F474615

General Info

Members Datasets Scaffolds Average Seq Length
677 289 676 237

Family's Representative Sequence

Representative Sequence 3300053131|Ga0500652_020551|Ga0500652_020551_1010_1828
Length 272
Sequence VGNTFYKRCKTLIKNPFFAALKGVSPIKSLNGQSYMLPKYKRILVKLSGESLMGDKSFGMDPSILNQYAHDIKELVELGVQVAIVIGGGNIYRGMNEAETGIERAHGDYMGMLATVINGMAMQAMLEKIGVFTRLQSAIKMEQIAEPYIRRRAIRHVEKGRVVIFGAGTGNPYFTTDTAGSLRAIEIQADVILKGTRVDGIYTADPEKDPTAKKYESITFQECISKNLRVMDMTAFTLCMENNLPIIVFDMNKPGNLRRVACGERVGTLVKG

Samples

Sample ID Description Type Environment
1 2738541278 Niastella sp. CF465 Isolate Unclassified
2 2818991444 Filimonas endophytica 3197 Isolate Unclassified
3 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
4 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
68 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
69 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
92 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
93 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
107 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
108 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
163 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
166 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
167 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
168 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
169 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
170 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
171 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
172 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
173 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
174 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
175 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
176 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
177 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
178 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
179 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
180 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
181 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
182 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
183 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
184 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
185 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
186 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
187 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
188 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
189 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
190 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
191 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
192 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
193 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
194 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
195 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
196 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
197 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
198 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
199 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
200 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
201 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
202 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
203 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
204 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
205 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
206 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
207 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
208 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
209 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
210 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
211 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
212 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
213 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
214 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
215 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
216 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
217 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
218 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
219 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
220 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
221 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
222 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
223 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
224 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
225 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
240 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
241 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
242 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
243 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
244 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
245 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
246 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
247 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
248 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
249 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
250 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
251 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
252 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
253 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
254 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
255 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
256 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
257 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
258 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
261 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
262 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
263 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
264 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
265 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
266 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
267 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
268 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
269 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
270 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
271 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
272 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
273 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
274 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
275 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
276 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
277 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
278 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
279 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
280 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
281 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
282 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
283 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
284 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
285 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
286 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
287 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
288 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
289 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.56
Metatranscriptomes 0
Isolates 0.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.43
Nodule 0
Rhizoplane 0.89
Rhizosphere 90.4
Stem 0
Stem Tuber 0
Unclassified 4.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNXas_1002191 3300000545 Bacteria 1347
2 JGI24751J29686_10000297 3300002459 Bacteria 18753
3 rootH1_10038406 3300003316 Bacteria 5727
4 rootH1_10038406 3300003323 Bacteria 17804
5 rootH2_10007161 3300003320 Bacteria 44535
6 rootL2_10009250 3300003322 Bacteria 1661
7 rootH1_10001569 3300003323 Bacteria 19450
8 rootH1_10010732 3300003316 Bacteria 3448
9 rootH1_10010732 3300003323 Bacteria 14229
10 Ga0065704_10117876 3300005289 Bacteria 1827
11 Ga0065704_10134167 3300005289 Bacteria 1580
12 Ga0065712_10006725 3300005290 Bacteria 2538
13 Ga0065712_10069410 3300005290 Bacteria 7353
14 Ga0065712_10102063 3300005290 Bacteria 1988
15 Ga0065715_10020203 3300005293 Bacteria 2111
16 Ga0065715_10097890 3300005293 Bacteria 3634
17 Ga0065715_10131286 3300005293 Bacteria 2010
18 Ga0065707_10099164 3300005295 Bacteria 3026
19 Ga0065707_10113318 3300005295 Bacteria 2331
20 Ga0065707_10481629 3300005295 Bacteria 773
21 Ga0070658_10032384 3300005327 Bacteria 4202
22 Ga0070658_10032704 3300005327 Bacteria 4182
23 Ga0070658_10060952 3300005327 Bacteria 3073
24 Ga0070658_10242787 3300005327 Bacteria 1527
25 Ga0070683_100024991 3300005329 Bacteria 5358
26 Ga0070690_100029757 3300005330 Bacteria 3390
27 Ga0070690_100079437 3300005330 Bacteria 2145
28 Ga0070690_100235141 3300005330 Bacteria 1290
29 Ga0070670_100021507 3300005331 Bacteria 5549
30 Ga0070670_100028923 3300005331 Bacteria 4770
31 Ga0070670_100091548 3300005331 Bacteria 2615
32 Ga0070670_100146190 3300005331 Bacteria 2045
33 Ga0070670_100184343 3300005331 Bacteria 1812
34 Ga0070670_100301478 3300005331 Bacteria 1402
35 Ga0070677_10174143 3300005333 Bacteria 1020
36 Ga0068869_100022861 3300005334 Bacteria 4312
37 Ga0068869_100037645 3300005334 Bacteria 3441
38 Ga0068869_100053761 3300005334 Bacteria 2929
39 Ga0068869_100057863 3300005334 Bacteria 2832
40 Ga0068869_100060326 3300005334 Bacteria 2780
41 Ga0068869_100105840 3300005334 Bacteria 2134
42 Ga0070666_10000072 3300005335 Bacteria 75356
43 Ga0070666_10052394 3300005335 Bacteria 2750
44 Ga0070666_10081514 3300005335 Bacteria 2212
45 Ga0070666_10327654 3300005335 Bacteria 1093
46 Ga0070680_100068203 3300005336 Bacteria 2919
47 Ga0068868_100008885 3300005338 Bacteria 7202
48 Ga0068868_100118841 3300005338 Bacteria 2155
49 Ga0068868_100677507 3300005338 Bacteria 920
50 Ga0070660_100000353 3300005339 Bacteria 30722
51 Ga0070689_100083237 3300005340 Bacteria 2514
52 Ga0070689_100150368 3300005340 Bacteria 1877
53 Ga0070689_100295372 3300005340 Bacteria 1347
54 Ga0070691_10207953 3300005341 Bacteria 1031
55 Ga0070691_10225792 3300005341 Bacteria 994
56 Ga0070687_100055049 3300005343 Bacteria 2076
57 Ga0070661_100112590 3300005344 Bacteria 2033
58 Ga0070668_100072324 3300005347 Bacteria 2687
59 Ga0070669_100013179 3300005353 Bacteria 5876
60 Ga0070669_100066732 3300005353 Bacteria 2653
61 Ga0070669_100140846 3300005353 Bacteria 1859
62 Ga0070669_100480030 3300005353 Bacteria 1028
63 Ga0070675_100037007 3300005354 Bacteria 3973
64 Ga0070675_100096076 3300005354 Bacteria 2489
65 Ga0070675_100240237 3300005354 Bacteria 1583
66 Ga0070675_100515595 3300005354 Bacteria 1078
67 Ga0070671_100038078 3300005355 Bacteria 3992
68 Ga0070671_100475351 3300005355 Bacteria 1073
69 Ga0070673_100001930 3300005364 Bacteria 12471
70 Ga0070673_100056888 3300005364 Bacteria 3088
71 Ga0070673_100095119 3300005364 Bacteria 2443
72 Ga0070688_100001768 3300005365 Bacteria 10813
73 Ga0070688_100067168 3300005365 Bacteria 2283
74 Ga0070688_100126961 3300005365 Bacteria 1715
75 Ga0070688_100448606 3300005365 Bacteria 964
76 Ga0070659_100461105 3300005366 Bacteria 1079
77 Ga0070667_100031681 3300005367 Bacteria 4408
78 Ga0070667_100123398 3300005367 Bacteria 2255
79 Ga0070667_100346335 3300005367 Bacteria 1344
80 Ga0070708_100196646 3300005445 Bacteria 1887
81 Ga0070663_100047024 3300005455 Bacteria 3056
82 Ga0070663_100293639 3300005455 Bacteria 1299
83 Ga0070678_100042232 3300005456 Bacteria 3240
84 Ga0070678_100096160 3300005456 Bacteria 2284
85 Ga0070662_100059134 3300005457 Bacteria 2791
86 Ga0070662_100200584 3300005457 Bacteria 1583
87 Ga0070681_10032510 3300005458 Bacteria 5236
88 Ga0068867_100016063 3300005459 Bacteria 5315
89 Ga0068867_100359275 3300005459 Unclassified 1218
90 Ga0070685_10008872 3300005466 Bacteria 5185
91 Ga0070685_10045751 3300005466 Bacteria 2511
92 Ga0070685_10119568 3300005466 Bacteria 1634
93 Ga0070685_10423099 3300005466 Bacteria 927
94 Ga0070706_100106836 3300005467 Bacteria 2604
95 Ga0070707_100028019 3300005468 Bacteria 5358
96 Ga0070707_100068849 3300005468 Bacteria 3407
97 Ga0070707_100493878 3300005468 Bacteria 1186
98 Ga0070698_100089668 3300005471 Bacteria 3058
99 Ga0070699_100035304 3300005518 Bacteria 4322
100 Ga0070679_100328890 3300005530 Bacteria 1477
101 Ga0070684_100123300 3300005535 Bacteria 2332
102 Ga0068853_100005414 3300005539 Bacteria 10003
103 Ga0068853_100021530 3300005539 Bacteria 5377
104 Ga0068853_100027012 3300005539 Bacteria 4823
105 Ga0068853_100116726 3300005539 Bacteria 2377
106 Ga0068853_100221793 3300005539 Bacteria 1727
107 Ga0068853_100940301 3300005539 Bacteria 831
108 Ga0070672_100034513 3300005543 Bacteria 3839
109 Ga0070672_100104380 3300005543 Bacteria 2303
110 Ga0070672_100125084 3300005543 Bacteria 2108
111 Ga0070672_100178205 3300005543 Bacteria 1770
112 Ga0070672_100426605 3300005543 Bacteria 1139
113 Ga0070686_100155613 3300005544 Bacteria 1605
114 Ga0070704_100261834 3300005549 Bacteria 1425
115 Ga0068855_100001281 3300005563 Bacteria 31161
116 Ga0068855_100001364 3300005563 Bacteria 30276
117 Ga0068855_100005605 3300005563 Bacteria 15317
118 Ga0068855_100061780 3300005563 Bacteria 4376
119 Ga0068855_100170031 3300005563 Bacteria 2469
120 Ga0068855_100224735 3300005563 Bacteria 2104
121 Ga0070664_100025450 3300005564 Bacteria 4905
122 Ga0068857_100040989 3300005577 Bacteria 4105
123 Ga0068857_100475945 3300005577 Bacteria 1170
124 Ga0068857_100504050 3300005577 Bacteria 1136
125 Ga0068856_100025243 3300005614 Bacteria 5790
126 Ga0068852_100011225 3300005616 Bacteria 6733
127 Ga0068852_100223678 3300005616 Bacteria 1791
128 Ga0068852_100463858 3300005616 Bacteria 1256
129 Ga0068859_100000006 3300005617 Bacteria 421509
130 Ga0068859_100043650 3300005617 Bacteria 4506
131 Ga0068859_100055565 3300005617 Bacteria 3984
132 Ga0068859_100076850 3300005617 Bacteria 3379
133 Ga0068859_100090079 3300005617 Bacteria 3118
134 Ga0068859_100276535 3300005617 Bacteria 1772
135 Ga0068859_100441309 3300005617 Bacteria 1398
136 Ga0068859_100470606 3300005617 Bacteria 1352
137 Ga0068864_100000469 3300005618 Bacteria 34957
138 Ga0068864_100013747 3300005618 Bacteria 6714
139 Ga0068864_100026382 3300005618 Bacteria 4901
140 Ga0068864_100038927 3300005618 Bacteria 4063
141 Ga0068864_100075767 3300005618 Bacteria 2938
142 Ga0068864_100160788 3300005618 Bacteria 2041
143 Ga0068864_100186352 3300005618 Bacteria 1900
144 Ga0068861_100004575 3300005719 Bacteria 9286
145 Ga0068861_100006209 3300005719 Bacteria 8131
146 Ga0068861_100025586 3300005719 Bacteria 4281
147 Ga0068861_100130465 3300005719 Bacteria 2039
148 Ga0068861_100865576 3300005719 Bacteria 853
149 Ga0068851_10065975 3300005834 Bacteria 1864
150 Ga0068851_10101144 3300005834 Bacteria 1530
151 Ga0068851_10401648 3300005834 Bacteria 806
152 Ga0068870_10137798 3300005840 Bacteria 1425
153 Ga0068863_100002075 3300005841 Bacteria 19871
154 Ga0068863_100428969 3300005841 Bacteria 1296
155 Ga0068858_100000978 3300005842 Bacteria 29516
156 Ga0068858_100227240 3300005842 Bacteria 1769
157 Ga0068858_100659088 3300005842 Bacteria 1017
158 Ga0068858_100838392 3300005842 Bacteria 898
159 Ga0068860_100001713 3300005843 Bacteria 23427
160 Ga0068860_100060453 3300005843 Bacteria 3601
161 Ga0068860_100082085 3300005843 Bacteria 3066
162 Ga0068860_100211746 3300005843 Bacteria 1880
163 Ga0068862_100012568 3300005844 Bacteria 7011
164 Ga0068862_100020995 3300005844 Bacteria 5457
165 Ga0081540_1017706 3300005983 Bacteria 4399
166 Ga0070716_100101830 3300006173 Bacteria 1762
167 Ga0075366_10024460 3300006195 Bacteria 3523
168 Ga0075366_10113143 3300006195 Bacteria 1634
169 Ga0075366_10124486 3300006195 Bacteria 1554
170 Ga0097621_100019677 3300006237 Bacteria 5187
171 Ga0097621_100025089 3300006237 Bacteria 4661
172 Ga0097621_100111731 3300006237 Bacteria 2310
173 Ga0097621_100175542 3300006237 Bacteria 1849
174 Ga0097621_100211165 3300006237 Bacteria 1689
175 Ga0097621_100490485 3300006237 Bacteria 1112
176 Ga0097621_100992207 3300006237 Bacteria 785
177 Ga0068871_100036138 3300006358 Bacteria 3931
178 Ga0068871_100053211 3300006358 Bacteria 3280
179 Ga0068871_100252807 3300006358 Bacteria 1535
180 Ga0068871_100347101 3300006358 Bacteria 1312
181 Ga0068871_100402919 3300006358 Bacteria 1219
182 Ga0068871_100828302 3300006358 Bacteria 854
183 Ga0075428_100013757 3300006844 Bacteria 9011
184 Ga0075428_100014688 3300006844 Bacteria 8698
185 Ga0075430_100004920 3300006846 Bacteria 11237
186 Ga0075431_100058710 3300006847 Bacteria 3971
187 Ga0075431_100112689 3300006847 Bacteria 2807
188 Ga0075429_100004785 3300006880 Bacteria 11657
189 Ga0075429_100013242 3300006880 Bacteria 7152
190 Ga0075429_100022401 3300006880 Bacteria 5479
191 Ga0075429_100059697 3300006880 Bacteria 3322
192 Ga0068865_100031052 3300006881 Bacteria 3559
193 Ga0068865_100143641 3300006881 Bacteria 1802
194 Ga0097620_100000006 3300006931 Bacteria 421509
195 Ga0097620_100043648 3300006931 Bacteria 4506
196 Ga0097620_100055565 3300006931 Bacteria 3984
197 Ga0097620_100076849 3300006931 Bacteria 3379
198 Ga0097620_100090075 3300006931 Bacteria 3118
199 Ga0097620_100276522 3300006931 Bacteria 1772
200 Ga0097620_100441314 3300006931 Bacteria 1398
201 Ga0097620_100470639 3300006931 Bacteria 1352
202 Ga0105240_10003164 3300009093 Bacteria 25888
203 Ga0105240_10022849 3300009093 Bacteria 8285
204 Ga0105240_10037496 3300009093 Bacteria 6230
205 Ga0105240_10050750 3300009093 Bacteria 5227
206 Ga0105240_10051677 3300009093 Bacteria 5170
207 Ga0105240_10072721 3300009093 Bacteria 4249
208 Ga0105240_10164462 3300009093 Bacteria 2633
209 Ga0111539_10209325 3300009094 Bacteria 2272
210 Ga0111539_10417824 3300009094 Bacteria 1562
211 Ga0111539_10556141 3300009094 Bacteria 1336
212 Ga0111539_10774045 3300009094 Bacteria 1117
213 Ga0105247_10004725 3300009101 Bacteria 8673
214 Ga0105247_10007492 3300009101 Bacteria 6691
215 Ga0114129_10001062 3300009147 Bacteria 36084
216 Ga0114129_10290216 3300009147 Bacteria 2183
217 Ga0105243_10184436 3300009148 Bacteria 1817
218 Ga0105243_10248409 3300009148 Bacteria 1587
219 Ga0105241_10000324 3300009174 Bacteria 36128
220 Ga0105241_10002036 3300009174 Bacteria 15289
221 Ga0105241_10006293 3300009174 Bacteria 8755
222 Ga0105241_10042016 3300009174 Bacteria 3457
223 Ga0105241_10417594 3300009174 Bacteria 1180
224 Ga0105242_10005785 3300009176 Bacteria 9521
225 Ga0105242_10028617 3300009176 Bacteria 4438
226 Ga0105242_10058511 3300009176 Bacteria 3160
227 Ga0105242_10238699 3300009176 Bacteria 1633
228 Ga0105248_10236734 3300009177 Bacteria 2055
229 Ga0105248_10445460 3300009177 Bacteria 1459
230 Ga0105237_10000144 3300009545 Bacteria 100105
231 Ga0105237_10003823 3300009545 Bacteria 17699
232 Ga0105237_10006111 3300009545 Bacteria 13458
233 Ga0105237_10033838 3300009545 Bacteria 5178
234 Ga0105237_10346767 3300009545 Bacteria 1489
235 Ga0105238_10005010 3300009551 Bacteria 13090
236 Ga0105238_10256291 3300009551 Bacteria 1728
237 Ga0105238_10259217 3300009551 Bacteria 1718
238 Ga0105249_10001056 3300009553 Bacteria 24413
239 Ga0105249_10002054 3300009553 Bacteria 17468
240 Ga0105249_10007493 3300009553 Bacteria 9521
241 Ga0105249_10011216 3300009553 Bacteria 7870
242 Ga0105249_10053452 3300009553 Bacteria 3692
243 Ga0105249_10075154 3300009553 Bacteria 3129
244 Ga0105249_10742256 3300009553 Bacteria 1043
245 Ga0105239_10000488 3300010375 Bacteria 57554
246 Ga0105239_10000925 3300010375 Bacteria 41596
247 Ga0105239_10010461 3300010375 Bacteria 10371
248 Ga0105239_10011188 3300010375 Bacteria 10015
249 Ga0105239_10016597 3300010375 Bacteria 8140
250 Ga0105239_10020600 3300010375 Bacteria 7276
251 Ga0105239_10090488 3300010375 Bacteria 3376
252 Ga0105246_10091029 3300011119 Bacteria 2198
253 Ga0105246_10363290 3300011119 Bacteria 1190
254 Ga0157373_10008679 3300013100 Bacteria 7542
255 Ga0157371_10000451 3300013102 Bacteria 50405
256 Ga0157371_10001626 3300013102 Bacteria 22988
257 Ga0157371_10152895 3300013102 Bacteria 1646
258 Ga0157371_10230889 3300013102 Bacteria 1330
259 Ga0157371_10577840 3300013102 Bacteria 834
260 Ga0157370_10003865 3300013104 Bacteria 17457
261 Ga0157370_10006839 3300013104 Bacteria 12493
262 Ga0157370_10007606 3300013104 Bacteria 11766
263 Ga0157370_10089403 3300013104 Bacteria 2893
264 Ga0157370_10175065 3300013104 Bacteria 1994
265 Ga0157370_10391791 3300013104 Bacteria 1279
266 Ga0157370_10743179 3300013104 Bacteria 894
267 Ga0157369_10007223 3300013105 Bacteria 12797
268 Ga0157369_10037669 3300013105 Bacteria 5293
269 Ga0157369_10227713 3300013105 Bacteria 1950
270 Ga0157374_10000013 3300013296 Bacteria 461240
271 Ga0157374_10024890 3300013296 Bacteria 5370
272 Ga0157374_10107475 3300013296 Bacteria 2681
273 Ga0157374_10398592 3300013296 Bacteria 1373
274 Ga0157378_10048214 3300013297 Bacteria 3787
275 Ga0157378_10091377 3300013297 Bacteria 2767
276 Ga0157378_10171743 3300013297 Bacteria 2033
277 Ga0157378_10268289 3300013297 Bacteria 1640
278 Ga0163162_10000112 3300013306 Bacteria 72032
279 Ga0163162_10000253 3300013306 Bacteria 48450
280 Ga0163162_10002447 3300013306 Bacteria 17518
281 Ga0163162_11301536 3300013306 Bacteria 826
282 Ga0157372_10000667 3300013307 Bacteria 37793
283 Ga0157372_10071033 3300013307 Bacteria 3919
284 Ga0157372_10327274 3300013307 Bacteria 1784
285 Ga0157372_10349849 3300013307 Bacteria 1721
286 Ga0157375_10088688 3300013308 Bacteria 3148
287 Ga0157375_10154229 3300013308 Bacteria 2434
288 Ga0157375_10209843 3300013308 Bacteria 2105
289 Ga0157375_10361412 3300013308 Bacteria 1618
290 Ga0157375_10400674 3300013308 Bacteria 1539
291 Ga0163163_10470739 3300014325 Bacteria 1317
292 Ga0157380_10004180 3300014326 Bacteria 9977
293 Ga0157380_10055627 3300014326 Bacteria 3144
294 Ga0157380_10099713 3300014326 Bacteria 2416
295 Ga0157380_10101875 3300014326 Bacteria 2393
296 Ga0157380_10281935 3300014326 Bacteria 1521
297 Ga0157380_10431861 3300014326 Bacteria 1259
298 Ga0157377_10017312 3300014745 Bacteria 3725
299 Ga0157377_10017363 3300014745 Bacteria 3720
300 Ga0157377_10504318 3300014745 Bacteria 846
301 Ga0157379_10005275 3300014968 Bacteria 11097
302 Ga0157379_10029944 3300014968 Bacteria 4841
303 Ga0157379_10380303 3300014968 Bacteria 1295
304 Ga0157376_10001570 3300014969 Bacteria 15087
305 Ga0157376_10070136 3300014969 Bacteria 2974
306 Ga0157376_10152746 3300014969 Bacteria 2084
307 Ga0157376_10153384 3300014969 Bacteria 2080
308 Ga0157376_10230195 3300014969 Bacteria 1721
309 Ga0163161_10040483 3300017792 Bacteria 3347
310 Ga0163161_10068270 3300017792 Bacteria 2597
311 Ga0163161_10075295 3300017792 Bacteria 2476
312 Ga0163161_10157142 3300017792 Bacteria 1732
313 Ga0163161_10237323 3300017792 Bacteria 1417
314 Ga0163161_10288960 3300017792 Bacteria 1288
315 Ga0163161_10719308 3300017792 Bacteria 833
316 Ga0213876_10016061 3300021384 Bacteria 3960
317 Ga0207426_1000059 3300025302 Bacteria 363842
318 Ga0207697_10013942 3300025315 Bacteria 3346
319 Ga0207656_10085275 3300025321 Bacteria 1426
320 Ga0207682_10161128 3300025893 Bacteria 1016
321 Ga0207642_10054219 3300025899 Bacteria 1828
322 Ga0207710_10002364 3300025900 Bacteria 8816
323 Ga0207680_10020915 3300025903 Bacteria 3533
324 Ga0207680_10324646 3300025903 Bacteria 1077
325 Ga0207647_10064086 3300025904 Bacteria 2234
326 Ga0207647_10108484 3300025904 Bacteria 1642
327 Ga0207685_10114091 3300025905 Bacteria 1176
328 Ga0207645_10020710 3300025907 Bacteria 4300
329 Ga0207645_10027483 3300025907 Bacteria 3673
330 Ga0207645_10121810 3300025907 Bacteria 1693
331 Ga0207643_10012716 3300025908 Bacteria 4549
332 Ga0207643_10091760 3300025908 Bacteria 1772
333 Ga0207705_10216977 3300025909 Bacteria 1452
334 Ga0207654_10002079 3300025911 Bacteria 10262
335 Ga0207654_10009816 3300025911 Bacteria 4867
336 Ga0207654_10055609 3300025911 Bacteria 2292
337 Ga0207695_10000056 3300025913 Bacteria 382433
338 Ga0207695_10001122 3300025913 Bacteria 46534
339 Ga0207695_10010840 3300025913 Bacteria 11105
340 Ga0207695_10027732 3300025913 Bacteria 6301
341 Ga0207695_10028609 3300025913 Bacteria 6173
342 Ga0207695_10063527 3300025913 Bacteria 3806
343 Ga0207671_10000453 3300025914 Bacteria 56447
344 Ga0207671_10001502 3300025914 Bacteria 26900
345 Ga0207671_10001511 3300025914 Bacteria 26769
346 Ga0207671_10085996 3300025914 Bacteria 2363
347 Ga0207660_10072945 3300025917 Bacteria 2502
348 Ga0207662_10014896 3300025918 Bacteria 4368
349 Ga0207662_10060356 3300025918 Bacteria 2274
350 Ga0207657_10005517 3300025919 Bacteria 13209
351 Ga0207657_10046739 3300025919 Bacteria 3790
352 Ga0207657_10115053 3300025919 Bacteria 2217
353 Ga0207649_10179546 3300025920 Bacteria 1481
354 Ga0207649_10208190 3300025920 Bacteria 1386
355 Ga0207652_10009486 3300025921 Bacteria 7824
356 Ga0207652_10405891 3300025921 Bacteria 1229
357 Ga0207646_10012637 3300025922 Bacteria 8105
358 Ga0207646_10212194 3300025922 Bacteria 1748
359 Ga0207646_10473547 3300025922 Bacteria 1129
360 Ga0207681_10057701 3300025923 Bacteria 2654
361 Ga0207681_10564845 3300025923 Bacteria 937
362 Ga0207694_10106310 3300025924 Bacteria 2229
363 Ga0207650_10012500 3300025925 Bacteria 5861
364 Ga0207650_10047529 3300025925 Bacteria 3162
365 Ga0207650_10103533 3300025925 Bacteria 2195
366 Ga0207650_10170423 3300025925 Bacteria 1730
367 Ga0207659_10004571 3300025926 Bacteria 8368
368 Ga0207659_10012861 3300025926 Bacteria 5344
369 Ga0207659_10477265 3300025926 Bacteria 1053
370 Ga0207644_10123395 3300025931 Bacteria 1975
371 Ga0207644_10354278 3300025931 Bacteria 1192
372 Ga0207690_10317204 3300025932 Bacteria 1224
373 Ga0207706_10067636 3300025933 Bacteria 3143
374 Ga0207706_10228136 3300025933 Bacteria 1630
375 Ga0207686_10000351 3300025934 Bacteria 32797
376 Ga0207686_10169185 3300025934 Bacteria 1539
377 Ga0207709_10169214 3300025935 Bacteria 1532
378 Ga0207670_10048806 3300025936 Bacteria 2827
379 Ga0207670_10062784 3300025936 Bacteria 2540
380 Ga0207670_10432955 3300025936 Bacteria 1057
381 Ga0207670_10523278 3300025936 Bacteria 966
382 Ga0207669_10817614 3300025937 Bacteria 774
383 Ga0207704_10126127 3300025938 Bacteria 1763
384 Ga0207704_10134502 3300025938 Bacteria 1718
385 Ga0207691_10055953 3300025940 Bacteria 3595
386 Ga0207691_10075209 3300025940 Bacteria 3045
387 Ga0207691_10081826 3300025940 Bacteria 2901
388 Ga0207691_10145305 3300025940 Bacteria 2088
389 Ga0207691_10300203 3300025940 Bacteria 1380
390 Ga0207691_10320367 3300025940 Bacteria 1329
391 Ga0207711_10078140 3300025941 Bacteria 2886
392 Ga0207689_10001492 3300025942 Bacteria 22339
393 Ga0207689_10086393 3300025942 Bacteria 2578
394 Ga0207689_10104175 3300025942 Bacteria 2331
395 Ga0207661_10803567 3300025944 Bacteria 866
396 Ga0207679_10029827 3300025945 Bacteria 3802
397 Ga0207667_10007821 3300025949 Bacteria 12775
398 Ga0207667_10075292 3300025949 Bacteria 3505
399 Ga0207667_10134911 3300025949 Bacteria 2542
400 Ga0207667_10150742 3300025949 Bacteria 2393
401 Ga0207667_10155683 3300025949 Bacteria 2352
402 Ga0207651_10109139 3300025960 Bacteria 2072
403 Ga0207651_10147807 3300025960 Bacteria 1825
404 Ga0207651_10168833 3300025960 Bacteria 1723
405 Ga0207651_10232759 3300025960 Bacteria 1497
406 Ga0207651_10586049 3300025960 Bacteria 973
407 Ga0207712_10001599 3300025961 Bacteria 15251
408 Ga0207712_10003428 3300025961 Bacteria 10019
409 Ga0207712_10005438 3300025961 Bacteria 8039
410 Ga0207712_10014496 3300025961 Bacteria 5074
411 Ga0207712_10031442 3300025961 Bacteria 3576
412 Ga0207712_10319151 3300025961 Bacteria 1281
413 Ga0207668_10333519 3300025972 Bacteria 1263
414 Ga0207668_10435833 3300025972 Bacteria 1115
415 Ga0207658_10010564 3300025986 Bacteria 6273
416 Ga0207658_10032675 3300025986 Bacteria 3706
417 Ga0207658_10042638 3300025986 Bacteria 3293
418 Ga0207677_10045716 3300026023 Bacteria 2925
419 Ga0207677_10153583 3300026023 Bacteria 1779
420 Ga0207677_10229345 3300026023 Bacteria 1495
421 Ga0207703_10002804 3300026035 Bacteria 14887
422 Ga0207639_10012512 3300026041 Bacteria 5911
423 Ga0207639_10054200 3300026041 Bacteria 3064
424 Ga0207639_10085015 3300026041 Bacteria 2515
425 Ga0207639_10088393 3300026041 Bacteria 2472
426 Ga0207639_10142613 3300026041 Bacteria 1998
427 Ga0207639_10160505 3300026041 Bacteria 1894
428 Ga0207639_10413219 3300026041 Bacteria 1218
429 Ga0207708_10120038 3300026075 Bacteria 2048
430 Ga0207708_10348786 3300026075 Bacteria 1214
431 Ga0207702_10230502 3300026078 Bacteria 1731
432 Ga0207641_10000058 3300026088 Bacteria 166385
433 Ga0207641_10043574 3300026088 Bacteria 3769
434 Ga0207641_10166367 3300026088 Bacteria 2009
435 Ga0207648_10022185 3300026089 Bacteria 5703
436 Ga0207648_10102681 3300026089 Bacteria 2506
437 Ga0207648_10118817 3300026089 Bacteria 2323
438 Ga0207648_10185389 3300026089 Unclassified 1843
439 Ga0207676_10014686 3300026095 Bacteria 5641
440 Ga0207676_10045785 3300026095 Bacteria 3382
441 Ga0207676_10238300 3300026095 Bacteria 1630
442 Ga0207676_10282148 3300026095 Bacteria 1508
443 Ga0207674_10008410 3300026116 Bacteria 11925
444 Ga0207674_10008703 3300026116 Bacteria 11683
445 Ga0207674_10101275 3300026116 Bacteria 2861
446 Ga0207674_10787100 3300026116 Bacteria 918
447 Ga0207675_100000153 3300026118 Bacteria 60593
448 Ga0207675_100003754 3300026118 Bacteria 14797
449 Ga0207675_100027008 3300026118 Bacteria 5344
450 Ga0207675_100100301 3300026118 Bacteria 2727
451 Ga0207675_100140758 3300026118 Bacteria 2292
452 Ga0207683_10011891 3300026121 Bacteria 7428
453 Ga0207683_10037605 3300026121 Bacteria 4215
454 Ga0207683_10245750 3300026121 Bacteria 1632
455 Ga0207683_10390413 3300026121 Bacteria 1280
456 Ga0207698_10007272 3300026142 Bacteria 6937
457 Ga0207698_10055959 3300026142 Bacteria 3043
458 Ga0207698_10063132 3300026142 Bacteria 2897
459 Ga0207698_10172973 3300026142 Bacteria 1904
460 Ga0207698_10391926 3300026142 Bacteria 1325
461 Ga0207428_10033842 3300027907 Bacteria 4192
462 Ga0268265_10006773 3300028380 Bacteria 7752
463 Ga0268265_10082385 3300028380 Bacteria 2544
464 Ga0268265_10144805 3300028380 Bacteria 1995
465 Ga0268265_10195834 3300028380 Bacteria 1749
466 Ga0268264_10000726 3300028381 Bacteria 37807
467 Ga0268264_10063815 3300028381 Bacteria 3098
468 Ga0268264_10490517 3300028381 Bacteria 1196
469 Ga0268264_10597587 3300028381 Bacteria 1087
470 Ga0307517_10219728 3300028786 Bacteria 1157
471 Ga0307515_10000059 3300028794 Bacteria 257520
472 Ga0307515_10192629 3300028794 Bacteria 1943
473 Ga0307511_10000181 3300030521 Bacteria 62420
474 Ga0265327_10000172 3300031251 Bacteria 139400
475 Ga0307513_10030476 3300031456 Bacteria 6128
476 Ga0307513_10348214 3300031456 Bacteria 1230
477 Ga0307513_10377596 3300031456 Bacteria 1158
478 Ga0307509_10013918 3300031507 Bacteria 9490
479 Ga0307509_10093902 3300031507 Bacteria 3060
480 Ga0307509_10151950 3300031507 Bacteria 2229
481 Ga0307408_100285963 3300031548 Bacteria 1375
482 Ga0307508_10000485 3300031616 Bacteria 47975
483 Ga0307508_10057484 3300031616 Bacteria 3442
484 Ga0307516_10170989 3300031730 Bacteria 1914
485 Ga0307516_10202111 3300031730 Bacteria 1706
486 Ga0307405_10054867 3300031731 Bacteria 2490
487 Ga0307405_10184986 3300031731 Bacteria 1499
488 Ga0307413_10048737 3300031824 Bacteria 2534
489 Ga0307412_10524207 3300031911 Bacteria 990
490 Ga0307409_100256882 3300031995 Bacteria 1601
491 Ga0307416_100007276 3300032002 Bacteria 7019
492 Ga0307414_10050346 3300032004 Bacteria 2885
493 Ga0373935_0088048 3300035692 Bacteria 2028
494 Ga0395900_0456266 3300037418 Bacteria 1234
495 Ga0395898_0658837 3300037466 Bacteria 989
496 Ga0395905_0000002 3300037471 Bacteria 1356358
497 Ga0436364_1006406 3300037853 Bacteria 1339
498 Ga0395901_0002140 3300038443 Bacteria 20188
499 Ga0395901_0838566 3300038443 Bacteria 905
500 Ga0436365_1001352 3300039437 Bacteria 8242
501 Ga0439436_0004748 3300041404 Bacteria 4167
502 Ga0439439_0001927 3300041406 Bacteria 4289
503 Ga0439439_0080627 3300041406 Bacteria 880
504 Ga0439465_0108527 3300041413 Bacteria 964
505 Ga0451791_1381310 3300041451 Bacteria 1453
506 Ga0451800_1146729 3300041459 Bacteria 995
507 Ga0451800_1377849 3300041459 Bacteria 1738
508 Ga0451807_0414922 3300041486 Bacteria 1737
509 Ga0451841_1354039 3300041498 Bacteria 877
510 Ga0451845_0011729 3300041501 Bacteria 1045
511 Ga0451847_0209969 3300041503 Bacteria 865
512 Ga0451853_2563909 3300041512 Bacteria 7170
513 Ga0439442_039304 3300042002 Bacteria 992
514 Ga0439449_0015126 3300042007 Bacteria 2899
515 Ga0439457_000277 3300042014 Bacteria 14123
516 Ga0439462_0062632 3300042015 Bacteria 1007
517 Ga0439434_0130367 3300042435 Bacteria 825
518 Ga0451577_0001932 3300042876 Bacteria 26161
519 Ga0451577_0210143 3300042876 Bacteria 1758
520 Ga0466969_0000190 3300044656 Bacteria 33133
521 Ga0466969_0054828 3300044656 Bacteria 1952
522 Ga0466972_0000168 3300044658 Bacteria 51759
523 Ga0466972_0000337 3300044658 Bacteria 25976
524 Ga0466972_0007731 3300044658 Bacteria 5397
525 Ga0453683_0083947 3300044673 Bacteria 1996
526 Ga0466966_0013541 3300044684 Bacteria 5398
527 Ga0466966_0075817 3300044684 Bacteria 2100
528 Ga0466966_0395256 3300044684 Bacteria 831
529 Ga0466961_0064427 3300044693 Bacteria 2329
530 Ga0466961_0110285 3300044693 Bacteria 1731
531 Ga0466961_0119342 3300044693 Bacteria 1656
532 Ga0453684_0318611 3300044712 Bacteria 1762
533 Ga0466971_0003048 3300044719 Bacteria 7120
534 Ga0466971_0167919 3300044719 Bacteria 1029
535 Ga0466970_0018702 3300044765 Bacteria 3590
536 Ga0466970_0018946 3300044765 Bacteria 3566
537 Ga0466957_0000428 3300044842 Bacteria 20729
538 Ga0466957_0001546 3300044842 Bacteria 12103
539 Ga0466959_0000003 3300045049 Bacteria 285164
540 Ga0466959_0000488 3300045049 Bacteria 23122
541 Ga0466959_0067262 3300045049 Bacteria 2598
542 Ga0466967_0269720 3300045976 Bacteria 1631
543 Ga0466967_0527085 3300045976 Bacteria 1161
544 Ga0495638_0120656 3300046460 Bacteria 1550
545 Ga0495580_0401459 3300046472 Bacteria 924
546 Ga0495642_0016639 3300046528 Bacteria 2869
547 Ga0495668_0000302 3300046616 Bacteria 68079
548 Ga0495611_0000061 3300046648 Bacteria 77533
549 Ga0495635_0153703 3300046663 Bacteria 1566
550 Ga0495600_0411156 3300046809 Bacteria 841
551 Ga0495672_0005682 3300047320 Bacteria 9829
552 Ga0495672_0018449 3300047320 Bacteria 4630
553 Ga0495672_0234052 3300047320 Bacteria 900
554 Ga0495686_0000010 3300047472 Bacteria 573229
555 Ga0495686_0012477 3300047472 Bacteria 5941
556 Ga0495686_0284601 3300047472 Bacteria 918
557 Ga0496110_0589746 3300048913 Bacteria 1009
558 Ga0496115_0008884 3300048918 Bacteria 7448
559 Ga0501031_0303091 3300049568 Bacteria 1035
560 Ga0501032_0010324 3300049569 Bacteria 6737
561 Ga0501033_0385959 3300049570 Bacteria 978
562 Ga0501033_0398674 3300049570 Bacteria 960
563 Ga0501034_0000004 3300049571 Bacteria 382255
564 Ga0501034_0013427 3300049571 Bacteria 8430
565 Ga0501034_0043155 3300049571 Bacteria 4565
566 Ga0501034_0061010 3300049571 Bacteria 3788
567 Ga0501034_0148138 3300049571 Bacteria 2323
568 Ga0501034_0459750 3300049571 Bacteria 1190
569 Ga0501036_0022006 3300049572 Bacteria 5361
570 Ga0501036_0568815 3300049572 Bacteria 941
571 Ga0501036_0639647 3300049572 Bacteria 881
572 Ga0501037_0131682 3300049573 Bacteria 1793
573 Ga0501037_0348103 3300049573 Bacteria 1023
574 Ga0501038_0015262 3300049574 Bacteria 6984
575 Ga0501038_0226201 3300049574 Bacteria 1491
576 Ga0501039_0040701 3300049575 Bacteria 3587
577 Ga0501039_0076399 3300049575 Bacteria 2604
578 Ga0501040_0024014 3300049576 Bacteria 4090
579 Ga0501040_0138935 3300049576 Bacteria 1710
580 Ga0501042_0049268 3300049578 Bacteria 3005
581 Ga0501042_0203698 3300049578 Bacteria 1427
582 Ga0501043_0010690 3300049579 Bacteria 7189
583 Ga0501043_0117068 3300049579 Bacteria 2091
584 Ga0501043_0572441 3300049579 Bacteria 837
585 Ga0501046_0005998 3300049580 Bacteria 10807
586 Ga0501046_0055861 3300049580 Bacteria 3100
587 Ga0501046_0214974 3300049580 Bacteria 1426
588 Ga0501047_0009030 3300049581 Bacteria 9412
589 Ga0501047_0019423 3300049581 Bacteria 6520
590 Ga0501047_0156907 3300049581 Bacteria 2149
591 Ga0501047_0170288 3300049581 Bacteria 2047
592 Ga0501048_0267987 3300049582 Bacteria 1213
593 Ga0501067_0278172 3300049583 Bacteria 932
594 Ga0501068_0078592 3300049584 Bacteria 2022
595 Ga0501068_0191671 3300049584 Bacteria 1295
596 Ga0501070_0006613 3300049586 Bacteria 9866
597 Ga0501070_0019796 3300049586 Bacteria 5644
598 Ga0501071_0010198 3300049587 Bacteria 6287
599 Ga0501072_0004554 3300049588 Bacteria 10543
600 Ga0501072_0164130 3300049588 Bacteria 1772
601 Ga0501073_0100011 3300049589 Bacteria 2013
602 Ga0501074_0004746 3300049590 Bacteria 9743
603 Ga0501074_0453491 3300049590 Bacteria 909
604 Ga0501075_0007589 3300049591 Bacteria 7526
605 Ga0501076_0103654 3300049592 Bacteria 2295
606 Ga0501076_0528909 3300049592 Bacteria 972
607 Ga0501077_0009648 3300049593 Bacteria 6000
608 Ga0501077_0083098 3300049593 Bacteria 2029
609 Ga0501206_019297 3300049653 Bacteria 964
610 Ga0501207_000200 3300049654 Bacteria 5921
611 Ga0501243_037238 3300049675 Bacteria 845
612 Ga0501219_000321 3300049703 Bacteria 8334
613 Ga0501225_0003367 3300049705 Bacteria 4855
614 Ga0501079_0005805 3300049741 Bacteria 9227
615 Ga0501079_0042780 3300049741 Bacteria 3497
616 Ga0501079_0177956 3300049741 Bacteria 1659
617 Ga0501080_0033622 3300049742 Bacteria 4786
618 Ga0501080_0057387 3300049742 Bacteria 3624
619 Ga0501081_0006944 3300049743 Bacteria 7357
620 Ga0501083_0041069 3300049744 Bacteria 3138
621 Ga0501083_0074150 3300049744 Bacteria 2261
622 Ga0501083_0129585 3300049744 Bacteria 1653
623 Ga0501035_0023355 3300049822 Bacteria 5672
624 Ga0501035_0028623 3300049822 Bacteria 5086
625 Ga0501035_0038469 3300049822 Bacteria 4331
626 Ga0501035_0110505 3300049822 Bacteria 2409
627 Ga0501044_0009878 3300049823 Bacteria 10371
628 Ga0501044_0081954 3300049823 Bacteria 3265
629 Ga0501044_0095326 3300049823 Bacteria 2999
630 Ga0501045_0574996 3300049824 Bacteria 835
631 Ga0501284_00001 3300050005 Bacteria 261916
632 nmdc:mga0k408_47296_c1 3300050493 Bacteria 2486
633 nmdc:mga0k408_53148_c1 3300050493 Bacteria 2347
634 nmdc:mga0k408_54390_c1 3300050493 Bacteria 2320
635 nmdc:mga0k408_55646_c1 3300050493 Bacteria 2294
636 nmdc:mga0k408_68441_c1 3300050493 Bacteria 2071
637 nmdc:mga07m45_365277_c1 3300050496 Bacteria 838
638 nmdc:mga05p37_235046_c1 3300050507 Bacteria 2206
639 nmdc:mga05p37_482_c1 3300050507 Bacteria 43621
640 nmdc:mga09592_17643_c1 3300050508 Bacteria 5850
641 nmdc:mga09592_5311_c1 3300050508 Bacteria 10470
642 nmdc:mga0qj67_4695_c1 3300050509 Bacteria 9918
643 nmdc:mga0qj67_71409_c1 3300050509 Bacteria 2771
644 nmdc:mga06r32_13475_c1 3300050510 Bacteria 7408
645 nmdc:mga06r32_28324_c1 3300050510 Bacteria 5240
646 nmdc:mga06r32_352998_c1 3300050510 Bacteria 1455
647 nmdc:mga08y16_295698_c1 3300050511 Bacteria 1669
648 nmdc:mga08y16_360998_c1 3300050511 Bacteria 1491
649 nmdc:mga08y16_54079_c1 3300050511 Bacteria 4196
650 nmdc:mga08y16_733552_c1 3300050511 Bacteria 985
651 Ga0500578_0001290 3300053086 Bacteria 25877
652 Ga0500578_0129817 3300053086 Bacteria 1581
653 Ga0500644_0157097 3300053088 Bacteria 916
654 Ga0500646_0007918 3300053090 Bacteria 2716
655 Ga0500583_0000019 3300053092 Bacteria 130534
656 Ga0500583_0004286 3300053092 Bacteria 4628
657 Ga0500651_0181427 3300053093 Bacteria 1250
658 Ga0500554_040399 3300053102 Bacteria 1429
659 Ga0500594_0063049 3300053118 Bacteria 1073
660 Ga0500652_020551 3300053131 Bacteria 2472
661 Ga0500658_0045886 3300053134 Bacteria 1768
662 Ga0500568_0000208 3300053139 Bacteria 51266
663 Ga0500573_0138055 3300053140 Bacteria 1345
664 Ga0500588_0125342 3300053146 Bacteria 910
665 Ga0500588_0163015 3300053146 Bacteria 812
666 Ga0500616_0276094 3300053153 Bacteria 707
667 Ga0500622_0160846 3300053156 Bacteria 1053
668 Ga0500636_0156465 3300053177 Bacteria 1247
669 Ga0500637_0010936 3300053178 Bacteria 4669
670 Ga0500611_000001 3300053727 Bacteria 385744
671 Ga0501084_0041252 3300054114 Bacteria 3861
672 Ga0501084_0108657 3300054114 Bacteria 2330
673 Ga0501084_0118061 3300054114 Bacteria 2230
674 Ga0501082_0005462 3300060353 Bacteria 11037
675 Ga0466962_0001581 3300061719 Bacteria 10654
676 Ga0530510_0079881 3300061734 Bacteria 2379

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049592 Ga0501076_0103654 Ga0501076_0103654_1262_1966 216
2 3300025905 Ga0207685_10114091 Ga0207685_101140912 217
3 3300003323 rootH1_10010732 rootH1_100107322 219
4 3300005293 Ga0065715_10020203 Ga0065715_100202031 219
5 3300005617 Ga0068859_100470606 Ga0068859_1004706062 219
6 3300005834 Ga0068851_10065975 Ga0068851_100659751 219
7 3300006931 Ga0097620_100470639 Ga0097620_1004706392 219
8 3300013102 Ga0157371_10001626 Ga0157371_1000162611 219
9 3300025925 Ga0207650_10047529 Ga0207650_100475292 219
10 3300031251 Ga0265327_10000172 Ga0265327_1000017215 219
11 3300031456 Ga0307513_10377596 Ga0307513_103775962 219
12 3300046528 Ga0495642_0016639 Ga0495642_0016639_841_1500 219
13 3300048918 Ga0496115_0008884 Ga0496115_0008884_1251_1910 219
14 3300050496 nmdc:mga07m45_365277_c1 nmdc:mga07m45_365277_c1_149_817 219
15 3300005334 Ga0068869_100060326 Ga0068869_1000603263 220
16 3300005338 Ga0068868_100677507 Ga0068868_1006775071 220
17 3300005353 Ga0070669_100066732 Ga0070669_1000667322 220
18 3300005539 Ga0068853_100005414 Ga0068853_1000054149 220
19 3300005719 Ga0068861_100006209 Ga0068861_1000062094 220
20 3300006358 Ga0068871_100252807 Ga0068871_1002528072 220
21 3300009174 Ga0105241_10006293 Ga0105241_100062938 220
22 3300010375 Ga0105239_10011188 Ga0105239_1001118810 220
23 3300013105 Ga0157369_10007223 Ga0157369_1000722313 220
24 3300013306 Ga0163162_10002447 Ga0163162_1000244713 220
25 3300013308 Ga0157375_10154229 Ga0157375_101542292 220
26 3300014745 Ga0157377_10504318 Ga0157377_105043182 220
27 3300014968 Ga0157379_10005275 Ga0157379_100052756 220
28 3300014969 Ga0157376_10070136 Ga0157376_100701363 220
29 3300017792 Ga0163161_10075295 Ga0163161_100752953 220
30 3300017792 Ga0163161_10237323 Ga0163161_102373231 220
31 3300025914 Ga0207671_10085996 Ga0207671_100859961 220
32 3300025920 Ga0207649_10179546 Ga0207649_101795462 220
33 3300025936 Ga0207670_10062784 Ga0207670_100627842 220
34 3300025940 Ga0207691_10300203 Ga0207691_103002031 220
35 3300026088 Ga0207641_10166367 Ga0207641_101663672 220
36 3300026089 Ga0207648_10102681 Ga0207648_101026812 220
37 3300026118 Ga0207675_100003754 Ga0207675_1000037543 220
38 3300028381 Ga0268264_10490517 Ga0268264_104905171 220
39 3300031548 Ga0307408_100285963 Ga0307408_1002859632 220
40 3300031731 Ga0307405_10054867 Ga0307405_100548672 220
41 3300031824 Ga0307413_10048737 Ga0307413_100487372 220
42 3300031911 Ga0307412_10524207 Ga0307412_105242071 220
43 3300031995 Ga0307409_100256882 Ga0307409_1002568821 220
44 3300032002 Ga0307416_100007276 Ga0307416_1000072767 220
45 3300037466 Ga0395898_0658837 Ga0395898_0658837_295_957 220
46 3300038443 Ga0395901_0838566 Ga0395901_0838566_24_686 220
47 3300042002 Ga0439442_039304 Ga0439442_039304_312_974 220
48 3300042015 Ga0439462_0062632 Ga0439462_0062632_51_713 220
49 3300042435 Ga0439434_0130367 Ga0439434_0130367_116_778 220
50 3300047320 Ga0495672_0234052 Ga0495672_0234052_31_693 220
51 3300049654 Ga0501207_000200 Ga0501207_000200_2298_2960 220
52 3300050493 nmdc:mga0k408_55646_c1 nmdc:mga0k408_55646_c1_20_682 220
53 3300053146 Ga0500588_0163015 Ga0500588_0163015_48_710 220
54 3300053153 Ga0500616_0276094 Ga0500616_0276094_18_680 220
55 3300005456 Ga0070678_100096160 Ga0070678_1000961602 221
56 3300026121 Ga0207683_10245750 Ga0207683_102457502 221
57 3300031507 Ga0307509_10151950 Ga0307509_101519501 221
58 3300005334 Ga0068869_100057863 Ga0068869_1000578633 225
59 3300009148 Ga0105243_10184436 Ga0105243_101844362 225
60 3300009176 Ga0105242_10028617 Ga0105242_100286174 225
61 3300025899 Ga0207642_10054219 Ga0207642_100542192 225
62 3300025907 Ga0207645_10027483 Ga0207645_100274832 225
63 3300025935 Ga0207709_10169214 Ga0207709_101692142 225
64 3300025942 Ga0207689_10086393 Ga0207689_100863932 225
65 3300026118 Ga0207675_100100301 Ga0207675_1001003012 225
66 3300028380 Ga0268265_10144805 Ga0268265_101448053 225
67 3300028381 Ga0268264_10597587 Ga0268264_105975871 225
68 3300050493 nmdc:mga0k408_53148_c1 nmdc:mga0k408_53148_c1_318_1031 225
69 3300006237 Ga0097621_100211165 Ga0097621_1002111652 226
70 3300026121 Ga0207683_10037605 Ga0207683_100376055 226
71 3300049653 Ga0501206_019297 Ga0501206_019297_22_711 229
72 3300053156 Ga0500622_0160846 Ga0500622_0160846_10_699 229
73 3300046663 Ga0495635_0153703 Ga0495635_0153703_24_737 230
74 iso_pu_bacteria 3003233435 3003235196 230
75 3300005330 Ga0070690_100079437 Ga0070690_1000794372 231
76 3300005334 Ga0068869_100022861 Ga0068869_1000228612 231
77 3300005338 Ga0068868_100118841 Ga0068868_1001188412 231
78 3300005340 Ga0070689_100083237 Ga0070689_1000832373 231
79 3300005344 Ga0070661_100112590 Ga0070661_1001125902 231
80 3300005354 Ga0070675_100096076 Ga0070675_1000960763 231
81 3300005355 Ga0070671_100475351 Ga0070671_1004753511 231
82 3300005366 Ga0070659_100461105 Ga0070659_1004611052 231
83 3300005539 Ga0068853_100940301 Ga0068853_1009403011 231
84 3300005543 Ga0070672_100104380 Ga0070672_1001043802 231
85 3300005564 Ga0070664_100025450 Ga0070664_1000254503 231
86 3300005719 Ga0068861_100865576 Ga0068861_1008655761 231
87 3300005842 Ga0068858_100659088 Ga0068858_1006590881 231
88 3300006237 Ga0097621_100490485 Ga0097621_1004904851 231
89 3300006358 Ga0068871_100347101 Ga0068871_1003471012 231
90 3300009177 Ga0105248_10445460 Ga0105248_104454601 231
91 3300017792 Ga0163161_10719308 Ga0163161_107193081 231
92 3300025907 Ga0207645_10020710 Ga0207645_100207102 231
93 3300025918 Ga0207662_10060356 Ga0207662_100603561 231
94 3300025920 Ga0207649_10208190 Ga0207649_102081901 231
95 3300025931 Ga0207644_10354278 Ga0207644_103542781 231
96 3300025940 Ga0207691_10055953 Ga0207691_100559532 231
97 3300025945 Ga0207679_10029827 Ga0207679_100298272 231
98 iso_pu_bacteria 2818991444 2819585597 232
99 3300006237 Ga0097621_100992207 Ga0097621_1009922071 233
100 iso_pu_bacteria 2738541278 2738725043 233
101 3300006358 Ga0068871_100828302 Ga0068871_1008283021 234
102 3300037471 Ga0395905_0000002 Ga0395905_0000002_1251055_1251762 234
103 3300049572 Ga0501036_0639647 Ga0501036_0639647_131_835 234
104 3300005295 Ga0065707_10481629 Ga0065707_104816291 235
105 3300009147 Ga0114129_10290216 Ga0114129_102902163 235
106 3300037853 Ga0436364_1006406 Ga0436364_1006406_25_744 235
107 3300050507 nmdc:mga05p37_235046_c1 nmdc:mga05p37_235046_c1_1172_1903 235
108 3300005327 Ga0070658_10060952 Ga0070658_100609522 236
109 3300005330 Ga0070690_100235141 Ga0070690_1002351411 236
110 3300005331 Ga0070670_100091548 Ga0070670_1000915482 236
111 3300005331 Ga0070670_100184343 Ga0070670_1001843432 236
112 3300005335 Ga0070666_10000072 Ga0070666_1000007264 236
113 3300005338 Ga0068868_100008885 Ga0068868_1000088856 236
114 3300005347 Ga0070668_100072324 Ga0070668_1000723242 236
115 3300005355 Ga0070671_100038078 Ga0070671_1000380786 236
116 3300005364 Ga0070673_100056888 Ga0070673_1000568884 236
117 3300005367 Ga0070667_100123398 Ga0070667_1001233982 236
118 3300005467 Ga0070706_100106836 Ga0070706_1001068362 236
119 3300005468 Ga0070707_100028019 Ga0070707_1000280194 236
120 3300005539 Ga0068853_100021530 Ga0068853_1000215302 236
121 3300005543 Ga0070672_100034513 Ga0070672_1000345135 236
122 3300005616 Ga0068852_100011225 Ga0068852_10001122510 236
123 3300005617 Ga0068859_100000006 Ga0068859_10000000663 236
124 3300005617 Ga0068859_100090079 Ga0068859_1000900792 236
125 3300005618 Ga0068864_100000469 Ga0068864_10000046926 236
126 3300005618 Ga0068864_100160788 Ga0068864_1001607883 236
127 3300005841 Ga0068863_100002075 Ga0068863_10000207512 236
128 3300005842 Ga0068858_100000978 Ga0068858_10000097820 236
129 3300005843 Ga0068860_100001713 Ga0068860_10000171326 236
130 3300005843 Ga0068860_100082085 Ga0068860_1000820853 236
131 3300006237 Ga0097621_100025089 Ga0097621_1000250898 236
132 3300006358 Ga0068871_100036138 Ga0068871_1000361384 236
133 3300006846 Ga0075430_100004920 Ga0075430_1000049208 236
134 3300006847 Ga0075431_100112689 Ga0075431_1001126893 236
135 3300006880 Ga0075429_100013242 Ga0075429_1000132427 236
136 3300006880 Ga0075429_100022401 Ga0075429_1000224015 236
137 3300006881 Ga0068865_100031052 Ga0068865_1000310521 236
138 3300006931 Ga0097620_100000006 Ga0097620_10000000663 236
139 3300006931 Ga0097620_100090075 Ga0097620_1000900752 236
140 3300009094 Ga0111539_10774045 Ga0111539_107740452 236
141 3300009101 Ga0105247_10004725 Ga0105247_1000472511 236
142 3300009174 Ga0105241_10000324 Ga0105241_1000032411 236
143 3300009176 Ga0105242_10238699 Ga0105242_102386991 236
144 3300009545 Ga0105237_10006111 Ga0105237_1000611113 236
145 3300009545 Ga0105237_10346767 Ga0105237_103467673 236
146 3300009551 Ga0105238_10259217 Ga0105238_102592171 236
147 3300009553 Ga0105249_10002054 Ga0105249_100020547 236
148 3300010375 Ga0105239_10010461 Ga0105239_1001046110 236
149 3300011119 Ga0105246_10091029 Ga0105246_100910291 236
150 3300011119 Ga0105246_10363290 Ga0105246_103632901 236
151 3300013296 Ga0157374_10024890 Ga0157374_100248907 236
152 3300013296 Ga0157374_10107475 Ga0157374_101074754 236
153 3300013296 Ga0157374_10398592 Ga0157374_103985922 236
154 3300013297 Ga0157378_10048214 Ga0157378_100482146 236
155 3300013297 Ga0157378_10091377 Ga0157378_100913772 236
156 3300013297 Ga0157378_10171743 Ga0157378_101717432 236
157 3300013297 Ga0157378_10268289 Ga0157378_102682892 236
158 3300013306 Ga0163162_10000112 Ga0163162_1000011247 236
159 3300013308 Ga0157375_10209843 Ga0157375_102098431 236
160 3300013308 Ga0157375_10361412 Ga0157375_103614123 236
161 3300014968 Ga0157379_10029944 Ga0157379_100299443 236
162 3300014969 Ga0157376_10001570 Ga0157376_100015709 236
163 3300021384 Ga0213876_10016061 Ga0213876_100160613 236
164 3300025302 Ga0207426_1000059 Ga0207426_1000059254 236
165 3300025904 Ga0207647_10108484 Ga0207647_101084842 236
166 3300025909 Ga0207705_10216977 Ga0207705_102169771 236
167 3300025911 Ga0207654_10009816 Ga0207654_100098167 236
168 3300025914 Ga0207671_10000453 Ga0207671_1000045331 236
169 3300025922 Ga0207646_10012637 Ga0207646_100126376 236
170 3300025940 Ga0207691_10145305 Ga0207691_101453051 236
171 3300025942 Ga0207689_10001492 Ga0207689_100014927 236
172 3300025960 Ga0207651_10168833 Ga0207651_101688332 236
173 3300025961 Ga0207712_10005438 Ga0207712_100054386 236
174 3300025972 Ga0207668_10435833 Ga0207668_104358331 236
175 3300025986 Ga0207658_10010564 Ga0207658_100105647 236
176 3300025986 Ga0207658_10032675 Ga0207658_100326753 236
177 3300026023 Ga0207677_10045716 Ga0207677_100457162 236
178 3300026035 Ga0207703_10002804 Ga0207703_100028048 236
179 3300026041 Ga0207639_10088393 Ga0207639_100883933 236
180 3300026041 Ga0207639_10142613 Ga0207639_101426132 236
181 3300026088 Ga0207641_10000058 Ga0207641_1000005815 236
182 3300026095 Ga0207676_10282148 Ga0207676_102821481 236
183 3300026121 Ga0207683_10390413 Ga0207683_103904132 236
184 3300026142 Ga0207698_10007272 Ga0207698_100072723 236
185 3300028381 Ga0268264_10000726 Ga0268264_1000072628 236
186 3300028381 Ga0268264_10063815 Ga0268264_100638152 236
187 3300028794 Ga0307515_10000059 Ga0307515_10000059206 236
188 3300028794 Ga0307515_10192629 Ga0307515_101926292 236
189 3300031456 Ga0307513_10030476 Ga0307513_100304765 236
190 3300031507 Ga0307509_10093902 Ga0307509_100939024 236
191 3300031616 Ga0307508_10000485 Ga0307508_1000048511 236
192 3300031616 Ga0307508_10057484 Ga0307508_100574842 236
193 3300031731 Ga0307405_10184986 Ga0307405_101849862 236
194 3300037418 Ga0395900_0456266 Ga0395900_0456266_375_1094 236
195 3300039437 Ga0436365_1001352 Ga0436365_1001352_3255_3983 236
196 3300044658 Ga0466972_0000168 Ga0466972_0000168_45040_45759 236
197 3300044684 Ga0466966_0013541 Ga0466966_0013541_3752_4480 236
198 3300044684 Ga0466966_0395256 Ga0466966_0395256_86_817 236
199 3300044693 Ga0466961_0064427 Ga0466961_0064427_1205_1933 236
200 3300044765 Ga0466970_0018702 Ga0466970_0018702_2327_3046 236
201 3300045049 Ga0466959_0067262 Ga0466959_0067262_230_958 236
202 3300049570 Ga0501033_0385959 Ga0501033_0385959_217_960 236
203 3300049570 Ga0501033_0398674 Ga0501033_0398674_188_931 236
204 3300049571 Ga0501034_0000004 Ga0501034_0000004_154069_154779 236
205 3300049571 Ga0501034_0148138 Ga0501034_0148138_846_1556 236
206 3300049572 Ga0501036_0568815 Ga0501036_0568815_145_888 236
207 3300049575 Ga0501039_0076399 Ga0501039_0076399_534_1277 236
208 3300049576 Ga0501040_0024014 Ga0501040_0024014_1384_2127 236
209 3300049576 Ga0501040_0138935 Ga0501040_0138935_683_1426 236
210 3300049578 Ga0501042_0049268 Ga0501042_0049268_677_1420 236
211 3300049579 Ga0501043_0572441 Ga0501043_0572441_23_766 236
212 3300049580 Ga0501046_0005998 Ga0501046_0005998_5152_5895 236
213 3300049580 Ga0501046_0214974 Ga0501046_0214974_203_946 236
214 3300049583 Ga0501067_0278172 Ga0501067_0278172_68_796 236
215 3300049584 Ga0501068_0078592 Ga0501068_0078592_386_1129 236
216 3300049584 Ga0501068_0191671 Ga0501068_0191671_358_1101 236
217 3300049587 Ga0501071_0010198 Ga0501071_0010198_2834_3577 236
218 3300049588 Ga0501072_0004554 Ga0501072_0004554_1650_2393 236
219 3300049588 Ga0501072_0164130 Ga0501072_0164130_969_1712 236
220 3300049590 Ga0501074_0453491 Ga0501074_0453491_15_743 236
221 3300049591 Ga0501075_0007589 Ga0501075_0007589_1411_2154 236
222 3300049593 Ga0501077_0009648 Ga0501077_0009648_4433_5176 236
223 3300049593 Ga0501077_0083098 Ga0501077_0083098_709_1452 236
224 3300049741 Ga0501079_0005805 Ga0501079_0005805_2042_2785 236
225 3300049741 Ga0501079_0177956 Ga0501079_0177956_424_1167 236
226 3300049742 Ga0501080_0033622 Ga0501080_0033622_3084_3827 236
227 3300049743 Ga0501081_0006944 Ga0501081_0006944_1400_2143 236
228 3300049744 Ga0501083_0074150 Ga0501083_0074150_563_1306 236
229 3300049824 Ga0501045_0574996 Ga0501045_0574996_16_741 236
230 3300050508 nmdc:mga09592_17643_c1 nmdc:mga09592_17643_c1_2763_3506 236
231 3300050509 nmdc:mga0qj67_71409_c1 nmdc:mga0qj67_71409_c1_1724_2467 236
232 3300050510 nmdc:mga06r32_13475_c1 nmdc:mga06r32_13475_c1_4451_5194 236
233 3300050511 nmdc:mga08y16_733552_c1 nmdc:mga08y16_733552_c1_161_904 236
234 3300053118 Ga0500594_0063049 Ga0500594_0063049_182_892 236
235 3300054114 Ga0501084_0041252 Ga0501084_0041252_2922_3665 236
236 3300054114 Ga0501084_0108657 Ga0501084_0108657_517_1260 236
237 3300060353 Ga0501082_0005462 Ga0501082_0005462_9213_9956 236
238 3300061734 Ga0530510_0079881 Ga0530510_0079881_560_1303 236
239 3300000545 CNXas_1002191 CNXas_10021911 237
240 3300002459 JGI24751J29686_10000297 JGI24751J29686_100002974 237
241 3300003316 rootH1_10038406 rootH1_100384062 237
242 3300003320 rootH2_10007161 rootH2_1000716124 237
243 3300003322 rootL2_10009250 rootL2_100092501 237
244 3300003323 rootH1_10001569 rootH1_100015694 237
245 3300005289 Ga0065704_10117876 Ga0065704_101178761 237
246 3300005289 Ga0065704_10134167 Ga0065704_101341672 237
247 3300005290 Ga0065712_10006725 Ga0065712_100067253 237
248 3300005290 Ga0065712_10069410 Ga0065712_100694104 237
249 3300005290 Ga0065712_10102063 Ga0065712_101020632 237
250 3300005293 Ga0065715_10097890 Ga0065715_100978905 237
251 3300005293 Ga0065715_10131286 Ga0065715_101312862 237
252 3300005295 Ga0065707_10099164 Ga0065707_100991642 237
253 3300005295 Ga0065707_10113318 Ga0065707_101133182 237
254 3300005327 Ga0070658_10032384 Ga0070658_100323845 237
255 3300005327 Ga0070658_10032704 Ga0070658_100327044 237
256 3300005327 Ga0070658_10242787 Ga0070658_102427873 237
257 3300005329 Ga0070683_100024991 Ga0070683_1000249913 237
258 3300005330 Ga0070690_100029757 Ga0070690_1000297573 237
259 3300005331 Ga0070670_100021507 Ga0070670_1000215074 237
260 3300005331 Ga0070670_100028923 Ga0070670_1000289233 237
261 3300005331 Ga0070670_100146190 Ga0070670_1001461902 237
262 3300005331 Ga0070670_100301478 Ga0070670_1003014781 237
263 3300005333 Ga0070677_10174143 Ga0070677_101741431 237
264 3300005334 Ga0068869_100037645 Ga0068869_1000376455 237
265 3300005334 Ga0068869_100053761 Ga0068869_1000537613 237
266 3300005334 Ga0068869_100105840 Ga0068869_1001058402 237
267 3300005335 Ga0070666_10052394 Ga0070666_100523942 237
268 3300005335 Ga0070666_10081514 Ga0070666_100815142 237
269 3300005335 Ga0070666_10327654 Ga0070666_103276541 237
270 3300005336 Ga0070680_100068203 Ga0070680_1000682031 237
271 3300005339 Ga0070660_100000353 Ga0070660_10000035310 237
272 3300005340 Ga0070689_100150368 Ga0070689_1001503682 237
273 3300005340 Ga0070689_100295372 Ga0070689_1002953722 237
274 3300005341 Ga0070691_10207953 Ga0070691_102079532 237
275 3300005341 Ga0070691_10225792 Ga0070691_102257922 237
276 3300005343 Ga0070687_100055049 Ga0070687_1000550492 237
277 3300005353 Ga0070669_100013179 Ga0070669_1000131795 237
278 3300005353 Ga0070669_100140846 Ga0070669_1001408461 237
279 3300005353 Ga0070669_100480030 Ga0070669_1004800302 237
280 3300005354 Ga0070675_100037007 Ga0070675_1000370075 237
281 3300005354 Ga0070675_100240237 Ga0070675_1002402371 237
282 3300005354 Ga0070675_100515595 Ga0070675_1005155952 237
283 3300005364 Ga0070673_100001930 Ga0070673_1000019307 237
284 3300005364 Ga0070673_100095119 Ga0070673_1000951192 237
285 3300005365 Ga0070688_100001768 Ga0070688_1000017685 237
286 3300005365 Ga0070688_100067168 Ga0070688_1000671682 237
287 3300005365 Ga0070688_100126961 Ga0070688_1001269611 237
288 3300005365 Ga0070688_100448606 Ga0070688_1004486061 237
289 3300005367 Ga0070667_100031681 Ga0070667_1000316816 237
290 3300005367 Ga0070667_100346335 Ga0070667_1003463351 237
291 3300005445 Ga0070708_100196646 Ga0070708_1001966462 237
292 3300005455 Ga0070663_100047024 Ga0070663_1000470242 237
293 3300005455 Ga0070663_100293639 Ga0070663_1002936392 237
294 3300005456 Ga0070678_100042232 Ga0070678_1000422322 237
295 3300005457 Ga0070662_100059134 Ga0070662_1000591341 237
296 3300005457 Ga0070662_100200584 Ga0070662_1002005842 237
297 3300005458 Ga0070681_10032510 Ga0070681_100325102 237
298 3300005459 Ga0068867_100016063 Ga0068867_1000160634 237
299 3300005459 Ga0068867_100359275 Ga0068867_1003592752 237
300 3300005466 Ga0070685_10008872 Ga0070685_100088724 237
301 3300005466 Ga0070685_10045751 Ga0070685_100457513 237
302 3300005466 Ga0070685_10119568 Ga0070685_101195682 237
303 3300005466 Ga0070685_10423099 Ga0070685_104230991 237
304 3300005468 Ga0070707_100068849 Ga0070707_1000688494 237
305 3300005468 Ga0070707_100493878 Ga0070707_1004938781 237
306 3300005471 Ga0070698_100089668 Ga0070698_1000896683 237
307 3300005518 Ga0070699_100035304 Ga0070699_1000353044 237
308 3300005530 Ga0070679_100328890 Ga0070679_1003288902 237
309 3300005535 Ga0070684_100123300 Ga0070684_1001233002 237
310 3300005539 Ga0068853_100027012 Ga0068853_1000270122 237
311 3300005539 Ga0068853_100116726 Ga0068853_1001167263 237
312 3300005539 Ga0068853_100221793 Ga0068853_1002217931 237
313 3300005543 Ga0070672_100125084 Ga0070672_1001250842 237
314 3300005543 Ga0070672_100178205 Ga0070672_1001782052 237
315 3300005543 Ga0070672_100426605 Ga0070672_1004266052 237
316 3300005544 Ga0070686_100155613 Ga0070686_1001556132 237
317 3300005549 Ga0070704_100261834 Ga0070704_1002618342 237
318 3300005563 Ga0068855_100001281 Ga0068855_10000128120 237
319 3300005563 Ga0068855_100001364 Ga0068855_10000136415 237
320 3300005563 Ga0068855_100005605 Ga0068855_10000560512 237
321 3300005563 Ga0068855_100061780 Ga0068855_1000617807 237
322 3300005563 Ga0068855_100170031 Ga0068855_1001700312 237
323 3300005563 Ga0068855_100224735 Ga0068855_1002247352 237
324 3300005577 Ga0068857_100040989 Ga0068857_1000409893 237
325 3300005577 Ga0068857_100475945 Ga0068857_1004759452 237
326 3300005577 Ga0068857_100504050 Ga0068857_1005040502 237
327 3300005614 Ga0068856_100025243 Ga0068856_1000252438 237
328 3300005616 Ga0068852_100223678 Ga0068852_1002236782 237
329 3300005616 Ga0068852_100463858 Ga0068852_1004638582 237
330 3300005617 Ga0068859_100043650 Ga0068859_1000436504 237
331 3300005617 Ga0068859_100055565 Ga0068859_1000555652 237
332 3300005617 Ga0068859_100076850 Ga0068859_1000768505 237
333 3300005617 Ga0068859_100276535 Ga0068859_1002765351 237
334 3300005617 Ga0068859_100441309 Ga0068859_1004413092 237
335 3300005618 Ga0068864_100013747 Ga0068864_1000137478 237
336 3300005618 Ga0068864_100026382 Ga0068864_1000263826 237
337 3300005618 Ga0068864_100038927 Ga0068864_1000389274 237
338 3300005618 Ga0068864_100075767 Ga0068864_1000757672 237
339 3300005618 Ga0068864_100186352 Ga0068864_1001863522 237
340 3300005719 Ga0068861_100004575 Ga0068861_10000457511 237
341 3300005719 Ga0068861_100025586 Ga0068861_1000255862 237
342 3300005719 Ga0068861_100130465 Ga0068861_1001304652 237
343 3300005834 Ga0068851_10101144 Ga0068851_101011442 237
344 3300005834 Ga0068851_10401648 Ga0068851_104016481 237
345 3300005840 Ga0068870_10137798 Ga0068870_101377982 237
346 3300005841 Ga0068863_100428969 Ga0068863_1004289691 237
347 3300005842 Ga0068858_100227240 Ga0068858_1002272402 237
348 3300005842 Ga0068858_100838392 Ga0068858_1008383922 237
349 3300005843 Ga0068860_100060453 Ga0068860_1000604535 237
350 3300005843 Ga0068860_100211746 Ga0068860_1002117462 237
351 3300005844 Ga0068862_100012568 Ga0068862_1000125683 237
352 3300005844 Ga0068862_100020995 Ga0068862_1000209957 237
353 3300005983 Ga0081540_1017706 Ga0081540_10177063 237
354 3300006173 Ga0070716_100101830 Ga0070716_1001018302 237
355 3300006195 Ga0075366_10024460 Ga0075366_100244602 237
356 3300006195 Ga0075366_10113143 Ga0075366_101131433 237
357 3300006195 Ga0075366_10124486 Ga0075366_101244861 237
358 3300006237 Ga0097621_100019677 Ga0097621_1000196771 237
359 3300006237 Ga0097621_100111731 Ga0097621_1001117313 237
360 3300006237 Ga0097621_100175542 Ga0097621_1001755423 237
361 3300006358 Ga0068871_100053211 Ga0068871_1000532112 237
362 3300006358 Ga0068871_100402919 Ga0068871_1004029192 237
363 3300006844 Ga0075428_100013757 Ga0075428_1000137578 237
364 3300006844 Ga0075428_100014688 Ga0075428_1000146886 237
365 3300006847 Ga0075431_100058710 Ga0075431_1000587105 237
366 3300006880 Ga0075429_100004785 Ga0075429_1000047859 237
367 3300006880 Ga0075429_100059697 Ga0075429_1000596971 237
368 3300006881 Ga0068865_100143641 Ga0068865_1001436411 237
369 3300006931 Ga0097620_100043648 Ga0097620_1000436484 237
370 3300006931 Ga0097620_100055565 Ga0097620_1000555652 237
371 3300006931 Ga0097620_100076849 Ga0097620_1000768495 237
372 3300006931 Ga0097620_100276522 Ga0097620_1002765221 237
373 3300006931 Ga0097620_100441314 Ga0097620_1004413142 237
374 3300009093 Ga0105240_10003164 Ga0105240_1000316415 237
375 3300009093 Ga0105240_10022849 Ga0105240_100228494 237
376 3300009093 Ga0105240_10037496 Ga0105240_100374965 237
377 3300009093 Ga0105240_10050750 Ga0105240_100507505 237
378 3300009093 Ga0105240_10051677 Ga0105240_100516773 237
379 3300009093 Ga0105240_10072721 Ga0105240_100727212 237
380 3300009093 Ga0105240_10164462 Ga0105240_101644622 237
381 3300009094 Ga0111539_10209325 Ga0111539_102093252 237
382 3300009094 Ga0111539_10417824 Ga0111539_104178241 237
383 3300009094 Ga0111539_10556141 Ga0111539_105561411 237
384 3300009101 Ga0105247_10007492 Ga0105247_100074925 237
385 3300009147 Ga0114129_10001062 Ga0114129_1000106210 237
386 3300009148 Ga0105243_10248409 Ga0105243_102484092 237
387 3300009174 Ga0105241_10002036 Ga0105241_1000203613 237
388 3300009174 Ga0105241_10042016 Ga0105241_100420162 237
389 3300009174 Ga0105241_10417594 Ga0105241_104175942 237
390 3300009176 Ga0105242_10005785 Ga0105242_1000578512 237
391 3300009176 Ga0105242_10058511 Ga0105242_100585112 237
392 3300009177 Ga0105248_10236734 Ga0105248_102367341 237
393 3300009545 Ga0105237_10000144 Ga0105237_1000014423 237
394 3300009545 Ga0105237_10003823 Ga0105237_1000382315 237
395 3300009545 Ga0105237_10033838 Ga0105237_100338384 237
396 3300009551 Ga0105238_10005010 Ga0105238_1000501012 237
397 3300009551 Ga0105238_10256291 Ga0105238_102562912 237
398 3300009553 Ga0105249_10001056 Ga0105249_1000105613 237
399 3300009553 Ga0105249_10007493 Ga0105249_100074934 237
400 3300009553 Ga0105249_10011216 Ga0105249_100112164 237
401 3300009553 Ga0105249_10053452 Ga0105249_100534523 237
402 3300009553 Ga0105249_10075154 Ga0105249_100751542 237
403 3300009553 Ga0105249_10742256 Ga0105249_107422561 237
404 3300010375 Ga0105239_10000488 Ga0105239_100004885 237
405 3300010375 Ga0105239_10000925 Ga0105239_1000092534 237
406 3300010375 Ga0105239_10016597 Ga0105239_100165975 237
407 3300010375 Ga0105239_10020600 Ga0105239_100206009 237
408 3300010375 Ga0105239_10090488 Ga0105239_100904883 237
409 3300013100 Ga0157373_10008679 Ga0157373_100086799 237
410 3300013102 Ga0157371_10000451 Ga0157371_1000045122 237
411 3300013102 Ga0157371_10152895 Ga0157371_101528951 237
412 3300013102 Ga0157371_10230889 Ga0157371_102308892 237
413 3300013102 Ga0157371_10577840 Ga0157371_105778401 237
414 3300013104 Ga0157370_10003865 Ga0157370_100038657 237
415 3300013104 Ga0157370_10006839 Ga0157370_100068394 237
416 3300013104 Ga0157370_10007606 Ga0157370_100076066 237
417 3300013104 Ga0157370_10089403 Ga0157370_100894032 237
418 3300013104 Ga0157370_10175065 Ga0157370_101750652 237
419 3300013104 Ga0157370_10391791 Ga0157370_103917912 237
420 3300013104 Ga0157370_10743179 Ga0157370_107431791 237
421 3300013105 Ga0157369_10037669 Ga0157369_100376698 237
422 3300013105 Ga0157369_10227713 Ga0157369_102277132 237
423 3300013296 Ga0157374_10000013 Ga0157374_10000013323 237
424 3300013306 Ga0163162_10000253 Ga0163162_1000025312 237
425 3300013306 Ga0163162_11301536 Ga0163162_113015361 237
426 3300013307 Ga0157372_10000667 Ga0157372_1000066728 237
427 3300013307 Ga0157372_10071033 Ga0157372_100710333 237
428 3300013307 Ga0157372_10327274 Ga0157372_103272742 237
429 3300013307 Ga0157372_10349849 Ga0157372_103498492 237
430 3300013308 Ga0157375_10088688 Ga0157375_100886882 237
431 3300013308 Ga0157375_10400674 Ga0157375_104006742 237
432 3300014325 Ga0163163_10470739 Ga0163163_104707392 237
433 3300014326 Ga0157380_10004180 Ga0157380_100041808 237
434 3300014326 Ga0157380_10055627 Ga0157380_100556274 237
435 3300014326 Ga0157380_10099713 Ga0157380_100997133 237
436 3300014326 Ga0157380_10101875 Ga0157380_101018753 237
437 3300014326 Ga0157380_10281935 Ga0157380_102819352 237
438 3300014326 Ga0157380_10431861 Ga0157380_104318612 237
439 3300014745 Ga0157377_10017312 Ga0157377_100173123 237
440 3300014745 Ga0157377_10017363 Ga0157377_100173635 237
441 3300014968 Ga0157379_10380303 Ga0157379_103803032 237
442 3300014969 Ga0157376_10152746 Ga0157376_101527462 237
443 3300014969 Ga0157376_10153384 Ga0157376_101533842 237
444 3300014969 Ga0157376_10230195 Ga0157376_102301952 237
445 3300017792 Ga0163161_10040483 Ga0163161_100404833 237
446 3300017792 Ga0163161_10068270 Ga0163161_100682701 237
447 3300017792 Ga0163161_10157142 Ga0163161_101571421 237
448 3300017792 Ga0163161_10288960 Ga0163161_102889602 237
449 3300025315 Ga0207697_10013942 Ga0207697_100139422 237
450 3300025321 Ga0207656_10085275 Ga0207656_100852751 237
451 3300025893 Ga0207682_10161128 Ga0207682_101611281 237
452 3300025900 Ga0207710_10002364 Ga0207710_100023647 237
453 3300025903 Ga0207680_10020915 Ga0207680_100209153 237
454 3300025903 Ga0207680_10324646 Ga0207680_103246461 237
455 3300025904 Ga0207647_10064086 Ga0207647_100640862 237
456 3300025907 Ga0207645_10121810 Ga0207645_101218102 237
457 3300025908 Ga0207643_10012716 Ga0207643_100127162 237
458 3300025908 Ga0207643_10091760 Ga0207643_100917602 237
459 3300025911 Ga0207654_10002079 Ga0207654_1000207911 237
460 3300025911 Ga0207654_10055609 Ga0207654_100556092 237
461 3300025913 Ga0207695_10000056 Ga0207695_10000056315 237
462 3300025913 Ga0207695_10001122 Ga0207695_1000112234 237
463 3300025913 Ga0207695_10010840 Ga0207695_100108409 237
464 3300025913 Ga0207695_10027732 Ga0207695_100277325 237
465 3300025913 Ga0207695_10028609 Ga0207695_100286095 237
466 3300025913 Ga0207695_10063527 Ga0207695_100635272 237
467 3300025914 Ga0207671_10001502 Ga0207671_1000150218 237
468 3300025914 Ga0207671_10001511 Ga0207671_1000151128 237
469 3300025917 Ga0207660_10072945 Ga0207660_100729452 237
470 3300025918 Ga0207662_10014896 Ga0207662_100148962 237
471 3300025919 Ga0207657_10005517 Ga0207657_100055174 237
472 3300025919 Ga0207657_10046739 Ga0207657_100467393 237
473 3300025919 Ga0207657_10115053 Ga0207657_101150533 237
474 3300025921 Ga0207652_10009486 Ga0207652_100094867 237
475 3300025921 Ga0207652_10405891 Ga0207652_104058911 237
476 3300025922 Ga0207646_10212194 Ga0207646_102121943 237
477 3300025922 Ga0207646_10473547 Ga0207646_104735472 237
478 3300025923 Ga0207681_10057701 Ga0207681_100577012 237
479 3300025923 Ga0207681_10564845 Ga0207681_105648451 237
480 3300025924 Ga0207694_10106310 Ga0207694_101063102 237
481 3300025925 Ga0207650_10012500 Ga0207650_100125002 237
482 3300025925 Ga0207650_10103533 Ga0207650_101035332 237
483 3300025925 Ga0207650_10170423 Ga0207650_101704232 237
484 3300025926 Ga0207659_10004571 Ga0207659_100045718 237
485 3300025926 Ga0207659_10012861 Ga0207659_100128614 237
486 3300025926 Ga0207659_10477265 Ga0207659_104772651 237
487 3300025931 Ga0207644_10123395 Ga0207644_101233952 237
488 3300025932 Ga0207690_10317204 Ga0207690_103172042 237
489 3300025933 Ga0207706_10067636 Ga0207706_100676363 237
490 3300025933 Ga0207706_10228136 Ga0207706_102281362 237
491 3300025934 Ga0207686_10000351 Ga0207686_1000035124 237
492 3300025934 Ga0207686_10169185 Ga0207686_101691852 237
493 3300025936 Ga0207670_10048806 Ga0207670_100488061 237
494 3300025936 Ga0207670_10432955 Ga0207670_104329552 237
495 3300025936 Ga0207670_10523278 Ga0207670_105232782 237
496 3300025937 Ga0207669_10817614 Ga0207669_108176141 237
497 3300025938 Ga0207704_10126127 Ga0207704_101261272 237
498 3300025938 Ga0207704_10134502 Ga0207704_101345022 237
499 3300025940 Ga0207691_10075209 Ga0207691_100752092 237
500 3300025940 Ga0207691_10081826 Ga0207691_100818262 237
501 3300025940 Ga0207691_10320367 Ga0207691_103203672 237
502 3300025941 Ga0207711_10078140 Ga0207711_100781402 237
503 3300025942 Ga0207689_10104175 Ga0207689_101041752 237
504 3300025944 Ga0207661_10803567 Ga0207661_108035671 237
505 3300025949 Ga0207667_10007821 Ga0207667_1000782112 237
506 3300025949 Ga0207667_10075292 Ga0207667_100752922 237
507 3300025949 Ga0207667_10134911 Ga0207667_101349113 237
508 3300025949 Ga0207667_10150742 Ga0207667_101507422 237
509 3300025949 Ga0207667_10155683 Ga0207667_101556833 237
510 3300025960 Ga0207651_10109139 Ga0207651_101091392 237
511 3300025960 Ga0207651_10147807 Ga0207651_101478072 237
512 3300025960 Ga0207651_10232759 Ga0207651_102327592 237
513 3300025960 Ga0207651_10586049 Ga0207651_105860491 237
514 3300025961 Ga0207712_10001599 Ga0207712_100015993 237
515 3300025961 Ga0207712_10003428 Ga0207712_100034288 237
516 3300025961 Ga0207712_10014496 Ga0207712_100144962 237
517 3300025961 Ga0207712_10031442 Ga0207712_100314423 237
518 3300025961 Ga0207712_10319151 Ga0207712_103191512 237
519 3300025972 Ga0207668_10333519 Ga0207668_103335192 237
520 3300025986 Ga0207658_10042638 Ga0207658_100426382 237
521 3300026023 Ga0207677_10153583 Ga0207677_101535831 237
522 3300026023 Ga0207677_10229345 Ga0207677_102293452 237
523 3300026041 Ga0207639_10012512 Ga0207639_100125125 237
524 3300026041 Ga0207639_10054200 Ga0207639_100542002 237
525 3300026041 Ga0207639_10085015 Ga0207639_100850153 237
526 3300026041 Ga0207639_10160505 Ga0207639_101605052 237
527 3300026041 Ga0207639_10413219 Ga0207639_104132192 237
528 3300026075 Ga0207708_10120038 Ga0207708_101200382 237
529 3300026075 Ga0207708_10348786 Ga0207708_103487862 237
530 3300026078 Ga0207702_10230502 Ga0207702_102305022 237
531 3300026088 Ga0207641_10043574 Ga0207641_100435742 237
532 3300026089 Ga0207648_10022185 Ga0207648_100221854 237
533 3300026089 Ga0207648_10118817 Ga0207648_101188172 237
534 3300026089 Ga0207648_10185389 Ga0207648_101853892 237
535 3300026095 Ga0207676_10014686 Ga0207676_100146865 237
536 3300026095 Ga0207676_10045785 Ga0207676_100457853 237
537 3300026095 Ga0207676_10238300 Ga0207676_102383003 237
538 3300026116 Ga0207674_10008410 Ga0207674_100084104 237
539 3300026116 Ga0207674_10008703 Ga0207674_100087035 237
540 3300026116 Ga0207674_10101275 Ga0207674_101012753 237
541 3300026116 Ga0207674_10787100 Ga0207674_107871001 237
542 3300026118 Ga0207675_100000153 Ga0207675_10000015321 237
543 3300026118 Ga0207675_100027008 Ga0207675_1000270083 237
544 3300026118 Ga0207675_100140758 Ga0207675_1001407583 237
545 3300026121 Ga0207683_10011891 Ga0207683_100118912 237
546 3300026142 Ga0207698_10055959 Ga0207698_100559592 237
547 3300026142 Ga0207698_10063132 Ga0207698_100631322 237
548 3300026142 Ga0207698_10172973 Ga0207698_101729732 237
549 3300026142 Ga0207698_10391926 Ga0207698_103919262 237
550 3300027907 Ga0207428_10033842 Ga0207428_100338421 237
551 3300028380 Ga0268265_10006773 Ga0268265_100067732 237
552 3300028380 Ga0268265_10082385 Ga0268265_100823852 237
553 3300028380 Ga0268265_10195834 Ga0268265_101958342 237
554 3300028786 Ga0307517_10219728 Ga0307517_102197282 237
555 3300030521 Ga0307511_10000181 Ga0307511_1000018151 237
556 3300031456 Ga0307513_10348214 Ga0307513_103482142 237
557 3300031507 Ga0307509_10013918 Ga0307509_100139186 237
558 3300031730 Ga0307516_10170989 Ga0307516_101709892 237
559 3300031730 Ga0307516_10202111 Ga0307516_102021112 237
560 3300032004 Ga0307414_10050346 Ga0307414_100503462 237
561 3300035692 Ga0373935_0088048 Ga0373935_0088048_1170_1883 237
562 3300038443 Ga0395901_0002140 Ga0395901_0002140_5330_6043 237
563 3300041404 Ga0439436_0004748 Ga0439436_0004748_889_1602 237
564 3300041406 Ga0439439_0001927 Ga0439439_0001927_1479_2192 237
565 3300041406 Ga0439439_0080627 Ga0439439_0080627_145_858 237
566 3300041413 Ga0439465_0108527 Ga0439465_0108527_44_757 237
567 3300041451 Ga0451791_1381310 Ga0451791_1381310_151_864 237
568 3300041459 Ga0451800_1146729 Ga0451800_1146729_102_815 237
569 3300041459 Ga0451800_1377849 Ga0451800_1377849_133_846 237
570 3300041486 Ga0451807_0414922 Ga0451807_0414922_284_1000 237
571 3300041498 Ga0451841_1354039 Ga0451841_1354039_89_841 237
572 3300041501 Ga0451845_0011729 Ga0451845_0011729_282_995 237
573 3300041503 Ga0451847_0209969 Ga0451847_0209969_33_749 237
574 3300041512 Ga0451853_2563909 Ga0451853_2563909_211_924 237
575 3300042007 Ga0439449_0015126 Ga0439449_0015126_1042_1755 237
576 3300042014 Ga0439457_000277 Ga0439457_000277_9013_9726 237
577 3300042876 Ga0451577_0001932 Ga0451577_0001932_5614_6336 237
578 3300042876 Ga0451577_0210143 Ga0451577_0210143_967_1680 237
579 3300044656 Ga0466969_0000190 Ga0466969_0000190_21043_21756 237
580 3300044656 Ga0466969_0054828 Ga0466969_0054828_312_1025 237
581 3300044658 Ga0466972_0000337 Ga0466972_0000337_23144_23857 237
582 3300044658 Ga0466972_0007731 Ga0466972_0007731_2160_2873 237
583 3300044673 Ga0453683_0083947 Ga0453683_0083947_795_1508 237
584 3300044684 Ga0466966_0075817 Ga0466966_0075817_68_781 237
585 3300044693 Ga0466961_0110285 Ga0466961_0110285_565_1278 237
586 3300044693 Ga0466961_0119342 Ga0466961_0119342_631_1344 237
587 3300044712 Ga0453684_0318611 Ga0453684_0318611_910_1632 237
588 3300044719 Ga0466971_0003048 Ga0466971_0003048_323_1036 237
589 3300044719 Ga0466971_0167919 Ga0466971_0167919_91_804 237
590 3300044765 Ga0466970_0018946 Ga0466970_0018946_1223_1936 237
591 3300044842 Ga0466957_0000428 Ga0466957_0000428_17756_18469 237
592 3300044842 Ga0466957_0001546 Ga0466957_0001546_6182_6895 237
593 3300045049 Ga0466959_0000003 Ga0466959_0000003_148911_149624 237
594 3300045049 Ga0466959_0000488 Ga0466959_0000488_1470_2183 237
595 3300045976 Ga0466967_0269720 Ga0466967_0269720_239_964 237
596 3300045976 Ga0466967_0527085 Ga0466967_0527085_196_921 237
597 3300046460 Ga0495638_0120656 Ga0495638_0120656_628_1341 237
598 3300046472 Ga0495580_0401459 Ga0495580_0401459_65_778 237
599 3300046616 Ga0495668_0000302 Ga0495668_0000302_22561_23274 237
600 3300046648 Ga0495611_0000061 Ga0495611_0000061_47024_47737 237
601 3300046809 Ga0495600_0411156 Ga0495600_0411156_69_782 237
602 3300047320 Ga0495672_0005682 Ga0495672_0005682_4822_5535 237
603 3300047320 Ga0495672_0018449 Ga0495672_0018449_669_1382 237
604 3300047472 Ga0495686_0000010 Ga0495686_0000010_477666_478379 237
605 3300047472 Ga0495686_0012477 Ga0495686_0012477_1587_2300 237
606 3300047472 Ga0495686_0284601 Ga0495686_0284601_34_747 237
607 3300048913 Ga0496110_0589746 Ga0496110_0589746_79_792 237
608 3300049568 Ga0501031_0303091 Ga0501031_0303091_205_918 237
609 3300049569 Ga0501032_0010324 Ga0501032_0010324_1610_2323 237
610 3300049571 Ga0501034_0013427 Ga0501034_0013427_7391_8104 237
611 3300049571 Ga0501034_0043155 Ga0501034_0043155_869_1618 237
612 3300049571 Ga0501034_0061010 Ga0501034_0061010_2087_2800 237
613 3300049571 Ga0501034_0459750 Ga0501034_0459750_436_1149 237
614 3300049572 Ga0501036_0022006 Ga0501036_0022006_488_1201 237
615 3300049573 Ga0501037_0131682 Ga0501037_0131682_543_1256 237
616 3300049573 Ga0501037_0348103 Ga0501037_0348103_63_776 237
617 3300049574 Ga0501038_0015262 Ga0501038_0015262_1884_2597 237
618 3300049574 Ga0501038_0226201 Ga0501038_0226201_249_962 237
619 3300049575 Ga0501039_0040701 Ga0501039_0040701_2860_3573 237
620 3300049578 Ga0501042_0203698 Ga0501042_0203698_228_941 237
621 3300049579 Ga0501043_0010690 Ga0501043_0010690_2079_2792 237
622 3300049579 Ga0501043_0117068 Ga0501043_0117068_838_1551 237
623 3300049580 Ga0501046_0055861 Ga0501046_0055861_759_1472 237
624 3300049581 Ga0501047_0009030 Ga0501047_0009030_7697_8410 237
625 3300049581 Ga0501047_0019423 Ga0501047_0019423_2346_3059 237
626 3300049581 Ga0501047_0156907 Ga0501047_0156907_727_1440 237
627 3300049581 Ga0501047_0170288 Ga0501047_0170288_695_1408 237
628 3300049582 Ga0501048_0267987 Ga0501048_0267987_256_969 237
629 3300049586 Ga0501070_0006613 Ga0501070_0006613_4304_5017 237
630 3300049586 Ga0501070_0019796 Ga0501070_0019796_497_1210 237
631 3300049589 Ga0501073_0100011 Ga0501073_0100011_1102_1815 237
632 3300049590 Ga0501074_0004746 Ga0501074_0004746_7221_7934 237
633 3300049592 Ga0501076_0528909 Ga0501076_0528909_165_878 237
634 3300049675 Ga0501243_037238 Ga0501243_037238_45_758 237
635 3300049703 Ga0501219_000321 Ga0501219_000321_7510_8223 237
636 3300049705 Ga0501225_0003367 Ga0501225_0003367_2850_3563 237
637 3300049741 Ga0501079_0042780 Ga0501079_0042780_796_1509 237
638 3300049742 Ga0501080_0057387 Ga0501080_0057387_1102_1815 237
639 3300049744 Ga0501083_0041069 Ga0501083_0041069_367_1080 237
640 3300049744 Ga0501083_0129585 Ga0501083_0129585_507_1220 237
641 3300049822 Ga0501035_0023355 Ga0501035_0023355_1086_1835 237
642 3300049822 Ga0501035_0028623 Ga0501035_0028623_2310_3023 237
643 3300049822 Ga0501035_0038469 Ga0501035_0038469_1005_1718 237
644 3300049822 Ga0501035_0110505 Ga0501035_0110505_1634_2347 237
645 3300049823 Ga0501044_0009878 Ga0501044_0009878_1493_2206 237
646 3300049823 Ga0501044_0081954 Ga0501044_0081954_1720_2433 237
647 3300049823 Ga0501044_0095326 Ga0501044_0095326_1141_1854 237
648 3300050005 Ga0501284_00001 Ga0501284_00001_97107_97820 237
649 3300050493 nmdc:mga0k408_47296_c1 nmdc:mga0k408_47296_c1_1729_2442 237
650 3300050493 nmdc:mga0k408_54390_c1 nmdc:mga0k408_54390_c1_676_1389 237
651 3300050493 nmdc:mga0k408_68441_c1 nmdc:mga0k408_68441_c1_1023_1736 237
652 3300050507 nmdc:mga05p37_482_c1 nmdc:mga05p37_482_c1_18907_19620 237
653 3300050508 nmdc:mga09592_5311_c1 nmdc:mga09592_5311_c1_2884_3597 237
654 3300050509 nmdc:mga0qj67_4695_c1 nmdc:mga0qj67_4695_c1_2631_3344 237
655 3300050510 nmdc:mga06r32_28324_c1 nmdc:mga06r32_28324_c1_823_1536 237
656 3300050510 nmdc:mga06r32_352998_c1 nmdc:mga06r32_352998_c1_527_1240 237
657 3300050511 nmdc:mga08y16_295698_c1 nmdc:mga08y16_295698_c1_401_1114 237
658 3300050511 nmdc:mga08y16_360998_c1 nmdc:mga08y16_360998_c1_318_1031 237
659 3300050511 nmdc:mga08y16_54079_c1 nmdc:mga08y16_54079_c1_3410_4123 237
660 3300053086 Ga0500578_0001290 Ga0500578_0001290_23785_24498 237
661 3300053086 Ga0500578_0129817 Ga0500578_0129817_498_1211 237
662 3300053088 Ga0500644_0157097 Ga0500644_0157097_19_732 237
663 3300053090 Ga0500646_0007918 Ga0500646_0007918_288_1001 237
664 3300053092 Ga0500583_0000019 Ga0500583_0000019_63324_64037 237
665 3300053092 Ga0500583_0004286 Ga0500583_0004286_1736_2449 237
666 3300053093 Ga0500651_0181427 Ga0500651_0181427_332_1045 237
667 3300053102 Ga0500554_040399 Ga0500554_040399_451_1164 237
668 3300053131 Ga0500652_020551 Ga0500652_020551_1010_1828 237
669 3300053134 Ga0500658_0045886 Ga0500658_0045886_756_1469 237
670 3300053139 Ga0500568_0000208 Ga0500568_0000208_11387_12100 237
671 3300053140 Ga0500573_0138055 Ga0500573_0138055_17_730 237
672 3300053146 Ga0500588_0125342 Ga0500588_0125342_41_754 237
673 3300053177 Ga0500636_0156465 Ga0500636_0156465_472_1185 237
674 3300053178 Ga0500637_0010936 Ga0500637_0010936_895_1608 237
675 3300053727 Ga0500611_000001 Ga0500611_000001_168651_169364 237
676 3300054114 Ga0501084_0118061 Ga0501084_0118061_511_1224 237
677 3300061719 Ga0466962_0001581 Ga0466962_0001581_1100_1813 237

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00696

AA_kinase

Amino acid kinase family

41

250

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2bnf-assembly1.cif.gz_A the structure of e. coli ump kinase in complex with utp 0.922 1 237
2bnf-assembly1.cif.gz_A the structure of e. coli ump kinase in complex with utp 0.9183 1 237
2bnd-assembly1.cif.gz_A the structure of e. coli ump kinase in complex with udp 0.9176 1 237
2v4y-assembly1.cif.gz_C the structure of e. coli ump kinase in complex with its allosteric regulator gtp 0.9168 1 237
2bne-assembly1.cif.gz_A the structure of e. coli ump kinase in complex with ump 0.9164 1 237
ID Description Score Start End Superfamily
af_P9WHK5_22_261_3.40.1160.10 Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like 0.9145 2 237 3.40.1160.10
2jjxC00 Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like 0.9088 5 236 3.40.1160.10
af_A0A1D6G3Z5_82_358_3.40.1160.10 Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like 0.9055 2 237 3.40.1160.10
3ek5B00 Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like 0.9048 1 237 3.40.1160.10
af_P9WHK5_22_261_3.40.1160.10 Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like 0.9034 2 237 3.40.1160.10
ID Description Score Start End GO Terms
AF-A0A520QIF5-F1-model_v4 UMP kinase (EC 2.7.4.22) (Uridine monophosphate kinase) 0.9969 140 237 GO:0005524
GO:0006225
GO:0033862
AF-A0A520QIF5-F1-model_v4 UMP kinase (EC 2.7.4.22) (Uridine monophosphate kinase) 0.9869 140 237 GO:0005524
GO:0006225
GO:0033862
AF-A0A359HF64-F1-model_v4 UMP kinase (EC 2.7.4.22) (Uridine monophosphate kinase) 0.9826 146 237 GO:0005524
GO:0006225
GO:0033862
AF-A0A3N5N269-F1-model_v4 UMP kinase (EC 2.7.4.22) (Uridine monophosphate kinase) 0.9789 137 237 GO:0005524
GO:0006225
GO:0033862
AF-Q4BV13-F1-model_v4 UMP kinase (EC 2.7.4.22) (Uridine monophosphate kinase) 0.9775 146 237 GO:0005524
GO:0006225
GO:0033862

Feature Viewer

pLDDT pTM Quality
87.29 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map