 | Ga0207691_10081826 | Ga0207691_100818262 | 237 |
| 501 | 3300025940 | Ga0207691_10320367 | Ga0207691_103203672 | 237 |
| 502 | 3300025941 | Ga0207711_10078140 | Ga0207711_100781402 | 237 |
| 503 | 3300025942 | Ga0207689_10104175 | Ga0207689_101041752 | 237 |
| 504 | 3300025944 | Ga0207661_10803567 | Ga0207661_108035671 | 237 |
| 505 | 3300025949 | Ga0207667_10007821 | Ga0207667_1000782112 | 237 |
| 506 | 3300025949 | Ga0207667_10075292 | Ga0207667_100752922 | 237 |
| 507 | 3300025949 | Ga0207667_10134911 | Ga0207667_101349113 | 237 |
| 508 | 3300025949 | Ga0207667_10150742 | Ga0207667_101507422 | 237 |
| 509 | 3300025949 | Ga0207667_10155683 | Ga0207667_101556833 | 237 |
| 510 | 3300025960 | Ga0207651_10109139 | Ga0207651_101091392 | 237 |
| 511 | 3300025960 | Ga0207651_10147807 | Ga0207651_101478072 | 237 |
| 512 | 3300025960 | Ga0207651_10232759 | Ga0207651_102327592 | 237 |
| 513 | 3300025960 | Ga0207651_10586049 | Ga0207651_105860491 | 237 |
| 514 | 3300025961 | Ga0207712_10001599 | Ga0207712_100015993 | 237 |
| 515 | 3300025961 | Ga0207712_10003428 | Ga0207712_100034288 | 237 |
| 516 | 3300025961 | Ga0207712_10014496 | Ga0207712_100144962 | 237 |
| 517 | 3300025961 | Ga0207712_10031442 | Ga0207712_100314423 | 237 |
| 518 | 3300025961 | Ga0207712_10319151 | Ga0207712_103191512 | 237 |
| 519 | 3300025972 | Ga0207668_10333519 | Ga0207668_103335192 | 237 |
| 520 | 3300025986 | Ga0207658_10042638 | Ga0207658_100426382 | 237 |
| 521 | 3300026023 | Ga0207677_10153583 | Ga0207677_101535831 | 237 |
| 522 | 3300026023 | Ga0207677_10229345 | Ga0207677_102293452 | 237 |
| 523 | 3300026041 | Ga0207639_10012512 | Ga0207639_100125125 | 237 |
| 524 | 3300026041 | Ga0207639_10054200 | Ga0207639_100542002 | 237 |
| 525 | 3300026041 | Ga0207639_10085015 | Ga0207639_100850153 | 237 |
| 526 | 3300026041 | Ga0207639_10160505 | Ga0207639_101605052 | 237 |
| 527 | 3300026041 | Ga0207639_10413219 | Ga0207639_104132192 | 237 |
| 528 | 3300026075 | Ga0207708_10120038 | Ga0207708_101200382 | 237 |
| 529 | 3300026075 | Ga0207708_10348786 | Ga0207708_103487862 | 237 |
| 530 | 3300026078 | Ga0207702_10230502 | Ga0207702_102305022 | 237 |
| 531 | 3300026088 | Ga0207641_10043574 | Ga0207641_100435742 | 237 |
| 532 | 3300026089 | Ga0207648_10022185 | Ga0207648_100221854 | 237 |
| 533 | 3300026089 | Ga0207648_10118817 | Ga0207648_101188172 | 237 |
| 534 | 3300026089 | Ga0207648_10185389 | Ga0207648_101853892 | 237 |
| 535 | 3300026095 | Ga0207676_10014686 | Ga0207676_100146865 | 237 |
| 536 | 3300026095 | Ga0207676_10045785 | Ga0207676_100457853 | 237 |
| 537 | 3300026095 | Ga0207676_10238300 | Ga0207676_102383003 | 237 |
| 538 | 3300026116 | Ga0207674_10008410 | Ga0207674_100084104 | 237 |
| 539 | 3300026116 | Ga0207674_10008703 | Ga0207674_100087035 | 237 |
| 540 | 3300026116 | Ga0207674_10101275 | Ga0207674_101012753 | 237 |
| 541 | 3300026116 | Ga0207674_10787100 | Ga0207674_107871001 | 237 |
| 542 | 3300026118 | Ga0207675_100000153 | Ga0207675_10000015321 | 237 |
| 543 | 3300026118 | Ga0207675_100027008 | Ga0207675_1000270083 | 237 |
| 544 | 3300026118 | Ga0207675_100140758 | Ga0207675_1001407583 | 237 |
| 545 | 3300026121 | Ga0207683_10011891 | Ga0207683_100118912 | 237 |
| 546 | 3300026142 | Ga0207698_10055959 | Ga0207698_100559592 | 237 |
| 547 | 3300026142 | Ga0207698_10063132 | Ga0207698_100631322 | 237 |
| 548 | 3300026142 | Ga0207698_10172973 | Ga0207698_101729732 | 237 |
| 549 | 3300026142 | Ga0207698_10391926 | Ga0207698_103919262 | 237 |
| 550 | 3300027907 | Ga0207428_10033842 | Ga0207428_100338421 | 237 |
| 551 | 3300028380 | Ga0268265_10006773 | Ga0268265_100067732 | 237 |
| 552 | 3300028380 | Ga0268265_10082385 | Ga0268265_100823852 | 237 |
| 553 | 3300028380 | Ga0268265_10195834 | Ga0268265_101958342 | 237 |
| 554 | 3300028786 | Ga0307517_10219728 | Ga0307517_102197282 | 237 |
| 555 | 3300030521 | Ga0307511_10000181 | Ga0307511_1000018151 | 237 |
| 556 | 3300031456 | Ga0307513_10348214 | Ga0307513_103482142 | 237 |
| 557 | 3300031507 | Ga0307509_10013918 | Ga0307509_100139186 | 237 |
| 558 | 3300031730 | Ga0307516_10170989 | Ga0307516_101709892 | 237 |
| 559 | 3300031730 | Ga0307516_10202111 | Ga0307516_102021112 | 237 |
| 560 | 3300032004 | Ga0307414_10050346 | Ga0307414_100503462 | 237 |
| 561 | 3300035692 | Ga0373935_0088048 | Ga0373935_0088048_1170_1883 | 237 |
| 562 | 3300038443 | Ga0395901_0002140 | Ga0395901_0002140_5330_6043 | 237 |
| 563 | 3300041404 | Ga0439436_0004748 | Ga0439436_0004748_889_1602 | 237 |
| 564 | 3300041406 | Ga0439439_0001927 | Ga0439439_0001927_1479_2192 | 237 |
| 565 | 3300041406 | Ga0439439_0080627 | Ga0439439_0080627_145_858 | 237 |
| 566 | 3300041413 | Ga0439465_0108527 | Ga0439465_0108527_44_757 | 237 |
| 567 | 3300041451 | Ga0451791_1381310 | Ga0451791_1381310_151_864 | 237 |
| 568 | 3300041459 | Ga0451800_1146729 | Ga0451800_1146729_102_815 | 237 |
| 569 | 3300041459 | Ga0451800_1377849 | Ga0451800_1377849_133_846 | 237 |
| 570 | 3300041486 | Ga0451807_0414922 | Ga0451807_0414922_284_1000 | 237 |
| 571 | 3300041498 | Ga0451841_1354039 | Ga0451841_1354039_89_841 | 237 |
| 572 | 3300041501 | Ga0451845_0011729 | Ga0451845_0011729_282_995 | 237 |
| 573 | 3300041503 | Ga0451847_0209969 | Ga0451847_0209969_33_749 | 237 |
| 574 | 3300041512 | Ga0451853_2563909 | Ga0451853_2563909_211_924 | 237 |
| 575 | 3300042007 | Ga0439449_0015126 | Ga0439449_0015126_1042_1755 | 237 |
| 576 | 3300042014 | Ga0439457_000277 | Ga0439457_000277_9013_9726 | 237 |
| 577 | 3300042876 | Ga0451577_0001932 | Ga0451577_0001932_5614_6336 | 237 |
| 578 | 3300042876 | Ga0451577_0210143 | Ga0451577_0210143_967_1680 | 237 |
| 579 | 3300044656 | Ga0466969_0000190 | Ga0466969_0000190_21043_21756 | 237 |
| 580 | 3300044656 | Ga0466969_0054828 | Ga0466969_0054828_312_1025 | 237 |
| 581 | 3300044658 | Ga0466972_0000337 | Ga0466972_0000337_23144_23857 | 237 |
| 582 | 3300044658 | Ga0466972_0007731 | Ga0466972_0007731_2160_2873 | 237 |
| 583 | 3300044673 | Ga0453683_0083947 | Ga0453683_0083947_795_1508 | 237 |
| 584 | 3300044684 | Ga0466966_0075817 | Ga0466966_0075817_68_781 | 237 |
| 585 | 3300044693 | Ga0466961_0110285 | Ga0466961_0110285_565_1278 | 237 |
| 586 | 3300044693 | Ga0466961_0119342 | Ga0466961_0119342_631_1344 | 237 |
| 587 | 3300044712 | Ga0453684_0318611 | Ga0453684_0318611_910_1632 | 237 |
| 588 | 3300044719 | Ga0466971_0003048 | Ga0466971_0003048_323_1036 | 237 |
| 589 | 3300044719 | Ga0466971_0167919 | Ga0466971_0167919_91_804 | 237 |
| 590 | 3300044765 | Ga0466970_0018946 | Ga0466970_0018946_1223_1936 | 237 |
| 591 | 3300044842 | Ga0466957_0000428 | Ga0466957_0000428_17756_18469 | 237 |
| 592 | 3300044842 | Ga0466957_0001546 | Ga0466957_0001546_6182_6895 | 237 |
| 593 | 3300045049 | Ga0466959_0000003 | Ga0466959_0000003_148911_149624 | 237 |
| 594 | 3300045049 | Ga0466959_0000488 | Ga0466959_0000488_1470_2183 | 237 |
| 595 | 3300045976 | Ga0466967_0269720 | Ga0466967_0269720_239_964 | 237 |
| 596 | 3300045976 | Ga0466967_0527085 | Ga0466967_0527085_196_921 | 237 |
| 597 | 3300046460 | Ga0495638_0120656 | Ga0495638_0120656_628_1341 | 237 |
| 598 | 3300046472 | Ga0495580_0401459 | Ga0495580_0401459_65_778 | 237 |
| 599 | 3300046616 | Ga0495668_0000302 | Ga0495668_0000302_22561_23274 | 237 |
| 600 | 3300046648 | Ga0495611_0000061 | Ga0495611_0000061_47024_47737 | 237 |
| 601 | 3300046809 | Ga0495600_0411156 | Ga0495600_0411156_69_782 | 237 |
| 602 | 3300047320 | Ga0495672_0005682 | Ga0495672_0005682_4822_5535 | 237 |
| 603 | 3300047320 | Ga0495672_0018449 | Ga0495672_0018449_669_1382 | 237 |
| 604 | 3300047472 | Ga0495686_0000010 | Ga0495686_0000010_477666_478379 | 237 |
| 605 | 3300047472 | Ga0495686_0012477 | Ga0495686_0012477_1587_2300 | 237 |
| 606 | 3300047472 | Ga0495686_0284601 | Ga0495686_0284601_34_747 | 237 |
| 607 | 3300048913 | Ga0496110_0589746 | Ga0496110_0589746_79_792 | 237 |
| 608 | 3300049568 | Ga0501031_0303091 | Ga0501031_0303091_205_918 | 237 |
| 609 | 3300049569 | Ga0501032_0010324 | Ga0501032_0010324_1610_2323 | 237 |
| 610 | 3300049571 | Ga0501034_0013427 | Ga0501034_0013427_7391_8104 | 237 |
| 611 | 3300049571 | Ga0501034_0043155 | Ga0501034_0043155_869_1618 | 237 |
| 612 | 3300049571 | Ga0501034_0061010 | Ga0501034_0061010_2087_2800 | 237 |
| 613 | 3300049571 | Ga0501034_0459750 | Ga0501034_0459750_436_1149 | 237 |
| 614 | 3300049572 | Ga0501036_0022006 | Ga0501036_0022006_488_1201 | 237 |
| 615 | 3300049573 | Ga0501037_0131682 | Ga0501037_0131682_543_1256 | 237 |
| 616 | 3300049573 | Ga0501037_0348103 | Ga0501037_0348103_63_776 | 237 |
| 617 | 3300049574 | Ga0501038_0015262 | Ga0501038_0015262_1884_2597 | 237 |
| 618 | 3300049574 | Ga0501038_0226201 | Ga0501038_0226201_249_962 | 237 |
| 619 | 3300049575 | Ga0501039_0040701 | Ga0501039_0040701_2860_3573 | 237 |
| 620 | 3300049578 | Ga0501042_0203698 | Ga0501042_0203698_228_941 | 237 |
| 621 | 3300049579 | Ga0501043_0010690 | Ga0501043_0010690_2079_2792 | 237 |
| 622 | 3300049579 | Ga0501043_0117068 | Ga0501043_0117068_838_1551 | 237 |
| 623 | 3300049580 | Ga0501046_0055861 | Ga0501046_0055861_759_1472 | 237 |
| 624 | 3300049581 | Ga0501047_0009030 | Ga0501047_0009030_7697_8410 | 237 |
| 625 | 3300049581 | Ga0501047_0019423 | Ga0501047_0019423_2346_3059 | 237 |
| 626 | 3300049581 | Ga0501047_0156907 | Ga0501047_0156907_727_1440 | 237 |
| 627 | 3300049581 | Ga0501047_0170288 | Ga0501047_0170288_695_1408 | 237 |
| 628 | 3300049582 | Ga0501048_0267987 | Ga0501048_0267987_256_969 | 237 |
| 629 | 3300049586 | Ga0501070_0006613 | Ga0501070_0006613_4304_5017 | 237 |
| 630 | 3300049586 | Ga0501070_0019796 | Ga0501070_0019796_497_1210 | 237 |
| 631 | 3300049589 | Ga0501073_0100011 | Ga0501073_0100011_1102_1815 | 237 |
| 632 | 3300049590 | Ga0501074_0004746 | Ga0501074_0004746_7221_7934 | 237 |
| 633 | 3300049592 | Ga0501076_0528909 | Ga0501076_0528909_165_878 | 237 |
| 634 | 3300049675 | Ga0501243_037238 | Ga0501243_037238_45_758 | 237 |
| 635 | 3300049703 | Ga0501219_000321 | Ga0501219_000321_7510_8223 | 237 |
| 636 | 3300049705 | Ga0501225_0003367 | Ga0501225_0003367_2850_3563 | 237 |
| 637 | 3300049741 | Ga0501079_0042780 | Ga0501079_0042780_796_1509 | 237 |
| 638 | 3300049742 | Ga0501080_0057387 | Ga0501080_0057387_1102_1815 | 237 |
| 639 | 3300049744 | Ga0501083_0041069 | Ga0501083_0041069_367_1080 | 237 |
| 640 | 3300049744 | Ga0501083_0129585 | Ga0501083_0129585_507_1220 | 237 |
| 641 | 3300049822 | Ga0501035_0023355 | Ga0501035_0023355_1086_1835 | 237 |
| 642 | 3300049822 | Ga0501035_0028623 | Ga0501035_0028623_2310_3023 | 237 |
| 643 | 3300049822 | Ga0501035_0038469 | Ga0501035_0038469_1005_1718 | 237 |
| 644 | 3300049822 | Ga0501035_0110505 | Ga0501035_0110505_1634_2347 | 237 |
| 645 | 3300049823 | Ga0501044_0009878 | Ga0501044_0009878_1493_2206 | 237 |
| 646 | 3300049823 | Ga0501044_0081954 | Ga0501044_0081954_1720_2433 | 237 |
| 647 | 3300049823 | Ga0501044_0095326 | Ga0501044_0095326_1141_1854 | 237 |
| 648 | 3300050005 | Ga0501284_00001 | Ga0501284_00001_97107_97820 | 237 |
| 649 | 3300050493 | nmdc:mga0k408_47296_c1 | nmdc:mga0k408_47296_c1_1729_2442 | 237 |
| 650 | 3300050493 | nmdc:mga0k408_54390_c1 | nmdc:mga0k408_54390_c1_676_1389 | 237 |
| 651 | 3300050493 | nmdc:mga0k408_68441_c1 | nmdc:mga0k408_68441_c1_1023_1736 | 237 |
| 652 | 3300050507 | nmdc:mga05p37_482_c1 | nmdc:mga05p37_482_c1_18907_19620 | 237 |
| 653 | 3300050508 | nmdc:mga09592_5311_c1 | nmdc:mga09592_5311_c1_2884_3597 | 237 |
| 654 | 3300050509 | nmdc:mga0qj67_4695_c1 | nmdc:mga0qj67_4695_c1_2631_3344 | 237 |
| 655 | 3300050510 | nmdc:mga06r32_28324_c1 | nmdc:mga06r32_28324_c1_823_1536 | 237 |
| 656 | 3300050510 | nmdc:mga06r32_352998_c1 | nmdc:mga06r32_352998_c1_527_1240 | 237 |
| 657 | 3300050511 | nmdc:mga08y16_295698_c1 | nmdc:mga08y16_295698_c1_401_1114 | 237 |
| 658 | 3300050511 | nmdc:mga08y16_360998_c1 | nmdc:mga08y16_360998_c1_318_1031 | 237 |
| 659 | 3300050511 | nmdc:mga08y16_54079_c1 | nmdc:mga08y16_54079_c1_3410_4123 | 237 |
| 660 | 3300053086 | Ga0500578_0001290 | Ga0500578_0001290_23785_24498 | 237 |
| 661 | 3300053086 | Ga0500578_0129817 | Ga0500578_0129817_498_1211 | 237 |
| 662 | 3300053088 | Ga0500644_0157097 | Ga0500644_0157097_19_732 | 237 |
| 663 | 3300053090 | Ga0500646_0007918 | Ga0500646_0007918_288_1001 | 237 |
| 664 | 3300053092 | Ga0500583_0000019 | Ga0500583_0000019_63324_64037 | 237 |
| 665 | 3300053092 | Ga0500583_0004286 | Ga0500583_0004286_1736_2449 | 237 |
| 666 | 3300053093 | Ga0500651_0181427 | Ga0500651_0181427_332_1045 | 237 |
| 667 | 3300053102 | Ga0500554_040399 | Ga0500554_040399_451_1164 | 237 |
| 668 | 3300053131 | Ga0500652_020551 | Ga0500652_020551_1010_1828 | 237 |
| 669 | 3300053134 | Ga0500658_0045886 | Ga0500658_0045886_756_1469 | 237 |
| 670 | 3300053139 | Ga0500568_0000208 | Ga0500568_0000208_11387_12100 | 237 |
| 671 | 3300053140 | Ga0500573_0138055 | Ga0500573_0138055_17_730 | 237 |
| 672 | 3300053146 | Ga0500588_0125342 | Ga0500588_0125342_41_754 | 237 |
| 673 | 3300053177 | Ga0500636_0156465 | Ga0500636_0156465_472_1185 | 237 |
| 674 | 3300053178 | Ga0500637_0010936 | Ga0500637_0010936_895_1608 | 237 |
| 675 | 3300053727 | Ga0500611_000001 | Ga0500611_000001_168651_169364 | 237 |
| 676 | 3300054114 | Ga0501084_0118061 | Ga0501084_0118061_511_1224 | 237 |
| 677 | 3300061719 | Ga0466962_0001581 | Ga0466962_0001581_1100_1813 | 237 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2bnf-assembly1.cif.gz_A | the structure of e. coli ump kinase in complex with utp | 0.922 | 1 | 237 |
| 2bnf-assembly1.cif.gz_A | the structure of e. coli ump kinase in complex with utp | 0.9183 | 1 | 237 |
| 2bnd-assembly1.cif.gz_A | the structure of e. coli ump kinase in complex with udp | 0.9176 | 1 | 237 |
| 2v4y-assembly1.cif.gz_C | the structure of e. coli ump kinase in complex with its allosteric regulator gtp | 0.9168 | 1 | 237 |
| 2bne-assembly1.cif.gz_A | the structure of e. coli ump kinase in complex with ump | 0.9164 | 1 | 237 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WHK5_22_261_3.40.1160.10 | Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like | 0.9145 | 2 | 237 | 3.40.1160.10 |
| 2jjxC00 | Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like | 0.9088 | 5 | 236 | 3.40.1160.10 |
| af_A0A1D6G3Z5_82_358_3.40.1160.10 | Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like | 0.9055 | 2 | 237 | 3.40.1160.10 |
| 3ek5B00 | Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like | 0.9048 | 1 | 237 | 3.40.1160.10 |
| af_P9WHK5_22_261_3.40.1160.10 | Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like | 0.9034 | 2 | 237 | 3.40.1160.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A520QIF5-F1-model_v4 | UMP kinase (EC 2.7.4.22) (Uridine monophosphate kinase) | 0.9969 | 140 | 237 |
GO:0005524
GO:0006225 GO:0033862 |
| AF-A0A520QIF5-F1-model_v4 | UMP kinase (EC 2.7.4.22) (Uridine monophosphate kinase) | 0.9869 | 140 | 237 |
GO:0005524
GO:0006225 GO:0033862 |
| AF-A0A359HF64-F1-model_v4 | UMP kinase (EC 2.7.4.22) (Uridine monophosphate kinase) | 0.9826 | 146 | 237 |
GO:0005524
GO:0006225 GO:0033862 |
| AF-A0A3N5N269-F1-model_v4 | UMP kinase (EC 2.7.4.22) (Uridine monophosphate kinase) | 0.9789 | 137 | 237 |
GO:0005524
GO:0006225 GO:0033862 |
| AF-Q4BV13-F1-model_v4 | UMP kinase (EC 2.7.4.22) (Uridine monophosphate kinase) | 0.9775 | 146 | 237 |
GO:0005524
GO:0006225 GO:0033862 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar