F474613
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 677 | 276 | 653 | 349 |
Family's Representative Sequence
| Representative Sequence | 3300049585|Ga0501069_0026292|Ga0501069_0026292_368_1492 |
| Length | 374 |
| Sequence | MQDGSRPWPGWRPFQGLATVLTGTGNNGVDSRPAGFTLTPNASLRDRNTLRVDARAAWLADIHDAAAIPDLLDQAASRDRPMLLLGEGSNVLFTGDFGGVVVTMKTRGVEILDDVDDAARIRVAAGEHWDSLVRWTLAHGHAGLENLILIPGSVGAAPMQNIGAYGVEVREFIESVETYDLRQRRGAEFRNGDCEFGYRDSIFKRHPDRWLITAVTLRLPRAWAPRIEYSGVQEELRRMGVERPAPIHVADAVVALRTRKLPDPAVIGNAGSFFKNPLIPAAQATTLLAEHPQLPCWPVPNDMSKLSAAWLIEASGFKGLREGDVGISNRHALVLVNHGNATGEQLWALAQRVREGVRERFGVELEPEPRVAAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2537561836 | Rhodanobacter spathiphylli B39 | Isolate | Unclassified |
| 2 | 2593339238 | Luteibacter sp. UNCMF366Tsu5.1 | Isolate | Unclassified |
| 3 | 2593339239 | Luteibacter sp. UNCMF331Sha3.1 | Isolate | Unclassified |
| 4 | 2643221562 | Rhodanobacter sp. Root561 | Isolate | Unclassified |
| 5 | 2643221577 | Rhodanobacter sp. Root627 | Isolate | Unclassified |
| 6 | 2643221685 | Rhodanobacter sp. Root480 | Isolate | Unclassified |
| 7 | 2687453130 | Dyella thiooxydans ATSB10 | Isolate | Unclassified |
| 8 | 2718218334 | Luteibacter rhizovicinus LJ96 | Isolate | Rhizosphere |
| 9 | 2734482264 | Dyella sp. AD052 | Isolate | Unclassified |
| 10 | 2738543009 | Luteibacter sp. OK325 | Isolate | Unclassified |
| 11 | 2739367700 | Dyella sp. YR388 | Isolate | Unclassified |
| 12 | 2818991440 | Luteibacter yeojuensis 583 | Isolate | Unclassified |
| 13 | 2842914999 | Luteibacter sp. R-72151 | Isolate | Unclassified |
| 14 | 2842918807 | Luteibacter sp. R-73110 | Isolate | Unclassified |
| 15 | 2884338543 | Luteibacter pinisoli MAH-14 | Isolate | Rhizosphere |
| 16 | 2884411467 | Dyella sp. AD56 | Isolate | Rhizosphere |
| 17 | 2895395659 | Rhodanobacter sp. T12-5 | Isolate | Unclassified |
| 18 | 2904463128 | Luteibacter yeojuensis 3191 | Isolate | Unclassified |
| 19 | 2919085039 | Luteibacter sp. 1214 | Isolate | Unclassified |
| 20 | 2919404418 | Luteibacter sp. 3190 | Isolate | Unclassified |
| 21 | 2928963466 | Dyella japonica 1073 | Isolate | Unclassified |
| 22 | 2939611941 | Rhodanobacter soli 1757 | Isolate | Rhizosphere |
| 23 | 2941471342 | Luteibacter sp. 621 | Isolate | Unclassified |
| 24 | 2953994433 | Luteibacter sp. W1I16 | Isolate | Rhizosphere |
| 25 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 26 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 27 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 28 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 29 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 30 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 31 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 32 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 33 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 34 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 35 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 36 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 37 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 38 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 39 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 40 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 41 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 42 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 43 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 44 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 45 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 46 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 47 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 48 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 49 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 52 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 56 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 58 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 69 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 70 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 71 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 72 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 73 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 78 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 80 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 81 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 82 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 83 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 84 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 85 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 86 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 87 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 94 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 103 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 105 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 106 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 107 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 108 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 109 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 111 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 112 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 113 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 114 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 115 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 116 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 126 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 127 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 129 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 130 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 172 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 173 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 174 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 175 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 176 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 177 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 178 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 179 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 180 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 181 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 182 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 183 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 184 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 185 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 186 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 187 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 188 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 189 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 190 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 191 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 192 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 193 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 194 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 195 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 196 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 197 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 198 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 199 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 227 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 228 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 229 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 230 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 231 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 232 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 233 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 234 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 235 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 236 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 237 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 238 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 239 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 240 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 241 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 242 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 243 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 244 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 245 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 246 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 256 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 271 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 272 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 273 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 274 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 275 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 276 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.13 |
| Metatranscriptomes | 1.33 |
| Isolates | 3.55 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13.88 |
| Nodule | 0 |
| Rhizoplane | 2.36 |
| Rhizosphere | 69.42 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 14.33 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1003793 | 3300001904 | Bacteria | 2606 |
| 2 | JGI24741J21665_1000657 | 3300001915 | Bacteria | 10437 |
| 3 | JGI24741J21665_1002272 | 3300001915 | Bacteria | 5061 |
| 4 | JGI24741J21665_1003851 | 3300001915 | Bacteria | 3466 |
| 5 | JGI24740J21852_10003823 | 3300001979 | Bacteria | 6545 |
| 6 | JGI24740J21852_10006323 | 3300001979 | Bacteria | 4917 |
| 7 | JGI24740J21852_10008388 | 3300001979 | Bacteria | 4118 |
| 8 | JGI24739J22299_10001760 | 3300001989 | Bacteria | 8239 |
| 9 | JGI24737J22298_10001454 | 3300001990 | Bacteria | 8441 |
| 10 | JGI24735J21928_10001618 | 3300002067 | Bacteria | 7972 |
| 11 | JGI24738J21930_10000989 | 3300002075 | Bacteria | 8151 |
| 12 | JGI25156J39149_1004866 | 3300002705 | Bacteria | 3997 |
| 13 | JGI25156J39149_1010264 | 3300002705 | Bacteria | 2213 |
| 14 | JGI25156J39149_1012543 | 3300002705 | Bacteria | 1854 |
| 15 | JGI25156J39149_1015099 | 3300002705 | Bacteria | 1561 |
| 16 | JGI25162J39368_1000068 | 3300002737 | Bacteria | 129594 |
| 17 | JGI25162J39368_1000270 | 3300002737 | Bacteria | 50050 |
| 18 | JGI25162J39368_1000991 | 3300002737 | Bacteria | 17952 |
| 19 | JGI25162J39368_1001266 | 3300002737 | Bacteria | 14404 |
| 20 | JGI25162J39368_1001649 | 3300002737 | Bacteria | 11104 |
| 21 | JGI25162J39368_1002007 | 3300002737 | Bacteria | 9042 |
| 22 | JGI25157J39369_1000068 | 3300002741 | Bacteria | 94833 |
| 23 | JGI25157J39369_1000333 | 3300002741 | Bacteria | 33433 |
| 24 | JGI25157J39369_1004281 | 3300002741 | Bacteria | 2639 |
| 25 | JGI25157J39369_1004468 | 3300002741 | Bacteria | 2528 |
| 26 | JGI25157J39369_1006344 | 3300002741 | Bacteria | 1810 |
| 27 | JGI25163J39215_1000711 | 3300002771 | Bacteria | 8660 |
| 28 | JGI25164J39214_1000113 | 3300002772 | Bacteria | 78046 |
| 29 | JGI25164J39214_1000216 | 3300002772 | Bacteria | 47222 |
| 30 | JGI25164J39214_1000366 | 3300002772 | Bacteria | 26967 |
| 31 | JGI25164J39214_1000931 | 3300002772 | Bacteria | 9574 |
| 32 | JGI25165J46597_1000058 | 3300003214 | Bacteria | 212833 |
| 33 | JGI25165J46597_1000158 | 3300003214 | Bacteria | 108257 |
| 34 | JGI25165J46597_1000405 | 3300003214 | Bacteria | 45672 |
| 35 | JGI25165J46597_1002857 | 3300003214 | Bacteria | 4937 |
| 36 | JGI25153J46596_10015617 | 3300003215 | Bacteria | 3083 |
| 37 | rootH1_10079021 | 3300003316 | Bacteria | 2610 |
| 38 | rootH2_10020728 | 3300003320 | Bacteria | 16631 |
| 39 | Ga0006562J51391_1025482 | 3300003578 | Bacteria | 5720 |
| 40 | Ga0006562J51391_1025483 | 3300003578 | Bacteria | 7220 |
| 41 | Ga0055538_1000519 | 3300003751 | Bacteria | 13752 |
| 42 | Ga0055533_1000980 | 3300003756 | Bacteria | 8350 |
| 43 | Ga0055527_1000066 | 3300003760 | Bacteria | 88276 |
| 44 | Ga0055527_1000092 | 3300003760 | Bacteria | 69389 |
| 45 | Ga0055527_1000340 | 3300003760 | Bacteria | 23889 |
| 46 | Ga0055535_1000034 | 3300003761 | Bacteria | 181954 |
| 47 | Ga0055535_1000058 | 3300003761 | Bacteria | 125370 |
| 48 | Ga0055535_1000149 | 3300003761 | Bacteria | 74091 |
| 49 | Ga0055535_1000424 | 3300003761 | Bacteria | 39544 |
| 50 | Ga0055542_1000081 | 3300003762 | Bacteria | 129595 |
| 51 | Ga0055542_1000085 | 3300003762 | Bacteria | 125370 |
| 52 | Ga0055542_1000112 | 3300003762 | Bacteria | 107429 |
| 53 | Ga0055542_1000134 | 3300003762 | Bacteria | 94890 |
| 54 | Ga0055542_1000250 | 3300003762 | Bacteria | 61397 |
| 55 | Ga0055542_1000503 | 3300003762 | Bacteria | 35709 |
| 56 | Ga0055529_1000083 | 3300003763 | Bacteria | 146729 |
| 57 | Ga0055529_1000107 | 3300003763 | Bacteria | 122905 |
| 58 | Ga0055529_1000173 | 3300003763 | Bacteria | 88663 |
| 59 | Ga0055529_1000830 | 3300003763 | Bacteria | 18257 |
| 60 | Ga0055529_1004448 | 3300003763 | Bacteria | 2130 |
| 61 | Ga0065165_1000157 | 3300005262 | Bacteria | 118005 |
| 62 | Ga0070658_10020024 | 3300005327 | Bacteria | 5359 |
| 63 | Ga0070676_10029931 | 3300005328 | Bacteria | 3100 |
| 64 | Ga0068869_100133004 | 3300005334 | Bacteria | 1914 |
| 65 | Ga0070666_10000005 | 3300005335 | Bacteria | 343092 |
| 66 | Ga0070680_100000962 | 3300005336 | Bacteria | 20385 |
| 67 | Ga0070680_100211347 | 3300005336 | Bacteria | 1637 |
| 68 | Ga0070682_100013674 | 3300005337 | Bacteria | 4676 |
| 69 | Ga0070682_100036100 | 3300005337 | Bacteria | 3020 |
| 70 | Ga0070682_100052640 | 3300005337 | Bacteria | 2548 |
| 71 | Ga0070682_100083093 | 3300005337 | Bacteria | 2077 |
| 72 | Ga0068868_100060198 | 3300005338 | Bacteria | 3006 |
| 73 | Ga0070660_100021136 | 3300005339 | Bacteria | 4795 |
| 74 | Ga0070660_100026970 | 3300005339 | Bacteria | 4282 |
| 75 | Ga0070660_100070386 | 3300005339 | Bacteria | 2730 |
| 76 | Ga0070689_100003960 | 3300005340 | Bacteria | 9945 |
| 77 | Ga0070691_10000750 | 3300005341 | Bacteria | 12791 |
| 78 | Ga0070661_100002828 | 3300005344 | Bacteria | 11929 |
| 79 | Ga0070661_100025681 | 3300005344 | Bacteria | 4235 |
| 80 | Ga0070661_100144397 | 3300005344 | Bacteria | 1795 |
| 81 | Ga0070692_10003484 | 3300005345 | Bacteria | 6385 |
| 82 | Ga0070692_10047255 | 3300005345 | Bacteria | 2227 |
| 83 | Ga0070668_100014597 | 3300005347 | Bacteria | 5872 |
| 84 | Ga0070675_100081524 | 3300005354 | Bacteria | 2698 |
| 85 | Ga0070659_100008670 | 3300005366 | Bacteria | 7436 |
| 86 | Ga0070659_100106952 | 3300005366 | Bacteria | 2255 |
| 87 | Ga0070659_100153987 | 3300005366 | Bacteria | 1876 |
| 88 | Ga0070714_100000079 | 3300005435 | Bacteria | 82899 |
| 89 | Ga0070714_100001985 | 3300005435 | Bacteria | 14951 |
| 90 | Ga0070714_100104506 | 3300005435 | Bacteria | 2499 |
| 91 | Ga0070711_100043758 | 3300005439 | Bacteria | 3035 |
| 92 | Ga0070711_100338174 | 3300005439 | Bacteria | 1207 |
| 93 | Ga0070663_100076485 | 3300005455 | Bacteria | 2448 |
| 94 | Ga0070662_100072022 | 3300005457 | Bacteria | 2550 |
| 95 | Ga0070681_10001678 | 3300005458 | Bacteria | 19781 |
| 96 | Ga0070681_10003236 | 3300005458 | Bacteria | 15189 |
| 97 | Ga0070681_10019170 | 3300005458 | Bacteria | 6846 |
| 98 | Ga0070681_10040729 | 3300005458 | Bacteria | 4654 |
| 99 | Ga0070681_10049674 | 3300005458 | Bacteria | 4188 |
| 100 | Ga0070681_10065542 | 3300005458 | Bacteria | 3600 |
| 101 | Ga0070681_10364768 | 3300005458 | Bacteria | 1355 |
| 102 | Ga0068867_100392717 | 3300005459 | Bacteria | 1168 |
| 103 | Ga0070685_10010099 | 3300005466 | Bacteria | 4897 |
| 104 | Ga0070679_100000544 | 3300005530 | Bacteria | 32045 |
| 105 | Ga0070679_100001710 | 3300005530 | Bacteria | 19781 |
| 106 | Ga0070679_100002570 | 3300005530 | Bacteria | 16476 |
| 107 | Ga0070679_100111886 | 3300005530 | Bacteria | 2716 |
| 108 | Ga0070679_100114322 | 3300005530 | Bacteria | 2684 |
| 109 | Ga0068853_100042501 | 3300005539 | Bacteria | 3886 |
| 110 | Ga0068853_100213545 | 3300005539 | Bacteria | 1759 |
| 111 | Ga0070672_100061062 | 3300005543 | Bacteria | 2970 |
| 112 | Ga0070696_100012517 | 3300005546 | Bacteria | 5694 |
| 113 | Ga0070696_100039428 | 3300005546 | Bacteria | 3261 |
| 114 | Ga0070693_100019676 | 3300005547 | Bacteria | 3545 |
| 115 | Ga0070665_100002911 | 3300005548 | Bacteria | 18499 |
| 116 | Ga0070665_100006594 | 3300005548 | Bacteria | 11798 |
| 117 | Ga0068855_100009625 | 3300005563 | Bacteria | 11657 |
| 118 | Ga0068855_100021410 | 3300005563 | Bacteria | 7753 |
| 119 | Ga0068855_100028046 | 3300005563 | Bacteria | 6734 |
| 120 | Ga0068855_100113488 | 3300005563 | Bacteria | 3108 |
| 121 | Ga0068855_100321170 | 3300005563 | Bacteria | 1711 |
| 122 | Ga0070664_100220520 | 3300005564 | Bacteria | 1697 |
| 123 | Ga0068857_100000573 | 3300005577 | Bacteria | 26921 |
| 124 | Ga0068857_100036303 | 3300005577 | Bacteria | 4368 |
| 125 | Ga0068857_100251419 | 3300005577 | Bacteria | 1620 |
| 126 | Ga0068854_100000455 | 3300005578 | Bacteria | 25249 |
| 127 | Ga0068854_100004459 | 3300005578 | Bacteria | 8831 |
| 128 | Ga0068854_100033157 | 3300005578 | Bacteria | 3599 |
| 129 | Ga0068854_100047091 | 3300005578 | Bacteria | 3072 |
| 130 | Ga0068854_100095115 | 3300005578 | Bacteria | 2223 |
| 131 | Ga0068856_100001826 | 3300005614 | Bacteria | 22258 |
| 132 | Ga0068856_100011459 | 3300005614 | Bacteria | 8605 |
| 133 | Ga0068852_100014031 | 3300005616 | Bacteria | 6149 |
| 134 | Ga0068852_100029880 | 3300005616 | Bacteria | 4480 |
| 135 | Ga0068852_100103311 | 3300005616 | Bacteria | 2577 |
| 136 | Ga0068852_100167194 | 3300005616 | Bacteria | 2058 |
| 137 | Ga0068852_100255423 | 3300005616 | Bacteria | 1681 |
| 138 | Ga0068851_10014337 | 3300005834 | Bacteria | 3763 |
| 139 | Ga0068858_100058951 | 3300005842 | Bacteria | 3548 |
| 140 | Ga0068860_100118857 | 3300005843 | Bacteria | 2530 |
| 141 | Ga0070712_100087436 | 3300006175 | Bacteria | 2274 |
| 142 | Ga0105240_10000298 | 3300009093 | Bacteria | 96724 |
| 143 | Ga0105240_10001857 | 3300009093 | Bacteria | 35309 |
| 144 | Ga0105240_10008267 | 3300009093 | Bacteria | 14897 |
| 145 | Ga0105240_10033211 | 3300009093 | Bacteria | 6670 |
| 146 | Ga0105240_10104508 | 3300009093 | Bacteria | 3439 |
| 147 | Ga0105240_10156323 | 3300009093 | Bacteria | 2711 |
| 148 | Ga0105247_10003125 | 3300009101 | Bacteria | 10930 |
| 149 | Ga0105241_10011431 | 3300009174 | Bacteria | 6508 |
| 150 | Ga0105241_10044962 | 3300009174 | Bacteria | 3348 |
| 151 | Ga0105241_10155036 | 3300009174 | Bacteria | 1877 |
| 152 | Ga0105237_10000023 | 3300009545 | Bacteria | 226144 |
| 153 | Ga0105237_10132777 | 3300009545 | Bacteria | 2484 |
| 154 | Ga0105237_10394014 | 3300009545 | Bacteria | 1389 |
| 155 | Ga0105238_10000060 | 3300009551 | Bacteria | 129934 |
| 156 | Ga0105238_10014194 | 3300009551 | Bacteria | 8058 |
| 157 | Ga0105238_10016291 | 3300009551 | Bacteria | 7524 |
| 158 | Ga0105239_10000044 | 3300010375 | Bacteria | 187680 |
| 159 | Ga0105239_10021311 | 3300010375 | Bacteria | 7146 |
| 160 | Ga0105239_10025794 | 3300010375 | Bacteria | 6473 |
| 161 | Ga0105239_10029949 | 3300010375 | Bacteria | 5986 |
| 162 | Ga0105239_10040405 | 3300010375 | Bacteria | 5111 |
| 163 | Ga0105239_10046422 | 3300010375 | Bacteria | 4760 |
| 164 | Ga0105239_10223572 | 3300010375 | Bacteria | 2111 |
| 165 | Ga0157314_1000032 | 3300012500 | Bacteria | 13500 |
| 166 | Ga0157373_10025438 | 3300013100 | Bacteria | 4281 |
| 167 | Ga0157373_10081770 | 3300013100 | Bacteria | 2277 |
| 168 | Ga0157373_10085090 | 3300013100 | Bacteria | 2229 |
| 169 | Ga0157371_10015942 | 3300013102 | Bacteria | 5622 |
| 170 | Ga0157371_10076776 | 3300013102 | Bacteria | 2365 |
| 171 | Ga0157371_10128027 | 3300013102 | Bacteria | 1806 |
| 172 | Ga0157370_10000813 | 3300013104 | Bacteria | 39470 |
| 173 | Ga0157370_10003679 | 3300013104 | Bacteria | 17908 |
| 174 | Ga0157370_10005119 | 3300013104 | Bacteria | 14786 |
| 175 | Ga0157370_10009565 | 3300013104 | Bacteria | 10329 |
| 176 | Ga0157370_10015593 | 3300013104 | Bacteria | 7721 |
| 177 | Ga0157370_10018018 | 3300013104 | Bacteria | 7108 |
| 178 | Ga0157370_10105705 | 3300013104 | Bacteria | 2635 |
| 179 | Ga0157370_10246668 | 3300013104 | Bacteria | 1652 |
| 180 | Ga0157370_10290728 | 3300013104 | Bacteria | 1509 |
| 181 | Ga0157369_10000028 | 3300013105 | Bacteria | 213910 |
| 182 | Ga0157369_10000080 | 3300013105 | Bacteria | 133011 |
| 183 | Ga0157369_10021166 | 3300013105 | Bacteria | 7271 |
| 184 | Ga0157369_10128534 | 3300013105 | Bacteria | 2686 |
| 185 | Ga0157369_10129308 | 3300013105 | Bacteria | 2677 |
| 186 | Ga0157374_10083523 | 3300013296 | Bacteria | 3034 |
| 187 | Ga0163162_10000060 | 3300013306 | Bacteria | 106982 |
| 188 | Ga0157372_10003349 | 3300013307 | Bacteria | 17301 |
| 189 | Ga0157372_10028027 | 3300013307 | Bacteria | 6143 |
| 190 | Ga0157372_10029412 | 3300013307 | Bacteria | 5998 |
| 191 | Ga0157372_10051236 | 3300013307 | Bacteria | 4594 |
| 192 | Ga0157380_10172436 | 3300014326 | Bacteria | 1892 |
| 193 | Ga0182008_10005463 | 3300014497 | Bacteria | 7237 |
| 194 | Ga0182008_10034216 | 3300014497 | Bacteria | 2548 |
| 195 | Ga0157376_10279957 | 3300014969 | Bacteria | 1570 |
| 196 | Ga0182006_1000140 | 3300015261 | Bacteria | 77650 |
| 197 | Ga0182006_1000222 | 3300015261 | Bacteria | 55421 |
| 198 | Ga0182007_10036061 | 3300015262 | Bacteria | 1665 |
| 199 | Ga0182007_10036761 | 3300015262 | Bacteria | 1646 |
| 200 | Ga0182005_1000028 | 3300015265 | Bacteria | 221889 |
| 201 | Ga0182005_1003015 | 3300015265 | Bacteria | 5821 |
| 202 | Ga0182005_1004381 | 3300015265 | Bacteria | 4575 |
| 203 | Ga0182005_1011020 | 3300015265 | Bacteria | 2587 |
| 204 | Ga0183369_1008 | 3300015685 | Bacteria | 346514 |
| 205 | Ga0183368_1003 | 3300015687 | Bacteria | 1276390 |
| 206 | Ga0163161_10001842 | 3300017792 | Bacteria | 15488 |
| 207 | Ga0197907_10018156 | 3300020069 | Bacteria | 1245 |
| 208 | Ga0206356_10117802 | 3300020070 | Bacteria | 11463 |
| 209 | Ga0206356_10611923 | 3300020070 | Bacteria | 4503 |
| 210 | Ga0206354_10508562 | 3300020081 | Bacteria | 3128 |
| 211 | Ga0206354_10839745 | 3300020081 | Bacteria | 4579 |
| 212 | Ga0206353_10202306 | 3300020082 | Bacteria | 4519 |
| 213 | Ga0154015_1117584 | 3300020610 | Bacteria | 5500 |
| 214 | Ga0209435_101622 | 3300025206 | Bacteria | 2768 |
| 215 | Ga0209760_100241 | 3300025207 | Bacteria | 22788 |
| 216 | Ga0209784_100016 | 3300025224 | Bacteria | 481036 |
| 217 | Ga0209566_101596 | 3300025225 | Bacteria | 5993 |
| 218 | Ga0209674_100012 | 3300025226 | Bacteria | 950162 |
| 219 | Ga0209674_100141 | 3300025226 | Bacteria | 108978 |
| 220 | Ga0209674_101045 | 3300025226 | Bacteria | 8400 |
| 221 | Ga0209674_101076 | 3300025226 | Bacteria | 8165 |
| 222 | Ga0209672_100007 | 3300025228 | Bacteria | 959482 |
| 223 | Ga0209672_100018 | 3300025228 | Bacteria | 432924 |
| 224 | Ga0209672_100161 | 3300025228 | Bacteria | 57457 |
| 225 | Ga0209672_100446 | 3300025228 | Bacteria | 23350 |
| 226 | Ga0209672_102265 | 3300025228 | Bacteria | 4953 |
| 227 | Ga0209563_100071 | 3300025230 | Bacteria | 232653 |
| 228 | Ga0207427_100019 | 3300025231 | Bacteria | 513977 |
| 229 | Ga0207427_100036 | 3300025231 | Bacteria | 309540 |
| 230 | Ga0207427_100050 | 3300025231 | Bacteria | 227233 |
| 231 | Ga0207427_100123 | 3300025231 | Bacteria | 98859 |
| 232 | Ga0207427_101984 | 3300025231 | Bacteria | 6231 |
| 233 | Ga0209437_100012 | 3300025233 | Bacteria | 792625 |
| 234 | Ga0209437_100120 | 3300025233 | Bacteria | 205054 |
| 235 | Ga0209437_100127 | 3300025233 | Bacteria | 190741 |
| 236 | Ga0209437_100227 | 3300025233 | Bacteria | 98939 |
| 237 | Ga0209437_100289 | 3300025233 | Bacteria | 73049 |
| 238 | Ga0209437_102524 | 3300025233 | Bacteria | 3524 |
| 239 | Ga0209258_100017 | 3300025242 | Bacteria | 590785 |
| 240 | Ga0209258_100024 | 3300025242 | Bacteria | 542096 |
| 241 | Ga0209258_100035 | 3300025242 | Bacteria | 430864 |
| 242 | Ga0209258_100039 | 3300025242 | Bacteria | 386366 |
| 243 | Ga0209258_100256 | 3300025242 | Bacteria | 93548 |
| 244 | Ga0209258_100308 | 3300025242 | Bacteria | 77195 |
| 245 | Ga0209646_1000426 | 3300025246 | Bacteria | 23498 |
| 246 | Ga0209646_1001098 | 3300025246 | Bacteria | 8038 |
| 247 | Ga0209646_1007686 | 3300025246 | Bacteria | 1750 |
| 248 | Ga0209026_1000012 | 3300025250 | Bacteria | 480426 |
| 249 | Ga0209026_1000281 | 3300025250 | Bacteria | 58797 |
| 250 | Ga0209026_1000370 | 3300025250 | Bacteria | 41493 |
| 251 | Ga0209026_1000594 | 3300025250 | Bacteria | 23615 |
| 252 | Ga0209026_1001678 | 3300025250 | Bacteria | 9299 |
| 253 | Ga0209026_1002746 | 3300025250 | Bacteria | 6297 |
| 254 | Ga0209026_1008071 | 3300025250 | Bacteria | 2255 |
| 255 | Ga0209148_1000001 | 3300025254 | Bacteria | 2545271 |
| 256 | Ga0209148_1000005 | 3300025254 | Bacteria | 1806504 |
| 257 | Ga0209148_1000009 | 3300025254 | Bacteria | 1395625 |
| 258 | Ga0209148_1000045 | 3300025254 | Bacteria | 448076 |
| 259 | Ga0209148_1000048 | 3300025254 | Bacteria | 430913 |
| 260 | Ga0209148_1000084 | 3300025254 | Bacteria | 268147 |
| 261 | Ga0209148_1001279 | 3300025254 | Bacteria | 13736 |
| 262 | Ga0209759_1000450 | 3300025256 | Bacteria | 47646 |
| 263 | Ga0209759_1000616 | 3300025256 | Bacteria | 34040 |
| 264 | Ga0209759_1001730 | 3300025256 | Bacteria | 11243 |
| 265 | Ga0209759_1003861 | 3300025256 | Bacteria | 5801 |
| 266 | Ga0209759_1004008 | 3300025256 | Bacteria | 5644 |
| 267 | Ga0209759_1004592 | 3300025256 | Bacteria | 5090 |
| 268 | Ga0209129_1001077 | 3300025258 | Bacteria | 16093 |
| 269 | Ga0209129_1002771 | 3300025258 | Bacteria | 8166 |
| 270 | Ga0209233_1000002 | 3300025261 | Bacteria | 2501366 |
| 271 | Ga0209233_1000101 | 3300025261 | Bacteria | 286063 |
| 272 | Ga0209233_1000174 | 3300025261 | Bacteria | 144639 |
| 273 | Ga0209233_1000283 | 3300025261 | Bacteria | 70137 |
| 274 | Ga0209233_1013154 | 3300025261 | Bacteria | 2369 |
| 275 | Ga0209455_1000010 | 3300025272 | Bacteria | 959482 |
| 276 | Ga0209455_1000029 | 3300025272 | Bacteria | 542096 |
| 277 | Ga0209455_1000035 | 3300025272 | Bacteria | 479071 |
| 278 | Ga0209455_1000039 | 3300025272 | Bacteria | 437734 |
| 279 | Ga0209455_1000465 | 3300025272 | Bacteria | 30599 |
| 280 | Ga0209455_1003533 | 3300025272 | Bacteria | 5487 |
| 281 | Ga0209455_1007348 | 3300025272 | Bacteria | 3122 |
| 282 | Ga0209758_1001696 | 3300025297 | Bacteria | 24789 |
| 283 | Ga0207680_10000002 | 3300025903 | Bacteria | 1018646 |
| 284 | Ga0207647_10000099 | 3300025904 | Bacteria | 66290 |
| 285 | Ga0207647_10000508 | 3300025904 | Bacteria | 31144 |
| 286 | Ga0207647_10008285 | 3300025904 | Bacteria | 7461 |
| 287 | Ga0207647_10010351 | 3300025904 | Bacteria | 6585 |
| 288 | Ga0207647_10076669 | 3300025904 | Bacteria | 2011 |
| 289 | Ga0207647_10123863 | 3300025904 | Bacteria | 1523 |
| 290 | Ga0207647_10131835 | 3300025904 | Bacteria | 1468 |
| 291 | Ga0207645_10008451 | 3300025907 | Bacteria | 7181 |
| 292 | Ga0207705_10000177 | 3300025909 | Bacteria | 67227 |
| 293 | Ga0207705_10001625 | 3300025909 | Bacteria | 17827 |
| 294 | Ga0207705_10001831 | 3300025909 | Bacteria | 16737 |
| 295 | Ga0207705_10015872 | 3300025909 | Bacteria | 5408 |
| 296 | Ga0207705_10174247 | 3300025909 | Bacteria | 1621 |
| 297 | Ga0207705_10249795 | 3300025909 | Bacteria | 1353 |
| 298 | Ga0207654_10016196 | 3300025911 | Bacteria | 3879 |
| 299 | Ga0207707_10000057 | 3300025912 | Bacteria | 113186 |
| 300 | Ga0207707_10000175 | 3300025912 | Bacteria | 66455 |
| 301 | Ga0207707_10000349 | 3300025912 | Bacteria | 48530 |
| 302 | Ga0207707_10002782 | 3300025912 | Bacteria | 15602 |
| 303 | Ga0207707_10004791 | 3300025912 | Bacteria | 11869 |
| 304 | Ga0207707_10009108 | 3300025912 | Bacteria | 8624 |
| 305 | Ga0207707_10013431 | 3300025912 | Bacteria | 7138 |
| 306 | Ga0207695_10000294 | 3300025913 | Bacteria | 123676 |
| 307 | Ga0207695_10001363 | 3300025913 | Bacteria | 41421 |
| 308 | Ga0207695_10001492 | 3300025913 | Bacteria | 39028 |
| 309 | Ga0207695_10004050 | 3300025913 | Bacteria | 20151 |
| 310 | Ga0207695_10005500 | 3300025913 | Bacteria | 16770 |
| 311 | Ga0207695_10009944 | 3300025913 | Bacteria | 11691 |
| 312 | Ga0207695_10024639 | 3300025913 | Bacteria | 6759 |
| 313 | Ga0207695_10033006 | 3300025913 | Bacteria | 5656 |
| 314 | Ga0207695_10038003 | 3300025913 | Bacteria | 5190 |
| 315 | Ga0207695_10064214 | 3300025913 | Bacteria | 3781 |
| 316 | Ga0207671_10000020 | 3300025914 | Bacteria | 309636 |
| 317 | Ga0207671_10000033 | 3300025914 | Bacteria | 245869 |
| 318 | Ga0207671_10000374 | 3300025914 | Bacteria | 63535 |
| 319 | Ga0207671_10004418 | 3300025914 | Bacteria | 13469 |
| 320 | Ga0207693_10109038 | 3300025915 | Bacteria | 2172 |
| 321 | Ga0207663_10066747 | 3300025916 | Bacteria | 2304 |
| 322 | Ga0207660_10000836 | 3300025917 | Bacteria | 20276 |
| 323 | Ga0207660_10001207 | 3300025917 | Bacteria | 17303 |
| 324 | Ga0207660_10001350 | 3300025917 | Bacteria | 16443 |
| 325 | Ga0207660_10004194 | 3300025917 | Bacteria | 9380 |
| 326 | Ga0207660_10006503 | 3300025917 | Bacteria | 7583 |
| 327 | Ga0207660_10100704 | 3300025917 | Bacteria | 2158 |
| 328 | Ga0207660_10148984 | 3300025917 | Bacteria | 1796 |
| 329 | Ga0207657_10007838 | 3300025919 | Bacteria | 10897 |
| 330 | Ga0207657_10063806 | 3300025919 | Bacteria | 3147 |
| 331 | Ga0207657_10076899 | 3300025919 | Bacteria | 2815 |
| 332 | Ga0207657_10081366 | 3300025919 | Bacteria | 2721 |
| 333 | Ga0207649_10035698 | 3300025920 | Bacteria | 2989 |
| 334 | Ga0207649_10057799 | 3300025920 | Bacteria | 2426 |
| 335 | Ga0207649_10123433 | 3300025920 | Bacteria | 1749 |
| 336 | Ga0207652_10000135 | 3300025921 | Bacteria | 78257 |
| 337 | Ga0207652_10000433 | 3300025921 | Bacteria | 43405 |
| 338 | Ga0207652_10002130 | 3300025921 | Bacteria | 16981 |
| 339 | Ga0207652_10021550 | 3300025921 | Bacteria | 5318 |
| 340 | Ga0207652_10022180 | 3300025921 | Bacteria | 5248 |
| 341 | Ga0207652_10226015 | 3300025921 | Bacteria | 1687 |
| 342 | Ga0207694_10000401 | 3300025924 | Bacteria | 40347 |
| 343 | Ga0207694_10074539 | 3300025924 | Bacteria | 2656 |
| 344 | Ga0207694_10146502 | 3300025924 | Bacteria | 1901 |
| 345 | Ga0207700_10016919 | 3300025928 | Bacteria | 4856 |
| 346 | Ga0207664_10000036 | 3300025929 | Bacteria | 173396 |
| 347 | Ga0207664_10000858 | 3300025929 | Bacteria | 20574 |
| 348 | Ga0207690_10005624 | 3300025932 | Bacteria | 7407 |
| 349 | Ga0207690_10014477 | 3300025932 | Bacteria | 4764 |
| 350 | Ga0207690_10015534 | 3300025932 | Bacteria | 4615 |
| 351 | Ga0207690_10031465 | 3300025932 | Bacteria | 3395 |
| 352 | Ga0207690_10055295 | 3300025932 | Bacteria | 2672 |
| 353 | Ga0207706_10015842 | 3300025933 | Bacteria | 6817 |
| 354 | Ga0207706_10060077 | 3300025933 | Bacteria | 3348 |
| 355 | Ga0207706_10175507 | 3300025933 | Bacteria | 1882 |
| 356 | Ga0207670_10001638 | 3300025936 | Bacteria | 11687 |
| 357 | Ga0207691_10078303 | 3300025940 | Bacteria | 2976 |
| 358 | Ga0207711_10357794 | 3300025941 | Bacteria | 1352 |
| 359 | Ga0207689_10103565 | 3300025942 | Bacteria | 2338 |
| 360 | Ga0207661_10001782 | 3300025944 | Bacteria | 14719 |
| 361 | Ga0207661_10032861 | 3300025944 | Bacteria | 4023 |
| 362 | Ga0207679_10173327 | 3300025945 | Bacteria | 1778 |
| 363 | Ga0207679_10195374 | 3300025945 | Bacteria | 1686 |
| 364 | Ga0207667_10000094 | 3300025949 | Bacteria | 145771 |
| 365 | Ga0207667_10000238 | 3300025949 | Bacteria | 76840 |
| 366 | Ga0207667_10000715 | 3300025949 | Bacteria | 43073 |
| 367 | Ga0207667_10001738 | 3300025949 | Bacteria | 27400 |
| 368 | Ga0207667_10005232 | 3300025949 | Bacteria | 15828 |
| 369 | Ga0207667_10014090 | 3300025949 | Bacteria | 9128 |
| 370 | Ga0207667_10037122 | 3300025949 | Bacteria | 5211 |
| 371 | Ga0207667_10126925 | 3300025949 | Bacteria | 2628 |
| 372 | Ga0207668_10102234 | 3300025972 | Bacteria | 2132 |
| 373 | Ga0207640_10000043 | 3300025981 | Bacteria | 102669 |
| 374 | Ga0207640_10000277 | 3300025981 | Bacteria | 34453 |
| 375 | Ga0207640_10008705 | 3300025981 | Bacteria | 5645 |
| 376 | Ga0207640_10010637 | 3300025981 | Bacteria | 5189 |
| 377 | Ga0207640_10032779 | 3300025981 | Bacteria | 3224 |
| 378 | Ga0207640_10041767 | 3300025981 | Bacteria | 2919 |
| 379 | Ga0207640_10092929 | 3300025981 | Bacteria | 2094 |
| 380 | Ga0207703_10072134 | 3300026035 | Bacteria | 2854 |
| 381 | Ga0207639_10000896 | 3300026041 | Bacteria | 20197 |
| 382 | Ga0207639_10028522 | 3300026041 | Bacteria | 4076 |
| 383 | Ga0207639_10058456 | 3300026041 | Bacteria | 2966 |
| 384 | Ga0207639_10064337 | 3300026041 | Bacteria | 2843 |
| 385 | Ga0207678_10003994 | 3300026067 | Bacteria | 13273 |
| 386 | Ga0207678_10005247 | 3300026067 | Bacteria | 11604 |
| 387 | Ga0207678_10037497 | 3300026067 | Bacteria | 4215 |
| 388 | Ga0207678_10060292 | 3300026067 | Bacteria | 3263 |
| 389 | Ga0207678_10252592 | 3300026067 | Bacteria | 1510 |
| 390 | Ga0207702_10000167 | 3300026078 | Bacteria | 78662 |
| 391 | Ga0207702_10003104 | 3300026078 | Bacteria | 15406 |
| 392 | Ga0207702_10023241 | 3300026078 | Bacteria | 5141 |
| 393 | Ga0207702_10216431 | 3300026078 | Bacteria | 1783 |
| 394 | Ga0207702_10312871 | 3300026078 | Bacteria | 1493 |
| 395 | Ga0207674_10000074 | 3300026116 | Bacteria | 105369 |
| 396 | Ga0207674_10005145 | 3300026116 | Bacteria | 15602 |
| 397 | Ga0207674_10010110 | 3300026116 | Bacteria | 10726 |
| 398 | Ga0207674_10047914 | 3300026116 | Bacteria | 4378 |
| 399 | Ga0207698_10008359 | 3300026142 | Bacteria | 6541 |
| 400 | Ga0207698_10013399 | 3300026142 | Bacteria | 5408 |
| 401 | Ga0207698_10023562 | 3300026142 | Bacteria | 4302 |
| 402 | Ga0207698_10083089 | 3300026142 | Bacteria | 2591 |
| 403 | Ga0207698_10213689 | 3300026142 | Bacteria | 1737 |
| 404 | Ga0209974_10016508 | 3300027876 | Bacteria | 2452 |
| 405 | Ga0268266_10000004 | 3300028379 | Bacteria | 1495817 |
| 406 | Ga0268265_10104729 | 3300028380 | Bacteria | 2294 |
| 407 | Ga0268264_10099024 | 3300028381 | Bacteria | 2530 |
| 408 | Ga0316575_10021316 | 3300031665 | Bacteria | 2493 |
| 409 | Ga0307412_10001235 | 3300031911 | Bacteria | 14469 |
| 410 | Ga0307510_10018989 | 3300033180 | Bacteria | 8066 |
| 411 | Ga0307510_10026445 | 3300033180 | Bacteria | 6670 |
| 412 | Ga0395899_0000119 | 3300037312 | Bacteria | 127184 |
| 413 | Ga0395899_0026995 | 3300037312 | Bacteria | 4331 |
| 414 | Ga0395899_0059325 | 3300037312 | Bacteria | 2820 |
| 415 | Ga0395899_0064622 | 3300037312 | Bacteria | 2690 |
| 416 | Ga0395899_0102191 | 3300037312 | Bacteria | 2068 |
| 417 | Ga0395899_0108314 | 3300037312 | Bacteria | 1999 |
| 418 | Ga0395900_0000333 | 3300037418 | Bacteria | 69342 |
| 419 | Ga0395900_0029174 | 3300037418 | Bacteria | 5658 |
| 420 | Ga0395900_0173886 | 3300037418 | Bacteria | 2191 |
| 421 | Ga0395900_0303022 | 3300037418 | Bacteria | 1583 |
| 422 | Ga0395898_0000078 | 3300037466 | Bacteria | 244514 |
| 423 | Ga0395898_0000211 | 3300037466 | Bacteria | 149301 |
| 424 | Ga0395898_0059229 | 3300037466 | Bacteria | 3726 |
| 425 | Ga0395898_0109761 | 3300037466 | Bacteria | 2644 |
| 426 | Ga0395898_0274355 | 3300037466 | Bacteria | 1608 |
| 427 | Ga0395905_0271372 | 3300037471 | Bacteria | 1582 |
| 428 | Ga0395901_0003349 | 3300038443 | Bacteria | 16152 |
| 429 | Ga0395901_0015121 | 3300038443 | Bacteria | 7848 |
| 430 | Ga0395901_0040362 | 3300038443 | Bacteria | 4833 |
| 431 | Ga0395901_0073213 | 3300038443 | Bacteria | 3572 |
| 432 | Ga0395901_0153632 | 3300038443 | Bacteria | 2417 |
| 433 | Ga0436365_0822627 | 3300039437 | Bacteria | 2088 |
| 434 | Ga0439436_0000011 | 3300041404 | Bacteria | 100668 |
| 435 | Ga0439465_0003294 | 3300041413 | Bacteria | 5275 |
| 436 | Ga0451793_1639987 | 3300041452 | Bacteria | 4526 |
| 437 | Ga0451807_0380006 | 3300041486 | Bacteria | 1796 |
| 438 | Ga0451807_1531267 | 3300041486 | Bacteria | 2332 |
| 439 | Ga0451837_0923555 | 3300041494 | Bacteria | 3599 |
| 440 | Ga0450908_000023 | 3300042184 | Bacteria | 36671 |
| 441 | Ga0439459_0008053 | 3300042438 | Bacteria | 1792 |
| 442 | Ga0451577_0173121 | 3300042876 | Bacteria | 1945 |
| 443 | Ga0466982_0000009 | 3300044672 | Bacteria | 221166 |
| 444 | Ga0466982_0000036 | 3300044672 | Bacteria | 43109 |
| 445 | Ga0466965_0015843 | 3300044683 | Bacteria | 3581 |
| 446 | Ga0466966_0038369 | 3300044684 | Bacteria | 3087 |
| 447 | Ga0466961_0001124 | 3300044693 | Bacteria | 16407 |
| 448 | Ga0466961_0002245 | 3300044693 | Bacteria | 12024 |
| 449 | Ga0466961_0003441 | 3300044693 | Bacteria | 9872 |
| 450 | Ga0466961_0097413 | 3300044693 | Bacteria | 1854 |
| 451 | Ga0466961_0100959 | 3300044693 | Bacteria | 1817 |
| 452 | Ga0453684_0064854 | 3300044712 | Bacteria | 4661 |
| 453 | Ga0453684_0079373 | 3300044712 | Bacteria | 4103 |
| 454 | Ga0466968_0000703 | 3300044735 | Bacteria | 11544 |
| 455 | Ga0466957_0011086 | 3300044842 | Bacteria | 5189 |
| 456 | Ga0466957_0011406 | 3300044842 | Bacteria | 5127 |
| 457 | Ga0466957_0011738 | 3300044842 | Bacteria | 5063 |
| 458 | Ga0466960_0007138 | 3300044901 | Bacteria | 4520 |
| 459 | Ga0466959_0000007 | 3300045049 | Bacteria | 184664 |
| 460 | Ga0466959_0012370 | 3300045049 | Bacteria | 6164 |
| 461 | Ga0466959_0089661 | 3300045049 | Bacteria | 2209 |
| 462 | Ga0466958_0033562 | 3300045836 | Bacteria | 3058 |
| 463 | Ga0466967_0100901 | 3300045976 | Bacteria | 2637 |
| 464 | Ga0495617_000077 | 3300046452 | Bacteria | 77203 |
| 465 | Ga0495638_0000007 | 3300046460 | Bacteria | 602783 |
| 466 | Ga0495638_0000078 | 3300046460 | Bacteria | 157545 |
| 467 | Ga0495638_0000159 | 3300046460 | Bacteria | 106490 |
| 468 | Ga0495638_0000161 | 3300046460 | Bacteria | 104406 |
| 469 | Ga0495650_0000197 | 3300046471 | Bacteria | 131300 |
| 470 | Ga0495650_0000686 | 3300046471 | Bacteria | 43752 |
| 471 | Ga0495650_0000984 | 3300046471 | Bacteria | 32560 |
| 472 | Ga0495650_0045039 | 3300046471 | Bacteria | 1860 |
| 473 | Ga0495585_0000080 | 3300046492 | Bacteria | 99617 |
| 474 | Ga0495585_0001139 | 3300046492 | Bacteria | 21767 |
| 475 | Ga0495607_0000144 | 3300046501 | Bacteria | 74813 |
| 476 | Ga0495607_0000954 | 3300046501 | Bacteria | 26747 |
| 477 | Ga0495606_0000227 | 3300046507 | Bacteria | 99782 |
| 478 | Ga0495606_0000340 | 3300046507 | Bacteria | 80328 |
| 479 | Ga0495606_0001905 | 3300046507 | Bacteria | 25977 |
| 480 | Ga0495606_0011714 | 3300046507 | Bacteria | 7116 |
| 481 | Ga0495606_0200041 | 3300046507 | Bacteria | 1139 |
| 482 | Ga0495610_0001128 | 3300046512 | Bacteria | 24366 |
| 483 | Ga0495616_0000036 | 3300046513 | Bacteria | 128264 |
| 484 | Ga0495620_0000164 | 3300046515 | Bacteria | 52861 |
| 485 | Ga0495620_0002441 | 3300046515 | Bacteria | 10767 |
| 486 | Ga0495631_0000017 | 3300046518 | Bacteria | 98047 |
| 487 | Ga0495631_0001882 | 3300046518 | Bacteria | 12374 |
| 488 | Ga0495632_0000004 | 3300046519 | Bacteria | 381372 |
| 489 | Ga0495632_0000786 | 3300046519 | Bacteria | 28264 |
| 490 | Ga0495632_0012006 | 3300046519 | Bacteria | 5018 |
| 491 | Ga0495648_0001369 | 3300046524 | Bacteria | 24049 |
| 492 | Ga0495648_0005091 | 3300046524 | Bacteria | 11030 |
| 493 | Ga0495668_0014064 | 3300046616 | Bacteria | 4702 |
| 494 | Ga0495668_0101678 | 3300046616 | Bacteria | 1572 |
| 495 | Ga0495611_0000001 | 3300046648 | Bacteria | 2628469 |
| 496 | Ga0495611_0000022 | 3300046648 | Bacteria | 122452 |
| 497 | Ga0495625_0000347 | 3300046660 | Bacteria | 70714 |
| 498 | Ga0495625_0002925 | 3300046660 | Bacteria | 17828 |
| 499 | Ga0495661_0000657 | 3300046665 | Bacteria | 34630 |
| 500 | Ga0495661_0145488 | 3300046665 | Bacteria | 1285 |
| 501 | Ga0495588_0084149 | 3300046674 | Bacteria | 1662 |
| 502 | Ga0495670_0008759 | 3300046691 | Bacteria | 4979 |
| 503 | Ga0495671_0000240 | 3300046692 | Bacteria | 47354 |
| 504 | Ga0495649_0010282 | 3300046694 | Bacteria | 5525 |
| 505 | Ga0495649_0011052 | 3300046694 | Bacteria | 5318 |
| 506 | Ga0495589_0000053 | 3300046794 | Bacteria | 111458 |
| 507 | Ga0495660_0000094 | 3300046810 | Bacteria | 94870 |
| 508 | Ga0495660_0000233 | 3300046810 | Bacteria | 54493 |
| 509 | Ga0495683_0001315 | 3300047323 | Bacteria | 16676 |
| 510 | Ga0495679_000004 | 3300047446 | Bacteria | 748056 |
| 511 | Ga0495673_0000004 | 3300047469 | Bacteria | 1354526 |
| 512 | Ga0495673_0000048 | 3300047469 | Bacteria | 265950 |
| 513 | Ga0495673_0000644 | 3300047469 | Bacteria | 34268 |
| 514 | Ga0495673_0104932 | 3300047469 | Bacteria | 1137 |
| 515 | Ga0495681_0043956 | 3300047470 | Bacteria | 2151 |
| 516 | Ga0495681_0111610 | 3300047470 | Bacteria | 1183 |
| 517 | Ga0495686_0000017 | 3300047472 | Bacteria | 435554 |
| 518 | Ga0495686_0000295 | 3300047472 | Bacteria | 86824 |
| 519 | Ga0495686_0087615 | 3300047472 | Bacteria | 1893 |
| 520 | Ga0495686_0120563 | 3300047472 | Bacteria | 1564 |
| 521 | Ga0496100_0005392 | 3300048903 | Bacteria | 6882 |
| 522 | Ga0496101_0004248 | 3300048904 | Bacteria | 8986 |
| 523 | Ga0496102_0163985 | 3300048905 | Bacteria | 2091 |
| 524 | Ga0496104_0032740 | 3300048907 | Bacteria | 4839 |
| 525 | Ga0496105_0002731 | 3300048908 | Bacteria | 12871 |
| 526 | Ga0496106_0005759 | 3300048909 | Bacteria | 9161 |
| 527 | Ga0496107_0020194 | 3300048910 | Bacteria | 4704 |
| 528 | Ga0496113_0018146 | 3300048916 | Bacteria | 4897 |
| 529 | Ga0496115_0000025 | 3300048918 | Bacteria | 151658 |
| 530 | Ga0496115_0000456 | 3300048918 | Bacteria | 32724 |
| 531 | Ga0496115_0016735 | 3300048918 | Bacteria | 5587 |
| 532 | Ga0496115_0017124 | 3300048918 | Bacteria | 5531 |
| 533 | Ga0496115_0023705 | 3300048918 | Bacteria | 4763 |
| 534 | Ga0496116_0093510 | 3300048919 | Bacteria | 1820 |
| 535 | Ga0496117_0004466 | 3300048920 | Bacteria | 15403 |
| 536 | Ga0496117_0011123 | 3300048920 | Bacteria | 8092 |
| 537 | Ga0496117_0024407 | 3300048920 | Bacteria | 4784 |
| 538 | Ga0496118_0000177 | 3300048921 | Bacteria | 114183 |
| 539 | Ga0496118_0000805 | 3300048921 | Bacteria | 50087 |
| 540 | Ga0496118_0001746 | 3300048921 | Bacteria | 31556 |
| 541 | Ga0496118_0002109 | 3300048921 | Bacteria | 27873 |
| 542 | Ga0496118_0023825 | 3300048921 | Bacteria | 5305 |
| 543 | Ga0496118_0079063 | 3300048921 | Bacteria | 2323 |
| 544 | Ga0496119_0000707 | 3300048922 | Bacteria | 44778 |
| 545 | Ga0496119_0019934 | 3300048922 | Bacteria | 4913 |
| 546 | Ga0496120_0000446 | 3300048923 | Bacteria | 65398 |
| 547 | Ga0496120_0001411 | 3300048923 | Bacteria | 29019 |
| 548 | Ga0496120_0068573 | 3300048923 | Bacteria | 1956 |
| 549 | Ga0496121_0000241 | 3300048924 | Bacteria | 117612 |
| 550 | Ga0496121_0000372 | 3300048924 | Bacteria | 92348 |
| 551 | Ga0496121_0002571 | 3300048924 | Bacteria | 27457 |
| 552 | Ga0496121_0005654 | 3300048924 | Bacteria | 15904 |
| 553 | Ga0496121_0027862 | 3300048924 | Bacteria | 5276 |
| 554 | Ga0496121_0028953 | 3300048924 | Bacteria | 5141 |
| 555 | Ga0496121_0068368 | 3300048924 | Bacteria | 2874 |
| 556 | Ga0496122_0013080 | 3300048925 | Bacteria | 8170 |
| 557 | Ga0496122_0055316 | 3300048925 | Bacteria | 2970 |
| 558 | Ga0496122_0109729 | 3300048925 | Bacteria | 1815 |
| 559 | Ga0496122_0139583 | 3300048925 | Bacteria | 1519 |
| 560 | Ga0496122_0140817 | 3300048925 | Bacteria | 1509 |
| 561 | Ga0496123_0008605 | 3300048926 | Bacteria | 9342 |
| 562 | Ga0496123_0022737 | 3300048926 | Bacteria | 4822 |
| 563 | Ga0496123_0088467 | 3300048926 | Bacteria | 1849 |
| 564 | Ga0496124_0008309 | 3300048927 | Bacteria | 10866 |
| 565 | Ga0496124_0008669 | 3300048927 | Bacteria | 10586 |
| 566 | Ga0496125_0000892 | 3300048928 | Bacteria | 47309 |
| 567 | Ga0496125_0005101 | 3300048928 | Bacteria | 14777 |
| 568 | Ga0496126_0000199 | 3300048929 | Bacteria | 133742 |
| 569 | Ga0496126_0000769 | 3300048929 | Bacteria | 57992 |
| 570 | Ga0496126_0021995 | 3300048929 | Bacteria | 6215 |
| 571 | Ga0496126_0025347 | 3300048929 | Bacteria | 5706 |
| 572 | Ga0496126_0035482 | 3300048929 | Bacteria | 4674 |
| 573 | Ga0496126_0043088 | 3300048929 | Bacteria | 4166 |
| 574 | Ga0496126_0139067 | 3300048929 | Bacteria | 2092 |
| 575 | Ga0495678_000276 | 3300049459 | Bacteria | 56670 |
| 576 | Ga0495682_0004711 | 3300049460 | Bacteria | 5770 |
| 577 | Ga0501031_0112889 | 3300049568 | Bacteria | 1775 |
| 578 | Ga0501032_0013648 | 3300049569 | Bacteria | 5771 |
| 579 | Ga0501033_0003142 | 3300049570 | Bacteria | 13728 |
| 580 | Ga0501033_0153123 | 3300049570 | Bacteria | 1662 |
| 581 | Ga0501034_0000462 | 3300049571 | Bacteria | 67291 |
| 582 | Ga0501034_0033101 | 3300049571 | Bacteria | 5248 |
| 583 | Ga0501034_0087735 | 3300049571 | Bacteria | 3110 |
| 584 | Ga0501034_0182660 | 3300049571 | Bacteria | 2062 |
| 585 | Ga0501034_0540514 | 3300049571 | Bacteria | 1075 |
| 586 | Ga0501036_0198790 | 3300049572 | Bacteria | 1686 |
| 587 | Ga0501037_0083137 | 3300049573 | Bacteria | 2319 |
| 588 | Ga0501037_0314216 | 3300049573 | Bacteria | 1086 |
| 589 | Ga0501038_0035121 | 3300049574 | Bacteria | 4403 |
| 590 | Ga0501039_0075591 | 3300049575 | Bacteria | 2618 |
| 591 | Ga0501043_0023760 | 3300049579 | Bacteria | 4808 |
| 592 | Ga0501043_0048461 | 3300049579 | Bacteria | 3340 |
| 593 | Ga0501043_0093824 | 3300049579 | Bacteria | 2359 |
| 594 | Ga0501043_0100992 | 3300049579 | Bacteria | 2267 |
| 595 | Ga0501043_0137019 | 3300049579 | Bacteria | 1917 |
| 596 | Ga0501043_0209253 | 3300049579 | Bacteria | 1512 |
| 597 | Ga0501046_0219429 | 3300049580 | Bacteria | 1408 |
| 598 | Ga0501047_0021876 | 3300049581 | Bacteria | 6140 |
| 599 | Ga0501047_0038226 | 3300049581 | Bacteria | 4643 |
| 600 | Ga0501047_0068553 | 3300049581 | Bacteria | 3416 |
| 601 | Ga0501047_0079729 | 3300049581 | Bacteria | 3148 |
| 602 | Ga0501047_0089672 | 3300049581 | Bacteria | 2952 |
| 603 | Ga0501047_0294352 | 3300049581 | Bacteria | 1466 |
| 604 | Ga0501048_0101764 | 3300049582 | Bacteria | 2027 |
| 605 | Ga0501048_0110770 | 3300049582 | Bacteria | 1938 |
| 606 | Ga0501048_0220704 | 3300049582 | Bacteria | 1344 |
| 607 | Ga0501048_0230711 | 3300049582 | Bacteria | 1313 |
| 608 | Ga0501068_0004463 | 3300049584 | Bacteria | 7613 |
| 609 | Ga0501069_0000202 | 3300049585 | Bacteria | 26292 |
| 610 | Ga0501069_0026292 | 3300049585 | Bacteria | 3187 |
| 611 | Ga0501070_0000062 | 3300049586 | Bacteria | 92290 |
| 612 | Ga0501070_0001521 | 3300049586 | Bacteria | 20654 |
| 613 | Ga0501070_0003611 | 3300049586 | Bacteria | 13360 |
| 614 | Ga0501070_0008534 | 3300049586 | Bacteria | 8664 |
| 615 | Ga0501070_0011198 | 3300049586 | Bacteria | 7571 |
| 616 | Ga0501070_0023671 | 3300049586 | Bacteria | 5146 |
| 617 | Ga0501070_0062978 | 3300049586 | Bacteria | 3072 |
| 618 | Ga0501073_0014451 | 3300049589 | Bacteria | 5736 |
| 619 | Ga0501073_0016155 | 3300049589 | Bacteria | 5410 |
| 620 | Ga0501073_0018129 | 3300049589 | Bacteria | 5089 |
| 621 | Ga0501073_0028815 | 3300049589 | Bacteria | 3968 |
| 622 | Ga0501073_0079902 | 3300049589 | Bacteria | 2276 |
| 623 | Ga0501073_0390464 | 3300049589 | Bacteria | 961 |
| 624 | Ga0501074_0001791 | 3300049590 | Bacteria | 14692 |
| 625 | Ga0501074_0003782 | 3300049590 | Bacteria | 10752 |
| 626 | Ga0501074_0005621 | 3300049590 | Bacteria | 9027 |
| 627 | Ga0501074_0014312 | 3300049590 | Bacteria | 5770 |
| 628 | Ga0501079_0064932 | 3300049741 | Bacteria | 2816 |
| 629 | Ga0501080_0001205 | 3300049742 | Bacteria | 21436 |
| 630 | Ga0501080_0017505 | 3300049742 | Bacteria | 6627 |
| 631 | Ga0501080_0107539 | 3300049742 | Bacteria | 2585 |
| 632 | Ga0501080_0202074 | 3300049742 | Bacteria | 1824 |
| 633 | Ga0501080_0272920 | 3300049742 | Bacteria | 1539 |
| 634 | Ga0501035_0013449 | 3300049822 | Bacteria | 7556 |
| 635 | Ga0501035_0020895 | 3300049822 | Bacteria | 6016 |
| 636 | Ga0501035_0039148 | 3300049822 | Bacteria | 4291 |
| 637 | Ga0501035_0076121 | 3300049822 | Bacteria | 2968 |
| 638 | Ga0501035_0196950 | 3300049822 | Bacteria | 1730 |
| 639 | Ga0501044_0016312 | 3300049823 | Bacteria | 7979 |
| 640 | Ga0501044_0027747 | 3300049823 | Bacteria | 5977 |
| 641 | Ga0501044_0035105 | 3300049823 | Bacteria | 5253 |
| 642 | Ga0501044_0042303 | 3300049823 | Bacteria | 4739 |
| 643 | Ga0501044_0052151 | 3300049823 | Bacteria | 4216 |
| 644 | Ga0501044_0053580 | 3300049823 | Bacteria | 4150 |
| 645 | Ga0501044_0102082 | 3300049823 | Bacteria | 2884 |
| 646 | Ga0501045_0176358 | 3300049824 | Bacteria | 1592 |
| 647 | Ga0500643_000020 | 3300053087 | Bacteria | 290328 |
| 648 | Ga0500651_0000201 | 3300053093 | Bacteria | 37864 |
| 649 | Ga0500555_000855 | 3300053103 | Bacteria | 10885 |
| 650 | Ga0500633_0005303 | 3300053160 | Bacteria | 3050 |
| 651 | Ga0500645_001658 | 3300053730 | Bacteria | 10941 |
| 652 | Ga0466962_0004485 | 3300061719 | Bacteria | 6692 |
| 653 | Ga0530510_0191094 | 3300061734 | Bacteria | 1520 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300037418 | Ga0395900_0303022 | Ga0395900_0303022_18_899 | 290 |
| 2 | 3300014326 | Ga0157380_10172436 | Ga0157380_101724362 | 299 |
| 3 | 3300049589 | Ga0501073_0390464 | Ga0501073_0390464_27_935 | 301 |
| 4 | 3300047470 | Ga0495681_0111610 | Ga0495681_0111610_14_994 | 320 |
| 5 | 3300044693 | Ga0466961_0100959 | Ga0466961_0100959_17_994 | 322 |
| 6 | 3300005563 | Ga0068855_100113488 | Ga0068855_1001134884 | 334 |
| 7 | iso_pu_bacteria | 2537561836 | 2538832874 | 335 |
| 8 | iso_pu_bacteria | 2643221577 | 2643895319 | 335 |
| 9 | iso_pu_bacteria | 2643221685 | 2644477489 | 335 |
| 10 | 3300002705 | JGI25156J39149_1012543 | JGI25156J39149_10125432 | 339 |
| 11 | 3300003763 | Ga0055529_1004448 | Ga0055529_10044482 | 339 |
| 12 | 3300005614 | Ga0068856_100011459 | Ga0068856_1000114596 | 339 |
| 13 | 3300013104 | Ga0157370_10105705 | Ga0157370_101057052 | 339 |
| 14 | 3300025250 | Ga0209026_1008071 | Ga0209026_10080712 | 339 |
| 15 | 3300025256 | Ga0209759_1004592 | Ga0209759_10045922 | 339 |
| 16 | 3300025272 | Ga0209455_1000465 | Ga0209455_100046525 | 339 |
| 17 | 3300026078 | Ga0207702_10000167 | Ga0207702_100001676 | 339 |
| 18 | 3300027876 | Ga0209974_10016508 | Ga0209974_100165084 | 339 |
| 19 | 3300049570 | Ga0501033_0153123 | Ga0501033_0153123_122_1147 | 339 |
| 20 | 3300049571 | Ga0501034_0540514 | Ga0501034_0540514_37_1062 | 339 |
| 21 | 3300049573 | Ga0501037_0314216 | Ga0501037_0314216_47_1072 | 339 |
| 22 | 3300049579 | Ga0501043_0093824 | Ga0501043_0093824_695_1720 | 339 |
| 23 | 3300049823 | Ga0501044_0016312 | Ga0501044_0016312_6851_7876 | 339 |
| 24 | 3300042876 | Ga0451577_0173121 | Ga0451577_0173121_817_1866 | 340 |
| 25 | 3300044712 | Ga0453684_0064854 | Ga0453684_0064854_585_1634 | 340 |
| 26 | 3300044712 | Ga0453684_0079373 | Ga0453684_0079373_359_1408 | 340 |
| 27 | iso_pu_bacteria | 2593339238 | 2595446898 | 342 |
| 28 | iso_pu_bacteria | 2593339239 | 2595449661 | 342 |
| 29 | iso_pu_bacteria | 2643221562 | 2643830732 | 342 |
| 30 | iso_pu_bacteria | 2687453130 | 2687582803 | 342 |
| 31 | iso_pu_bacteria | 2739367700 | 2739731782 | 342 |
| 32 | iso_pu_bacteria | 2842914999 | 2842917602 | 342 |
| 33 | iso_pu_bacteria | 2842918807 | 2842919976 | 342 |
| 34 | iso_pu_bacteria | 2884411467 | 2884415035 | 342 |
| 35 | iso_pu_bacteria | 2895395659 | 2895396732 | 342 |
| 36 | iso_pu_bacteria | 2919085039 | 2919088230 | 342 |
| 37 | iso_pu_bacteria | 2919404418 | 2919406179 | 342 |
| 38 | iso_pu_bacteria | 2928963466 | 2928967241 | 342 |
| 39 | iso_pu_bacteria | 2953994433 | 2953995268 | 342 |
| 40 | 3300049570 | Ga0501033_0003142 | Ga0501033_0003142_2352_3398 | 343 |
| 41 | 3300049574 | Ga0501038_0035121 | Ga0501038_0035121_37_1083 | 343 |
| 42 | 3300049581 | Ga0501047_0294352 | Ga0501047_0294352_38_1084 | 343 |
| 43 | 3300049582 | Ga0501048_0230711 | Ga0501048_0230711_236_1282 | 343 |
| 44 | 3300049823 | Ga0501044_0102082 | Ga0501044_0102082_977_2023 | 343 |
| 45 | iso_pu_bacteria | 2718218334 | 2721026422 | 343 |
| 46 | iso_pu_bacteria | 2734482264 | 2735833591 | 343 |
| 47 | iso_pu_bacteria | 2738543009 | 2739229709 | 343 |
| 48 | 3300001915 | JGI24741J21665_1000657 | JGI24741J21665_10006576 | 344 |
| 49 | 3300005336 | Ga0070680_100000962 | Ga0070680_10000096210 | 344 |
| 50 | 3300005337 | Ga0070682_100013674 | Ga0070682_1000136742 | 344 |
| 51 | 3300005341 | Ga0070691_10000750 | Ga0070691_1000075011 | 344 |
| 52 | 3300005344 | Ga0070661_100002828 | Ga0070661_10000282811 | 344 |
| 53 | 3300005344 | Ga0070661_100144397 | Ga0070661_1001443972 | 344 |
| 54 | 3300005345 | Ga0070692_10003484 | Ga0070692_100034847 | 344 |
| 55 | 3300005455 | Ga0070663_100076485 | Ga0070663_1000764852 | 344 |
| 56 | 3300005458 | Ga0070681_10003236 | Ga0070681_100032368 | 344 |
| 57 | 3300005458 | Ga0070681_10019170 | Ga0070681_100191702 | 344 |
| 58 | 3300005458 | Ga0070681_10364768 | Ga0070681_103647681 | 344 |
| 59 | 3300005530 | Ga0070679_100000544 | Ga0070679_1000005445 | 344 |
| 60 | 3300005530 | Ga0070679_100002570 | Ga0070679_1000025706 | 344 |
| 61 | 3300005539 | Ga0068853_100042501 | Ga0068853_1000425014 | 344 |
| 62 | 3300005547 | Ga0070693_100019676 | Ga0070693_1000196762 | 344 |
| 63 | 3300005563 | Ga0068855_100021410 | Ga0068855_1000214103 | 344 |
| 64 | 3300005563 | Ga0068855_100321170 | Ga0068855_1003211702 | 344 |
| 65 | 3300005578 | Ga0068854_100047091 | Ga0068854_1000470912 | 344 |
| 66 | 3300005616 | Ga0068852_100014031 | Ga0068852_1000140315 | 344 |
| 67 | 3300005616 | Ga0068852_100029880 | Ga0068852_1000298804 | 344 |
| 68 | 3300005616 | Ga0068852_100167194 | Ga0068852_1001671942 | 344 |
| 69 | 3300005616 | Ga0068852_100255423 | Ga0068852_1002554231 | 344 |
| 70 | 3300005834 | Ga0068851_10014337 | Ga0068851_100143373 | 344 |
| 71 | 3300009093 | Ga0105240_10104508 | Ga0105240_101045082 | 344 |
| 72 | 3300009093 | Ga0105240_10156323 | Ga0105240_101563234 | 344 |
| 73 | 3300009174 | Ga0105241_10011431 | Ga0105241_100114312 | 344 |
| 74 | 3300009174 | Ga0105241_10155036 | Ga0105241_101550361 | 344 |
| 75 | 3300009545 | Ga0105237_10132777 | Ga0105237_101327772 | 344 |
| 76 | 3300009551 | Ga0105238_10014194 | Ga0105238_100141944 | 344 |
| 77 | 3300009551 | Ga0105238_10016291 | Ga0105238_100162916 | 344 |
| 78 | 3300010375 | Ga0105239_10021311 | Ga0105239_100213114 | 344 |
| 79 | 3300013100 | Ga0157373_10085090 | Ga0157373_100850902 | 344 |
| 80 | 3300013104 | Ga0157370_10003679 | Ga0157370_100036796 | 344 |
| 81 | 3300013104 | Ga0157370_10015593 | Ga0157370_100155932 | 344 |
| 82 | 3300013104 | Ga0157370_10246668 | Ga0157370_102466682 | 344 |
| 83 | 3300013104 | Ga0157370_10290728 | Ga0157370_102907282 | 344 |
| 84 | 3300013105 | Ga0157369_10000028 | Ga0157369_10000028115 | 344 |
| 85 | 3300013105 | Ga0157369_10021166 | Ga0157369_100211663 | 344 |
| 86 | 3300013105 | Ga0157369_10129308 | Ga0157369_101293083 | 344 |
| 87 | 3300013307 | Ga0157372_10003349 | Ga0157372_100033494 | 344 |
| 88 | 3300013307 | Ga0157372_10051236 | Ga0157372_100512365 | 344 |
| 89 | 3300020070 | Ga0206356_10611923 | Ga0206356_106119232 | 344 |
| 90 | 3300020082 | Ga0206353_10202306 | Ga0206353_102023062 | 344 |
| 91 | 3300025904 | Ga0207647_10000508 | Ga0207647_1000050825 | 344 |
| 92 | 3300025909 | Ga0207705_10000177 | Ga0207705_1000017715 | 344 |
| 93 | 3300025909 | Ga0207705_10001625 | Ga0207705_100016257 | 344 |
| 94 | 3300025909 | Ga0207705_10249795 | Ga0207705_102497952 | 344 |
| 95 | 3300025911 | Ga0207654_10016196 | Ga0207654_100161962 | 344 |
| 96 | 3300025912 | Ga0207707_10000057 | Ga0207707_1000005742 | 344 |
| 97 | 3300025912 | Ga0207707_10000175 | Ga0207707_1000017512 | 344 |
| 98 | 3300025912 | Ga0207707_10002782 | Ga0207707_1000278211 | 344 |
| 99 | 3300025913 | Ga0207695_10001492 | Ga0207695_1000149214 | 344 |
| 100 | 3300025913 | Ga0207695_10004050 | Ga0207695_100040503 | 344 |
| 101 | 3300025913 | Ga0207695_10009944 | Ga0207695_100099443 | 344 |
| 102 | 3300025913 | Ga0207695_10038003 | Ga0207695_100380034 | 344 |
| 103 | 3300025914 | Ga0207671_10004418 | Ga0207671_1000441811 | 344 |
| 104 | 3300025917 | Ga0207660_10000836 | Ga0207660_1000083613 | 344 |
| 105 | 3300025917 | Ga0207660_10001207 | Ga0207660_1000120715 | 344 |
| 106 | 3300025917 | Ga0207660_10004194 | Ga0207660_100041945 | 344 |
| 107 | 3300025919 | Ga0207657_10007838 | Ga0207657_100078387 | 344 |
| 108 | 3300025920 | Ga0207649_10057799 | Ga0207649_100577992 | 344 |
| 109 | 3300025920 | Ga0207649_10123433 | Ga0207649_101234333 | 344 |
| 110 | 3300025921 | Ga0207652_10000135 | Ga0207652_1000013549 | 344 |
| 111 | 3300025921 | Ga0207652_10000433 | Ga0207652_100004335 | 344 |
| 112 | 3300025924 | Ga0207694_10074539 | Ga0207694_100745392 | 344 |
| 113 | 3300025932 | Ga0207690_10005624 | Ga0207690_100056248 | 344 |
| 114 | 3300025933 | Ga0207706_10015842 | Ga0207706_100158425 | 344 |
| 115 | 3300025944 | Ga0207661_10001782 | Ga0207661_100017828 | 344 |
| 116 | 3300025949 | Ga0207667_10000715 | Ga0207667_100007152 | 344 |
| 117 | 3300025949 | Ga0207667_10005232 | Ga0207667_100052325 | 344 |
| 118 | 3300025949 | Ga0207667_10014090 | Ga0207667_100140909 | 344 |
| 119 | 3300025949 | Ga0207667_10126925 | Ga0207667_101269252 | 344 |
| 120 | 3300025981 | Ga0207640_10008705 | Ga0207640_100087056 | 344 |
| 121 | 3300025981 | Ga0207640_10032779 | Ga0207640_100327791 | 344 |
| 122 | 3300025981 | Ga0207640_10092929 | Ga0207640_100929292 | 344 |
| 123 | 3300026041 | Ga0207639_10000896 | Ga0207639_100008966 | 344 |
| 124 | 3300026041 | Ga0207639_10028522 | Ga0207639_100285226 | 344 |
| 125 | 3300026041 | Ga0207639_10064337 | Ga0207639_100643373 | 344 |
| 126 | 3300026067 | Ga0207678_10003994 | Ga0207678_100039942 | 344 |
| 127 | 3300026067 | Ga0207678_10005247 | Ga0207678_100052477 | 344 |
| 128 | 3300026078 | Ga0207702_10216431 | Ga0207702_102164313 | 344 |
| 129 | 3300026078 | Ga0207702_10312871 | Ga0207702_103128712 | 344 |
| 130 | 3300026116 | Ga0207674_10005145 | Ga0207674_100051455 | 344 |
| 131 | 3300026142 | Ga0207698_10013399 | Ga0207698_100133995 | 344 |
| 132 | 3300026142 | Ga0207698_10023562 | Ga0207698_100235625 | 344 |
| 133 | 3300026142 | Ga0207698_10213689 | Ga0207698_102136892 | 344 |
| 134 | 3300037312 | Ga0395899_0026995 | Ga0395899_0026995_2662_3705 | 344 |
| 135 | 3300037312 | Ga0395899_0102191 | Ga0395899_0102191_143_1186 | 344 |
| 136 | 3300037418 | Ga0395900_0173886 | Ga0395900_0173886_598_1641 | 344 |
| 137 | 3300037466 | Ga0395898_0109761 | Ga0395898_0109761_1240_2283 | 344 |
| 138 | 3300037466 | Ga0395898_0274355 | Ga0395898_0274355_553_1596 | 344 |
| 139 | 3300038443 | Ga0395901_0040362 | Ga0395901_0040362_451_1494 | 344 |
| 140 | 3300041486 | Ga0451807_0380006 | Ga0451807_0380006_424_1464 | 344 |
| 141 | 3300041494 | Ga0451837_0923555 | Ga0451837_0923555_661_1701 | 344 |
| 142 | 3300042438 | Ga0439459_0008053 | Ga0439459_0008053_170_1213 | 344 |
| 143 | 3300048907 | Ga0496104_0032740 | Ga0496104_0032740_1759_2799 | 344 |
| 144 | 3300049579 | Ga0501043_0100992 | Ga0501043_0100992_320_1363 | 344 |
| 145 | 3300049580 | Ga0501046_0219429 | Ga0501046_0219429_100_1143 | 344 |
| 146 | 3300049581 | Ga0501047_0021876 | Ga0501047_0021876_4771_5814 | 344 |
| 147 | 3300049582 | Ga0501048_0101764 | Ga0501048_0101764_129_1163 | 344 |
| 148 | 3300049582 | Ga0501048_0220704 | Ga0501048_0220704_114_1157 | 344 |
| 149 | 3300049584 | Ga0501068_0004463 | Ga0501068_0004463_37_1080 | 344 |
| 150 | 3300049590 | Ga0501074_0003782 | Ga0501074_0003782_2208_3251 | 344 |
| 151 | 3300049742 | Ga0501080_0272920 | Ga0501080_0272920_130_1179 | 344 |
| 152 | 3300061734 | Ga0530510_0191094 | Ga0530510_0191094_61_1104 | 344 |
| 153 | iso_pu_bacteria | 2818991440 | 2819564051 | 344 |
| 154 | iso_pu_bacteria | 2884338543 | 2884341575 | 344 |
| 155 | iso_pu_bacteria | 2904463128 | 2904464687 | 344 |
| 156 | iso_pu_bacteria | 2941471342 | 2941473017 | 344 |
| 157 | 3300005328 | Ga0070676_10029931 | Ga0070676_100299312 | 345 |
| 158 | 3300005334 | Ga0068869_100133004 | Ga0068869_1001330042 | 345 |
| 159 | 3300005338 | Ga0068868_100060198 | Ga0068868_1000601982 | 345 |
| 160 | 3300005347 | Ga0070668_100014597 | Ga0070668_1000145975 | 345 |
| 161 | 3300005354 | Ga0070675_100081524 | Ga0070675_1000815243 | 345 |
| 162 | 3300005439 | Ga0070711_100043758 | Ga0070711_1000437584 | 345 |
| 163 | 3300005543 | Ga0070672_100061062 | Ga0070672_1000610622 | 345 |
| 164 | 3300005548 | Ga0070665_100006594 | Ga0070665_1000065947 | 345 |
| 165 | 3300010375 | Ga0105239_10223572 | Ga0105239_102235722 | 345 |
| 166 | 3300013102 | Ga0157371_10128027 | Ga0157371_101280272 | 345 |
| 167 | 3300013307 | Ga0157372_10029412 | Ga0157372_100294125 | 345 |
| 168 | 3300025907 | Ga0207645_10008451 | Ga0207645_100084514 | 345 |
| 169 | 3300025916 | Ga0207663_10066747 | Ga0207663_100667473 | 345 |
| 170 | 3300025933 | Ga0207706_10175507 | Ga0207706_101755072 | 345 |
| 171 | 3300025940 | Ga0207691_10078303 | Ga0207691_100783032 | 345 |
| 172 | 3300025941 | Ga0207711_10357794 | Ga0207711_103577941 | 345 |
| 173 | 3300025942 | Ga0207689_10103565 | Ga0207689_101035652 | 345 |
| 174 | 3300046460 | Ga0495638_0000007 | Ga0495638_0000007_74282_75328 | 345 |
| 175 | 3300049585 | Ga0501069_0000202 | Ga0501069_0000202_11983_13032 | 345 |
| 176 | 3300001915 | JGI24741J21665_1003851 | JGI24741J21665_10038514 | 346 |
| 177 | 3300001979 | JGI24740J21852_10006323 | JGI24740J21852_100063232 | 346 |
| 178 | 3300002067 | JGI24735J21928_10001618 | JGI24735J21928_100016182 | 346 |
| 179 | 3300002075 | JGI24738J21930_10000989 | JGI24738J21930_100009893 | 346 |
| 180 | 3300002705 | JGI25156J39149_1004866 | JGI25156J39149_10048662 | 346 |
| 181 | 3300002705 | JGI25156J39149_1010264 | JGI25156J39149_10102642 | 346 |
| 182 | 3300002705 | JGI25156J39149_1015099 | JGI25156J39149_10150992 | 346 |
| 183 | 3300002737 | JGI25162J39368_1000068 | JGI25162J39368_1000068123 | 346 |
| 184 | 3300002737 | JGI25162J39368_1000270 | JGI25162J39368_100027035 | 346 |
| 185 | 3300002737 | JGI25162J39368_1000991 | JGI25162J39368_10009912 | 346 |
| 186 | 3300002737 | JGI25162J39368_1002007 | JGI25162J39368_10020076 | 346 |
| 187 | 3300002741 | JGI25157J39369_1000068 | JGI25157J39369_1000068125 | 346 |
| 188 | 3300002741 | JGI25157J39369_1000333 | JGI25157J39369_10003335 | 346 |
| 189 | 3300002741 | JGI25157J39369_1004281 | JGI25157J39369_10042812 | 346 |
| 190 | 3300002741 | JGI25157J39369_1004468 | JGI25157J39369_10044682 | 346 |
| 191 | 3300002741 | JGI25157J39369_1006344 | JGI25157J39369_10063441 | 346 |
| 192 | 3300002771 | JGI25163J39215_1000711 | JGI25163J39215_10007114 | 346 |
| 193 | 3300002772 | JGI25164J39214_1000113 | JGI25164J39214_100011375 | 346 |
| 194 | 3300002772 | JGI25164J39214_1000216 | JGI25164J39214_10002165 | 346 |
| 195 | 3300002772 | JGI25164J39214_1000931 | JGI25164J39214_10009314 | 346 |
| 196 | 3300003214 | JGI25165J46597_1000058 | JGI25165J46597_100005834 | 346 |
| 197 | 3300003214 | JGI25165J46597_1000158 | JGI25165J46597_100015899 | 346 |
| 198 | 3300003214 | JGI25165J46597_1002857 | JGI25165J46597_10028574 | 346 |
| 199 | 3300003320 | rootH2_10020728 | rootH2_1002072811 | 346 |
| 200 | 3300003751 | Ga0055538_1000519 | Ga0055538_10005192 | 346 |
| 201 | 3300003756 | Ga0055533_1000980 | Ga0055533_10009804 | 346 |
| 202 | 3300003760 | Ga0055527_1000066 | Ga0055527_100006610 | 346 |
| 203 | 3300003760 | Ga0055527_1000092 | Ga0055527_100009215 | 346 |
| 204 | 3300003760 | Ga0055527_1000340 | Ga0055527_10003407 | 346 |
| 205 | 3300003761 | Ga0055535_1000034 | Ga0055535_1000034183 | 346 |
| 206 | 3300003761 | Ga0055535_1000058 | Ga0055535_100005880 | 346 |
| 207 | 3300003761 | Ga0055535_1000149 | Ga0055535_100014925 | 346 |
| 208 | 3300003761 | Ga0055535_1000424 | Ga0055535_100042420 | 346 |
| 209 | 3300003762 | Ga0055542_1000081 | Ga0055542_1000081124 | 346 |
| 210 | 3300003762 | Ga0055542_1000085 | Ga0055542_100008580 | 346 |
| 211 | 3300003762 | Ga0055542_1000112 | Ga0055542_100011252 | 346 |
| 212 | 3300003762 | Ga0055542_1000134 | Ga0055542_100013446 | 346 |
| 213 | 3300003762 | Ga0055542_1000250 | Ga0055542_100025016 | 346 |
| 214 | 3300003762 | Ga0055542_1000503 | Ga0055542_10005035 | 346 |
| 215 | 3300003763 | Ga0055529_1000083 | Ga0055529_100008334 | 346 |
| 216 | 3300003763 | Ga0055529_1000107 | Ga0055529_100010770 | 346 |
| 217 | 3300003763 | Ga0055529_1000173 | Ga0055529_100017325 | 346 |
| 218 | 3300003763 | Ga0055529_1000830 | Ga0055529_100083017 | 346 |
| 219 | 3300005262 | Ga0065165_1000157 | Ga0065165_100015752 | 346 |
| 220 | 3300005327 | Ga0070658_10020024 | Ga0070658_100200245 | 346 |
| 221 | 3300005335 | Ga0070666_10000005 | Ga0070666_10000005277 | 346 |
| 222 | 3300005337 | Ga0070682_100052640 | Ga0070682_1000526402 | 346 |
| 223 | 3300005337 | Ga0070682_100083093 | Ga0070682_1000830932 | 346 |
| 224 | 3300005340 | Ga0070689_100003960 | Ga0070689_1000039607 | 346 |
| 225 | 3300005366 | Ga0070659_100106952 | Ga0070659_1001069521 | 346 |
| 226 | 3300005435 | Ga0070714_100104506 | Ga0070714_1001045062 | 346 |
| 227 | 3300005439 | Ga0070711_100338174 | Ga0070711_1003381741 | 346 |
| 228 | 3300005458 | Ga0070681_10065542 | Ga0070681_100655423 | 346 |
| 229 | 3300005459 | Ga0068867_100392717 | Ga0068867_1003927171 | 346 |
| 230 | 3300005466 | Ga0070685_10010099 | Ga0070685_100100992 | 346 |
| 231 | 3300005548 | Ga0070665_100002911 | Ga0070665_10000291114 | 346 |
| 232 | 3300005577 | Ga0068857_100036303 | Ga0068857_1000363034 | 346 |
| 233 | 3300005577 | Ga0068857_100251419 | Ga0068857_1002514192 | 346 |
| 234 | 3300005578 | Ga0068854_100033157 | Ga0068854_1000331572 | 346 |
| 235 | 3300005578 | Ga0068854_100095115 | Ga0068854_1000951152 | 346 |
| 236 | 3300005614 | Ga0068856_100001826 | Ga0068856_1000018263 | 346 |
| 237 | 3300005843 | Ga0068860_100118857 | Ga0068860_1001188572 | 346 |
| 238 | 3300006175 | Ga0070712_100087436 | Ga0070712_1000874362 | 346 |
| 239 | 3300009093 | Ga0105240_10001857 | Ga0105240_1000185718 | 346 |
| 240 | 3300009174 | Ga0105241_10044962 | Ga0105241_100449624 | 346 |
| 241 | 3300009551 | Ga0105238_10000060 | Ga0105238_1000006066 | 346 |
| 242 | 3300010375 | Ga0105239_10025794 | Ga0105239_100257946 | 346 |
| 243 | 3300010375 | Ga0105239_10029949 | Ga0105239_100299492 | 346 |
| 244 | 3300013100 | Ga0157373_10081770 | Ga0157373_100817703 | 346 |
| 245 | 3300013102 | Ga0157371_10015942 | Ga0157371_100159422 | 346 |
| 246 | 3300013104 | Ga0157370_10000813 | Ga0157370_1000081319 | 346 |
| 247 | 3300013296 | Ga0157374_10083523 | Ga0157374_100835232 | 346 |
| 248 | 3300013306 | Ga0163162_10000060 | Ga0163162_1000006016 | 346 |
| 249 | 3300014497 | Ga0182008_10005463 | Ga0182008_100054633 | 346 |
| 250 | 3300014969 | Ga0157376_10279957 | Ga0157376_102799572 | 346 |
| 251 | 3300015261 | Ga0182006_1000222 | Ga0182006_100022223 | 346 |
| 252 | 3300015262 | Ga0182007_10036061 | Ga0182007_100360611 | 346 |
| 253 | 3300015265 | Ga0182005_1000028 | Ga0182005_100002845 | 346 |
| 254 | 3300015265 | Ga0182005_1004381 | Ga0182005_10043812 | 346 |
| 255 | 3300015265 | Ga0182005_1011020 | Ga0182005_10110202 | 346 |
| 256 | 3300015685 | Ga0183369_1008 | Ga0183369_100822 | 346 |
| 257 | 3300015687 | Ga0183368_1003 | Ga0183368_1003968 | 346 |
| 258 | 3300025206 | Ga0209435_101622 | Ga0209435_1016222 | 346 |
| 259 | 3300025207 | Ga0209760_100241 | Ga0209760_10024118 | 346 |
| 260 | 3300025224 | Ga0209784_100016 | Ga0209784_100016274 | 346 |
| 261 | 3300025225 | Ga0209566_101596 | Ga0209566_1015963 | 346 |
| 262 | 3300025226 | Ga0209674_100012 | Ga0209674_100012714 | 346 |
| 263 | 3300025226 | Ga0209674_100141 | Ga0209674_10014131 | 346 |
| 264 | 3300025226 | Ga0209674_101045 | Ga0209674_1010456 | 346 |
| 265 | 3300025226 | Ga0209674_101076 | Ga0209674_1010765 | 346 |
| 266 | 3300025228 | Ga0209672_100007 | Ga0209672_100007364 | 346 |
| 267 | 3300025228 | Ga0209672_100018 | Ga0209672_100018159 | 346 |
| 268 | 3300025228 | Ga0209672_100161 | Ga0209672_10016146 | 346 |
| 269 | 3300025228 | Ga0209672_100446 | Ga0209672_10044616 | 346 |
| 270 | 3300025228 | Ga0209672_102265 | Ga0209672_1022652 | 346 |
| 271 | 3300025230 | Ga0209563_100071 | Ga0209563_10007140 | 346 |
| 272 | 3300025231 | Ga0207427_100019 | Ga0207427_100019140 | 346 |
| 273 | 3300025231 | Ga0207427_100036 | Ga0207427_100036137 | 346 |
| 274 | 3300025231 | Ga0207427_100050 | Ga0207427_100050177 | 346 |
| 275 | 3300025231 | Ga0207427_101984 | Ga0207427_1019842 | 346 |
| 276 | 3300025233 | Ga0209437_100012 | Ga0209437_10001233 | 346 |
| 277 | 3300025233 | Ga0209437_100120 | Ga0209437_100120165 | 346 |
| 278 | 3300025233 | Ga0209437_100127 | Ga0209437_10012780 | 346 |
| 279 | 3300025233 | Ga0209437_100289 | Ga0209437_10028951 | 346 |
| 280 | 3300025233 | Ga0209437_102524 | Ga0209437_1025243 | 346 |
| 281 | 3300025242 | Ga0209258_100017 | Ga0209258_100017453 | 346 |
| 282 | 3300025242 | Ga0209258_100024 | Ga0209258_100024265 | 346 |
| 283 | 3300025242 | Ga0209258_100035 | Ga0209258_100035108 | 346 |
| 284 | 3300025242 | Ga0209258_100039 | Ga0209258_100039279 | 346 |
| 285 | 3300025242 | Ga0209258_100256 | Ga0209258_10025679 | 346 |
| 286 | 3300025242 | Ga0209258_100308 | Ga0209258_10030863 | 346 |
| 287 | 3300025246 | Ga0209646_1000426 | Ga0209646_100042621 | 346 |
| 288 | 3300025246 | Ga0209646_1001098 | Ga0209646_10010987 | 346 |
| 289 | 3300025246 | Ga0209646_1007686 | Ga0209646_10076861 | 346 |
| 290 | 3300025250 | Ga0209026_1000012 | Ga0209026_1000012212 | 346 |
| 291 | 3300025250 | Ga0209026_1000281 | Ga0209026_100028130 | 346 |
| 292 | 3300025250 | Ga0209026_1000370 | Ga0209026_100037019 | 346 |
| 293 | 3300025250 | Ga0209026_1000594 | Ga0209026_100059423 | 346 |
| 294 | 3300025250 | Ga0209026_1001678 | Ga0209026_10016782 | 346 |
| 295 | 3300025250 | Ga0209026_1002746 | Ga0209026_10027465 | 346 |
| 296 | 3300025254 | Ga0209148_1000001 | Ga0209148_10000011544 | 346 |
| 297 | 3300025254 | Ga0209148_1000005 | Ga0209148_1000005745 | 346 |
| 298 | 3300025254 | Ga0209148_1000009 | Ga0209148_1000009593 | 346 |
| 299 | 3300025254 | Ga0209148_1000045 | Ga0209148_1000045133 | 346 |
| 300 | 3300025254 | Ga0209148_1000048 | Ga0209148_1000048253 | 346 |
| 301 | 3300025254 | Ga0209148_1000084 | Ga0209148_1000084157 | 346 |
| 302 | 3300025254 | Ga0209148_1001279 | Ga0209148_100127910 | 346 |
| 303 | 3300025256 | Ga0209759_1000450 | Ga0209759_10004505 | 346 |
| 304 | 3300025256 | Ga0209759_1000616 | Ga0209759_100061627 | 346 |
| 305 | 3300025256 | Ga0209759_1001730 | Ga0209759_10017302 | 346 |
| 306 | 3300025256 | Ga0209759_1003861 | Ga0209759_10038612 | 346 |
| 307 | 3300025256 | Ga0209759_1004008 | Ga0209759_10040084 | 346 |
| 308 | 3300025258 | Ga0209129_1001077 | Ga0209129_10010773 | 346 |
| 309 | 3300025261 | Ga0209233_1000002 | Ga0209233_1000002687 | 346 |
| 310 | 3300025261 | Ga0209233_1000101 | Ga0209233_1000101137 | 346 |
| 311 | 3300025261 | Ga0209233_1000174 | Ga0209233_10001746 | 346 |
| 312 | 3300025261 | Ga0209233_1013154 | Ga0209233_10131542 | 346 |
| 313 | 3300025272 | Ga0209455_1000010 | Ga0209455_1000010364 | 346 |
| 314 | 3300025272 | Ga0209455_1000029 | Ga0209455_1000029265 | 346 |
| 315 | 3300025272 | Ga0209455_1000035 | Ga0209455_1000035134 | 346 |
| 316 | 3300025272 | Ga0209455_1000039 | Ga0209455_1000039279 | 346 |
| 317 | 3300025272 | Ga0209455_1003533 | Ga0209455_10035332 | 346 |
| 318 | 3300025272 | Ga0209455_1007348 | Ga0209455_10073483 | 346 |
| 319 | 3300025903 | Ga0207680_10000002 | Ga0207680_10000002897 | 346 |
| 320 | 3300025904 | Ga0207647_10076669 | Ga0207647_100766692 | 346 |
| 321 | 3300025904 | Ga0207647_10131835 | Ga0207647_101318351 | 346 |
| 322 | 3300025909 | Ga0207705_10174247 | Ga0207705_101742472 | 346 |
| 323 | 3300025913 | Ga0207695_10000294 | Ga0207695_1000029430 | 346 |
| 324 | 3300025913 | Ga0207695_10005500 | Ga0207695_100055008 | 346 |
| 325 | 3300025913 | Ga0207695_10024639 | Ga0207695_100246395 | 346 |
| 326 | 3300025914 | Ga0207671_10000374 | Ga0207671_1000037449 | 346 |
| 327 | 3300025915 | Ga0207693_10109038 | Ga0207693_101090381 | 346 |
| 328 | 3300025924 | Ga0207694_10000401 | Ga0207694_1000040110 | 346 |
| 329 | 3300025924 | Ga0207694_10146502 | Ga0207694_101465022 | 346 |
| 330 | 3300025928 | Ga0207700_10016919 | Ga0207700_100169193 | 346 |
| 331 | 3300025936 | Ga0207670_10001638 | Ga0207670_100016387 | 346 |
| 332 | 3300025972 | Ga0207668_10102234 | Ga0207668_101022342 | 346 |
| 333 | 3300025981 | Ga0207640_10010637 | Ga0207640_100106373 | 346 |
| 334 | 3300026067 | Ga0207678_10252592 | Ga0207678_102525921 | 346 |
| 335 | 3300026078 | Ga0207702_10003104 | Ga0207702_100031047 | 346 |
| 336 | 3300026116 | Ga0207674_10047914 | Ga0207674_100479142 | 346 |
| 337 | 3300028379 | Ga0268266_10000004 | Ga0268266_10000004891 | 346 |
| 338 | 3300028380 | Ga0268265_10104729 | Ga0268265_101047292 | 346 |
| 339 | 3300028381 | Ga0268264_10099024 | Ga0268264_100990243 | 346 |
| 340 | 3300031911 | Ga0307412_10001235 | Ga0307412_100012353 | 346 |
| 341 | 3300033180 | Ga0307510_10018989 | Ga0307510_100189894 | 346 |
| 342 | 3300033180 | Ga0307510_10026445 | Ga0307510_100264455 | 346 |
| 343 | 3300037312 | Ga0395899_0000119 | Ga0395899_0000119_30647_31696 | 346 |
| 344 | 3300037312 | Ga0395899_0059325 | Ga0395899_0059325_1663_2703 | 346 |
| 345 | 3300037312 | Ga0395899_0064622 | Ga0395899_0064622_59_1102 | 346 |
| 346 | 3300037312 | Ga0395899_0108314 | Ga0395899_0108314_246_1286 | 346 |
| 347 | 3300037418 | Ga0395900_0000333 | Ga0395900_0000333_61871_62920 | 346 |
| 348 | 3300037418 | Ga0395900_0029174 | Ga0395900_0029174_2608_3648 | 346 |
| 349 | 3300037466 | Ga0395898_0000078 | Ga0395898_0000078_229969_231012 | 346 |
| 350 | 3300037466 | Ga0395898_0000211 | Ga0395898_0000211_133999_135048 | 346 |
| 351 | 3300037466 | Ga0395898_0059229 | Ga0395898_0059229_1120_2160 | 346 |
| 352 | 3300037471 | Ga0395905_0271372 | Ga0395905_0271372_294_1334 | 346 |
| 353 | 3300038443 | Ga0395901_0003349 | Ga0395901_0003349_714_1754 | 346 |
| 354 | 3300038443 | Ga0395901_0073213 | Ga0395901_0073213_1820_2860 | 346 |
| 355 | 3300038443 | Ga0395901_0153632 | Ga0395901_0153632_839_1879 | 346 |
| 356 | 3300039437 | Ga0436365_0822627 | Ga0436365_0822627_201_1253 | 346 |
| 357 | 3300041404 | Ga0439436_0000011 | Ga0439436_0000011_70928_71968 | 346 |
| 358 | 3300041413 | Ga0439465_0003294 | Ga0439465_0003294_3761_4801 | 346 |
| 359 | 3300041452 | Ga0451793_1639987 | Ga0451793_1639987_2123_3187 | 346 |
| 360 | 3300041486 | Ga0451807_1531267 | Ga0451807_1531267_642_1700 | 346 |
| 361 | 3300042184 | Ga0450908_000023 | Ga0450908_000023_27833_28873 | 346 |
| 362 | 3300044672 | Ga0466982_0000036 | Ga0466982_0000036_13486_14526 | 346 |
| 363 | 3300044693 | Ga0466961_0003441 | Ga0466961_0003441_3691_4740 | 346 |
| 364 | 3300044693 | Ga0466961_0097413 | Ga0466961_0097413_450_1499 | 346 |
| 365 | 3300044842 | Ga0466957_0011086 | Ga0466957_0011086_3311_4360 | 346 |
| 366 | 3300044842 | Ga0466957_0011406 | Ga0466957_0011406_1385_2434 | 346 |
| 367 | 3300044842 | Ga0466957_0011738 | Ga0466957_0011738_1506_2546 | 346 |
| 368 | 3300045049 | Ga0466959_0012370 | Ga0466959_0012370_1386_2435 | 346 |
| 369 | 3300045836 | Ga0466958_0033562 | Ga0466958_0033562_830_1879 | 346 |
| 370 | 3300045976 | Ga0466967_0100901 | Ga0466967_0100901_244_1296 | 346 |
| 371 | 3300046460 | Ga0495638_0000159 | Ga0495638_0000159_45393_46433 | 346 |
| 372 | 3300046460 | Ga0495638_0000161 | Ga0495638_0000161_61361_62401 | 346 |
| 373 | 3300046471 | Ga0495650_0000197 | Ga0495650_0000197_43848_44888 | 346 |
| 374 | 3300046471 | Ga0495650_0000984 | Ga0495650_0000984_6516_7559 | 346 |
| 375 | 3300046501 | Ga0495607_0000144 | Ga0495607_0000144_50188_51228 | 346 |
| 376 | 3300046507 | Ga0495606_0001905 | Ga0495606_0001905_3652_4692 | 346 |
| 377 | 3300046512 | Ga0495610_0001128 | Ga0495610_0001128_22104_23144 | 346 |
| 378 | 3300046519 | Ga0495632_0000004 | Ga0495632_0000004_49792_50832 | 346 |
| 379 | 3300046674 | Ga0495588_0084149 | Ga0495588_0084149_365_1414 | 346 |
| 380 | 3300046694 | Ga0495649_0010282 | Ga0495649_0010282_2962_4002 | 346 |
| 381 | 3300046694 | Ga0495649_0011052 | Ga0495649_0011052_563_1603 | 346 |
| 382 | 3300047472 | Ga0495686_0120563 | Ga0495686_0120563_424_1482 | 346 |
| 383 | 3300048916 | Ga0496113_0018146 | Ga0496113_0018146_3550_4590 | 346 |
| 384 | 3300048918 | Ga0496115_0000025 | Ga0496115_0000025_18545_19585 | 346 |
| 385 | 3300048918 | Ga0496115_0000456 | Ga0496115_0000456_22941_23993 | 346 |
| 386 | 3300048918 | Ga0496115_0016735 | Ga0496115_0016735_794_1834 | 346 |
| 387 | 3300048918 | Ga0496115_0023705 | Ga0496115_0023705_2420_3460 | 346 |
| 388 | 3300048922 | Ga0496119_0019934 | Ga0496119_0019934_1323_2363 | 346 |
| 389 | 3300048923 | Ga0496120_0001411 | Ga0496120_0001411_24267_25310 | 346 |
| 390 | 3300048923 | Ga0496120_0068573 | Ga0496120_0068573_426_1466 | 346 |
| 391 | 3300048924 | Ga0496121_0068368 | Ga0496121_0068368_1032_2075 | 346 |
| 392 | 3300048925 | Ga0496122_0013080 | Ga0496122_0013080_2740_3780 | 346 |
| 393 | 3300048925 | Ga0496122_0139583 | Ga0496122_0139583_371_1411 | 346 |
| 394 | 3300048926 | Ga0496123_0022737 | Ga0496123_0022737_1086_2126 | 346 |
| 395 | 3300048927 | Ga0496124_0008309 | Ga0496124_0008309_39_1079 | 346 |
| 396 | 3300048927 | Ga0496124_0008669 | Ga0496124_0008669_39_1079 | 346 |
| 397 | 3300048929 | Ga0496126_0000199 | Ga0496126_0000199_94720_95772 | 346 |
| 398 | 3300048929 | Ga0496126_0021995 | Ga0496126_0021995_1542_2582 | 346 |
| 399 | 3300048929 | Ga0496126_0025347 | Ga0496126_0025347_2605_3648 | 346 |
| 400 | 3300048929 | Ga0496126_0035482 | Ga0496126_0035482_1272_2315 | 346 |
| 401 | 3300048929 | Ga0496126_0043088 | Ga0496126_0043088_536_1576 | 346 |
| 402 | 3300049568 | Ga0501031_0112889 | Ga0501031_0112889_609_1649 | 346 |
| 403 | 3300049569 | Ga0501032_0013648 | Ga0501032_0013648_2183_3223 | 346 |
| 404 | 3300049571 | Ga0501034_0000462 | Ga0501034_0000462_32697_33773 | 346 |
| 405 | 3300049571 | Ga0501034_0033101 | Ga0501034_0033101_149_1225 | 346 |
| 406 | 3300049571 | Ga0501034_0087735 | Ga0501034_0087735_182_1231 | 346 |
| 407 | 3300049571 | Ga0501034_0182660 | Ga0501034_0182660_875_1915 | 346 |
| 408 | 3300049572 | Ga0501036_0198790 | Ga0501036_0198790_435_1475 | 346 |
| 409 | 3300049573 | Ga0501037_0083137 | Ga0501037_0083137_1192_2232 | 346 |
| 410 | 3300049579 | Ga0501043_0023760 | Ga0501043_0023760_1550_2626 | 346 |
| 411 | 3300049579 | Ga0501043_0048461 | Ga0501043_0048461_1880_2929 | 346 |
| 412 | 3300049579 | Ga0501043_0137019 | Ga0501043_0137019_93_1133 | 346 |
| 413 | 3300049579 | Ga0501043_0209253 | Ga0501043_0209253_398_1453 | 346 |
| 414 | 3300049581 | Ga0501047_0038226 | Ga0501047_0038226_3331_4371 | 346 |
| 415 | 3300049581 | Ga0501047_0068553 | Ga0501047_0068553_1687_2742 | 346 |
| 416 | 3300049581 | Ga0501047_0079729 | Ga0501047_0079729_1035_2111 | 346 |
| 417 | 3300049581 | Ga0501047_0089672 | Ga0501047_0089672_22_1077 | 346 |
| 418 | 3300049585 | Ga0501069_0026292 | Ga0501069_0026292_368_1492 | 346 |
| 419 | 3300049586 | Ga0501070_0000062 | Ga0501070_0000062_29384_30508 | 346 |
| 420 | 3300049586 | Ga0501070_0001521 | Ga0501070_0001521_10330_11382 | 346 |
| 421 | 3300049586 | Ga0501070_0003611 | Ga0501070_0003611_8400_9455 | 346 |
| 422 | 3300049586 | Ga0501070_0008534 | Ga0501070_0008534_6838_7881 | 346 |
| 423 | 3300049586 | Ga0501070_0011198 | Ga0501070_0011198_245_1321 | 346 |
| 424 | 3300049586 | Ga0501070_0023671 | Ga0501070_0023671_891_1940 | 346 |
| 425 | 3300049586 | Ga0501070_0062978 | Ga0501070_0062978_128_1183 | 346 |
| 426 | 3300049589 | Ga0501073_0014451 | Ga0501073_0014451_4644_5699 | 346 |
| 427 | 3300049589 | Ga0501073_0016155 | Ga0501073_0016155_2027_3103 | 346 |
| 428 | 3300049589 | Ga0501073_0018129 | Ga0501073_0018129_3892_4947 | 346 |
| 429 | 3300049589 | Ga0501073_0079902 | Ga0501073_0079902_865_1941 | 346 |
| 430 | 3300049590 | Ga0501074_0001791 | Ga0501074_0001791_12875_13930 | 346 |
| 431 | 3300049590 | Ga0501074_0005621 | Ga0501074_0005621_523_1578 | 346 |
| 432 | 3300049590 | Ga0501074_0014312 | Ga0501074_0014312_2790_3866 | 346 |
| 433 | 3300049741 | Ga0501079_0064932 | Ga0501079_0064932_57_1112 | 346 |
| 434 | 3300049742 | Ga0501080_0001205 | Ga0501080_0001205_17793_18869 | 346 |
| 435 | 3300049742 | Ga0501080_0017505 | Ga0501080_0017505_1576_2652 | 346 |
| 436 | 3300049742 | Ga0501080_0107539 | Ga0501080_0107539_948_2003 | 346 |
| 437 | 3300049742 | Ga0501080_0202074 | Ga0501080_0202074_677_1720 | 346 |
| 438 | 3300049822 | Ga0501035_0013449 | Ga0501035_0013449_3173_4222 | 346 |
| 439 | 3300049822 | Ga0501035_0020895 | Ga0501035_0020895_1024_2079 | 346 |
| 440 | 3300049822 | Ga0501035_0039148 | Ga0501035_0039148_1039_2079 | 346 |
| 441 | 3300049822 | Ga0501035_0076121 | Ga0501035_0076121_1314_2369 | 346 |
| 442 | 3300049822 | Ga0501035_0196950 | Ga0501035_0196950_347_1423 | 346 |
| 443 | 3300049823 | Ga0501044_0027747 | Ga0501044_0027747_2085_3134 | 346 |
| 444 | 3300049823 | Ga0501044_0035105 | Ga0501044_0035105_1786_2835 | 346 |
| 445 | 3300049823 | Ga0501044_0042303 | Ga0501044_0042303_2077_3132 | 346 |
| 446 | 3300049823 | Ga0501044_0052151 | Ga0501044_0052151_1515_2555 | 346 |
| 447 | 3300049824 | Ga0501045_0176358 | Ga0501045_0176358_422_1462 | 346 |
| 448 | 3300053093 | Ga0500651_0000201 | Ga0500651_0000201_35044_36108 | 346 |
| 449 | 3300001915 | JGI24741J21665_1002272 | JGI24741J21665_10022724 | 347 |
| 450 | 3300001979 | JGI24740J21852_10003823 | JGI24740J21852_100038232 | 347 |
| 451 | 3300005336 | Ga0070680_100211347 | Ga0070680_1002113472 | 347 |
| 452 | 3300005339 | Ga0070660_100026970 | Ga0070660_1000269702 | 347 |
| 453 | 3300005345 | Ga0070692_10047255 | Ga0070692_100472552 | 347 |
| 454 | 3300005458 | Ga0070681_10001678 | Ga0070681_100016786 | 347 |
| 455 | 3300005530 | Ga0070679_100001710 | Ga0070679_1000017106 | 347 |
| 456 | 3300009101 | Ga0105247_10003125 | Ga0105247_100031255 | 347 |
| 457 | 3300013100 | Ga0157373_10025438 | Ga0157373_100254382 | 347 |
| 458 | 3300013102 | Ga0157371_10076776 | Ga0157371_100767762 | 347 |
| 459 | 3300014497 | Ga0182008_10034216 | Ga0182008_100342162 | 347 |
| 460 | 3300015261 | Ga0182006_1000140 | Ga0182006_100014027 | 347 |
| 461 | 3300015262 | Ga0182007_10036761 | Ga0182007_100367611 | 347 |
| 462 | 3300015265 | Ga0182005_1003015 | Ga0182005_10030153 | 347 |
| 463 | 3300017792 | Ga0163161_10001842 | Ga0163161_100018427 | 347 |
| 464 | 3300020069 | Ga0197907_10018156 | Ga0197907_100181561 | 347 |
| 465 | 3300020070 | Ga0206356_10117802 | Ga0206356_101178022 | 347 |
| 466 | 3300020081 | Ga0206354_10508562 | Ga0206354_105085622 | 347 |
| 467 | 3300020081 | Ga0206354_10839745 | Ga0206354_108397455 | 347 |
| 468 | 3300020610 | Ga0154015_1117584 | Ga0154015_11175842 | 347 |
| 469 | 3300025904 | Ga0207647_10008285 | Ga0207647_100082855 | 347 |
| 470 | 3300025909 | Ga0207705_10015872 | Ga0207705_100158723 | 347 |
| 471 | 3300025912 | Ga0207707_10000349 | Ga0207707_1000034913 | 347 |
| 472 | 3300025912 | Ga0207707_10009108 | Ga0207707_100091085 | 347 |
| 473 | 3300025912 | Ga0207707_10013431 | Ga0207707_100134315 | 347 |
| 474 | 3300025913 | Ga0207695_10033006 | Ga0207695_100330065 | 347 |
| 475 | 3300025917 | Ga0207660_10001350 | Ga0207660_1000135014 | 347 |
| 476 | 3300025917 | Ga0207660_10006503 | Ga0207660_100065035 | 347 |
| 477 | 3300025921 | Ga0207652_10002130 | Ga0207652_100021302 | 347 |
| 478 | 3300025921 | Ga0207652_10021550 | Ga0207652_100215501 | 347 |
| 479 | 3300025921 | Ga0207652_10022180 | Ga0207652_100221805 | 347 |
| 480 | 3300025944 | Ga0207661_10032861 | Ga0207661_100328612 | 347 |
| 481 | 3300025945 | Ga0207679_10173327 | Ga0207679_101733272 | 347 |
| 482 | 3300025949 | Ga0207667_10037122 | Ga0207667_100371222 | 347 |
| 483 | 3300025981 | Ga0207640_10041767 | Ga0207640_100417672 | 347 |
| 484 | 3300026067 | Ga0207678_10037497 | Ga0207678_100374974 | 347 |
| 485 | 3300026142 | Ga0207698_10008359 | Ga0207698_100083592 | 347 |
| 486 | 3300038443 | Ga0395901_0015121 | Ga0395901_0015121_2554_3654 | 347 |
| 487 | 3300046452 | Ga0495617_000077 | Ga0495617_000077_28058_29101 | 347 |
| 488 | 3300046460 | Ga0495638_0000078 | Ga0495638_0000078_134278_135321 | 347 |
| 489 | 3300046471 | Ga0495650_0000686 | Ga0495650_0000686_37040_38083 | 347 |
| 490 | 3300046471 | Ga0495650_0045039 | Ga0495650_0045039_137_1180 | 347 |
| 491 | 3300046492 | Ga0495585_0000080 | Ga0495585_0000080_51136_52179 | 347 |
| 492 | 3300046492 | Ga0495585_0001139 | Ga0495585_0001139_10597_11640 | 347 |
| 493 | 3300046501 | Ga0495607_0000954 | Ga0495607_0000954_3215_4258 | 347 |
| 494 | 3300046507 | Ga0495606_0000227 | Ga0495606_0000227_20026_21069 | 347 |
| 495 | 3300046507 | Ga0495606_0000340 | Ga0495606_0000340_45701_46744 | 347 |
| 496 | 3300046507 | Ga0495606_0011714 | Ga0495606_0011714_4144_5187 | 347 |
| 497 | 3300046507 | Ga0495606_0200041 | Ga0495606_0200041_79_1122 | 347 |
| 498 | 3300046513 | Ga0495616_0000036 | Ga0495616_0000036_75139_76182 | 347 |
| 499 | 3300046515 | Ga0495620_0000164 | Ga0495620_0000164_49892_50935 | 347 |
| 500 | 3300046515 | Ga0495620_0002441 | Ga0495620_0002441_4988_6031 | 347 |
| 501 | 3300046518 | Ga0495631_0000017 | Ga0495631_0000017_85352_86395 | 347 |
| 502 | 3300046518 | Ga0495631_0001882 | Ga0495631_0001882_4246_5289 | 347 |
| 503 | 3300046519 | Ga0495632_0000786 | Ga0495632_0000786_19_1062 | 347 |
| 504 | 3300046519 | Ga0495632_0012006 | Ga0495632_0012006_2701_3744 | 347 |
| 505 | 3300046524 | Ga0495648_0001369 | Ga0495648_0001369_11467_12510 | 347 |
| 506 | 3300046524 | Ga0495648_0005091 | Ga0495648_0005091_8578_9621 | 347 |
| 507 | 3300046616 | Ga0495668_0014064 | Ga0495668_0014064_2929_3972 | 347 |
| 508 | 3300046616 | Ga0495668_0101678 | Ga0495668_0101678_457_1500 | 347 |
| 509 | 3300046648 | Ga0495611_0000001 | Ga0495611_0000001_2271165_2272208 | 347 |
| 510 | 3300046648 | Ga0495611_0000022 | Ga0495611_0000022_50196_51239 | 347 |
| 511 | 3300046660 | Ga0495625_0000347 | Ga0495625_0000347_4143_5186 | 347 |
| 512 | 3300046660 | Ga0495625_0002925 | Ga0495625_0002925_9412_10455 | 347 |
| 513 | 3300046665 | Ga0495661_0000657 | Ga0495661_0000657_3168_4211 | 347 |
| 514 | 3300046665 | Ga0495661_0145488 | Ga0495661_0145488_66_1109 | 347 |
| 515 | 3300046691 | Ga0495670_0008759 | Ga0495670_0008759_1262_2305 | 347 |
| 516 | 3300046692 | Ga0495671_0000240 | Ga0495671_0000240_29844_30887 | 347 |
| 517 | 3300046794 | Ga0495589_0000053 | Ga0495589_0000053_49726_50769 | 347 |
| 518 | 3300046810 | Ga0495660_0000094 | Ga0495660_0000094_77302_78345 | 347 |
| 519 | 3300046810 | Ga0495660_0000233 | Ga0495660_0000233_17247_18290 | 347 |
| 520 | 3300047323 | Ga0495683_0001315 | Ga0495683_0001315_8388_9431 | 347 |
| 521 | 3300047446 | Ga0495679_000004 | Ga0495679_000004_381937_382980 | 347 |
| 522 | 3300047469 | Ga0495673_0000004 | Ga0495673_0000004_216944_217987 | 347 |
| 523 | 3300047469 | Ga0495673_0000048 | Ga0495673_0000048_220028_221071 | 347 |
| 524 | 3300047469 | Ga0495673_0000644 | Ga0495673_0000644_21964_23007 | 347 |
| 525 | 3300047469 | Ga0495673_0104932 | Ga0495673_0104932_83_1126 | 347 |
| 526 | 3300047470 | Ga0495681_0043956 | Ga0495681_0043956_295_1338 | 347 |
| 527 | 3300047472 | Ga0495686_0000295 | Ga0495686_0000295_42683_43726 | 347 |
| 528 | 3300047472 | Ga0495686_0087615 | Ga0495686_0087615_782_1825 | 347 |
| 529 | 3300048903 | Ga0496100_0005392 | Ga0496100_0005392_2729_3772 | 347 |
| 530 | 3300048904 | Ga0496101_0004248 | Ga0496101_0004248_2677_3720 | 347 |
| 531 | 3300048909 | Ga0496106_0005759 | Ga0496106_0005759_2795_3838 | 347 |
| 532 | 3300048924 | Ga0496121_0002571 | Ga0496121_0002571_3819_4862 | 347 |
| 533 | 3300048924 | Ga0496121_0005654 | Ga0496121_0005654_12256_13299 | 347 |
| 534 | 3300048925 | Ga0496122_0055316 | Ga0496122_0055316_1237_2280 | 347 |
| 535 | 3300048926 | Ga0496123_0088467 | Ga0496123_0088467_175_1218 | 347 |
| 536 | 3300049459 | Ga0495678_000276 | Ga0495678_000276_3215_4258 | 347 |
| 537 | 3300049460 | Ga0495682_0004711 | Ga0495682_0004711_2973_4016 | 347 |
| 538 | 3300049575 | Ga0501039_0075591 | Ga0501039_0075591_1110_2177 | 347 |
| 539 | 3300049582 | Ga0501048_0110770 | Ga0501048_0110770_22_1086 | 347 |
| 540 | 3300053087 | Ga0500643_000020 | Ga0500643_000020_139771_140814 | 347 |
| 541 | 3300053103 | Ga0500555_000855 | Ga0500555_000855_364_1407 | 347 |
| 542 | 3300053160 | Ga0500633_0005303 | Ga0500633_0005303_1612_2655 | 347 |
| 543 | 3300053730 | Ga0500645_001658 | Ga0500645_001658_8372_9415 | 347 |
| 544 | 3300001904 | JGI24736J21556_1003793 | JGI24736J21556_10037932 | 348 |
| 545 | 3300001979 | JGI24740J21852_10008388 | JGI24740J21852_100083882 | 348 |
| 546 | 3300001989 | JGI24739J22299_10001760 | JGI24739J22299_100017604 | 348 |
| 547 | 3300001990 | JGI24737J22298_10001454 | JGI24737J22298_100014544 | 348 |
| 548 | 3300002737 | JGI25162J39368_1001266 | JGI25162J39368_10012666 | 348 |
| 549 | 3300002737 | JGI25162J39368_1001649 | JGI25162J39368_10016494 | 348 |
| 550 | 3300002772 | JGI25164J39214_1000366 | JGI25164J39214_100036623 | 348 |
| 551 | 3300003214 | JGI25165J46597_1000405 | JGI25165J46597_100040525 | 348 |
| 552 | 3300003215 | JGI25153J46596_10015617 | JGI25153J46596_100156172 | 348 |
| 553 | 3300003316 | rootH1_10079021 | rootH1_100790213 | 348 |
| 554 | 3300003578 | Ga0006562J51391_1025482 | Ga0006562J51391_10254825 | 348 |
| 555 | 3300003578 | Ga0006562J51391_1025483 | Ga0006562J51391_10254835 | 348 |
| 556 | 3300005337 | Ga0070682_100036100 | Ga0070682_1000361002 | 348 |
| 557 | 3300005339 | Ga0070660_100021136 | Ga0070660_1000211362 | 348 |
| 558 | 3300005339 | Ga0070660_100070386 | Ga0070660_1000703862 | 348 |
| 559 | 3300005344 | Ga0070661_100025681 | Ga0070661_1000256815 | 348 |
| 560 | 3300005366 | Ga0070659_100008670 | Ga0070659_1000086706 | 348 |
| 561 | 3300005366 | Ga0070659_100153987 | Ga0070659_1001539872 | 348 |
| 562 | 3300005435 | Ga0070714_100000079 | Ga0070714_10000007985 | 348 |
| 563 | 3300005435 | Ga0070714_100001985 | Ga0070714_1000019859 | 348 |
| 564 | 3300005457 | Ga0070662_100072022 | Ga0070662_1000720222 | 348 |
| 565 | 3300005458 | Ga0070681_10040729 | Ga0070681_100407294 | 348 |
| 566 | 3300005458 | Ga0070681_10049674 | Ga0070681_100496746 | 348 |
| 567 | 3300005530 | Ga0070679_100111886 | Ga0070679_1001118862 | 348 |
| 568 | 3300005530 | Ga0070679_100114322 | Ga0070679_1001143222 | 348 |
| 569 | 3300005539 | Ga0068853_100213545 | Ga0068853_1002135451 | 348 |
| 570 | 3300005546 | Ga0070696_100012517 | Ga0070696_1000125174 | 348 |
| 571 | 3300005546 | Ga0070696_100039428 | Ga0070696_1000394284 | 348 |
| 572 | 3300005563 | Ga0068855_100009625 | Ga0068855_1000096258 | 348 |
| 573 | 3300005563 | Ga0068855_100028046 | Ga0068855_1000280464 | 348 |
| 574 | 3300005564 | Ga0070664_100220520 | Ga0070664_1002205202 | 348 |
| 575 | 3300005577 | Ga0068857_100000573 | Ga0068857_10000057321 | 348 |
| 576 | 3300005578 | Ga0068854_100000455 | Ga0068854_1000004554 | 348 |
| 577 | 3300005578 | Ga0068854_100004459 | Ga0068854_1000044598 | 348 |
| 578 | 3300005616 | Ga0068852_100103311 | Ga0068852_1001033112 | 348 |
| 579 | 3300005842 | Ga0068858_100058951 | Ga0068858_1000589513 | 348 |
| 580 | 3300009093 | Ga0105240_10000298 | Ga0105240_1000029817 | 348 |
| 581 | 3300009093 | Ga0105240_10008267 | Ga0105240_100082678 | 348 |
| 582 | 3300009093 | Ga0105240_10033211 | Ga0105240_100332114 | 348 |
| 583 | 3300009545 | Ga0105237_10000023 | Ga0105237_10000023177 | 348 |
| 584 | 3300009545 | Ga0105237_10394014 | Ga0105237_103940142 | 348 |
| 585 | 3300010375 | Ga0105239_10000044 | Ga0105239_10000044156 | 348 |
| 586 | 3300010375 | Ga0105239_10040405 | Ga0105239_100404052 | 348 |
| 587 | 3300010375 | Ga0105239_10046422 | Ga0105239_100464222 | 348 |
| 588 | 3300012500 | Ga0157314_1000032 | Ga0157314_10000322 | 348 |
| 589 | 3300013104 | Ga0157370_10005119 | Ga0157370_100051192 | 348 |
| 590 | 3300013104 | Ga0157370_10009565 | Ga0157370_100095654 | 348 |
| 591 | 3300013104 | Ga0157370_10018018 | Ga0157370_100180186 | 348 |
| 592 | 3300013105 | Ga0157369_10000080 | Ga0157369_1000008051 | 348 |
| 593 | 3300013105 | Ga0157369_10128534 | Ga0157369_101285342 | 348 |
| 594 | 3300013307 | Ga0157372_10028027 | Ga0157372_100280275 | 348 |
| 595 | 3300025231 | Ga0207427_100123 | Ga0207427_10012324 | 348 |
| 596 | 3300025233 | Ga0209437_100227 | Ga0209437_10022773 | 348 |
| 597 | 3300025258 | Ga0209129_1002771 | Ga0209129_10027712 | 348 |
| 598 | 3300025261 | Ga0209233_1000283 | Ga0209233_100028324 | 348 |
| 599 | 3300025297 | Ga0209758_1001696 | Ga0209758_10016964 | 348 |
| 600 | 3300025904 | Ga0207647_10000099 | Ga0207647_1000009916 | 348 |
| 601 | 3300025904 | Ga0207647_10010351 | Ga0207647_100103515 | 348 |
| 602 | 3300025904 | Ga0207647_10123863 | Ga0207647_101238632 | 348 |
| 603 | 3300025909 | Ga0207705_10001831 | Ga0207705_1000183111 | 348 |
| 604 | 3300025912 | Ga0207707_10004791 | Ga0207707_1000479113 | 348 |
| 605 | 3300025913 | Ga0207695_10001363 | Ga0207695_1000136321 | 348 |
| 606 | 3300025913 | Ga0207695_10064214 | Ga0207695_100642142 | 348 |
| 607 | 3300025914 | Ga0207671_10000020 | Ga0207671_1000002059 | 348 |
| 608 | 3300025914 | Ga0207671_10000033 | Ga0207671_10000033196 | 348 |
| 609 | 3300025917 | Ga0207660_10100704 | Ga0207660_101007042 | 348 |
| 610 | 3300025917 | Ga0207660_10148984 | Ga0207660_101489841 | 348 |
| 611 | 3300025919 | Ga0207657_10063806 | Ga0207657_100638064 | 348 |
| 612 | 3300025919 | Ga0207657_10076899 | Ga0207657_100768992 | 348 |
| 613 | 3300025919 | Ga0207657_10081366 | Ga0207657_100813662 | 348 |
| 614 | 3300025920 | Ga0207649_10035698 | Ga0207649_100356983 | 348 |
| 615 | 3300025921 | Ga0207652_10226015 | Ga0207652_102260152 | 348 |
| 616 | 3300025929 | Ga0207664_10000036 | Ga0207664_10000036153 | 348 |
| 617 | 3300025929 | Ga0207664_10000858 | Ga0207664_100008585 | 348 |
| 618 | 3300025932 | Ga0207690_10014477 | Ga0207690_100144775 | 348 |
| 619 | 3300025932 | Ga0207690_10015534 | Ga0207690_100155343 | 348 |
| 620 | 3300025932 | Ga0207690_10031465 | Ga0207690_100314652 | 348 |
| 621 | 3300025932 | Ga0207690_10055295 | Ga0207690_100552952 | 348 |
| 622 | 3300025933 | Ga0207706_10060077 | Ga0207706_100600772 | 348 |
| 623 | 3300025945 | Ga0207679_10195374 | Ga0207679_101953742 | 348 |
| 624 | 3300025949 | Ga0207667_10000094 | Ga0207667_1000009458 | 348 |
| 625 | 3300025949 | Ga0207667_10000238 | Ga0207667_1000023829 | 348 |
| 626 | 3300025949 | Ga0207667_10001738 | Ga0207667_100017382 | 348 |
| 627 | 3300025981 | Ga0207640_10000043 | Ga0207640_1000004316 | 348 |
| 628 | 3300025981 | Ga0207640_10000277 | Ga0207640_100002778 | 348 |
| 629 | 3300026035 | Ga0207703_10072134 | Ga0207703_100721342 | 348 |
| 630 | 3300026041 | Ga0207639_10058456 | Ga0207639_100584562 | 348 |
| 631 | 3300026067 | Ga0207678_10060292 | Ga0207678_100602922 | 348 |
| 632 | 3300026078 | Ga0207702_10023241 | Ga0207702_100232414 | 348 |
| 633 | 3300026116 | Ga0207674_10000074 | Ga0207674_1000007465 | 348 |
| 634 | 3300026116 | Ga0207674_10010110 | Ga0207674_100101108 | 348 |
| 635 | 3300026142 | Ga0207698_10083089 | Ga0207698_100830892 | 348 |
| 636 | 3300031665 | Ga0316575_10021316 | Ga0316575_100213162 | 348 |
| 637 | 3300044672 | Ga0466982_0000009 | Ga0466982_0000009_3725_4795 | 348 |
| 638 | 3300044683 | Ga0466965_0015843 | Ga0466965_0015843_71_1126 | 348 |
| 639 | 3300044684 | Ga0466966_0038369 | Ga0466966_0038369_2005_3075 | 348 |
| 640 | 3300044693 | Ga0466961_0001124 | Ga0466961_0001124_6223_7302 | 348 |
| 641 | 3300044693 | Ga0466961_0002245 | Ga0466961_0002245_3920_4993 | 348 |
| 642 | 3300044735 | Ga0466968_0000703 | Ga0466968_0000703_1178_2224 | 348 |
| 643 | 3300044901 | Ga0466960_0007138 | Ga0466960_0007138_1451_2521 | 348 |
| 644 | 3300045049 | Ga0466959_0000007 | Ga0466959_0000007_56958_58037 | 348 |
| 645 | 3300045049 | Ga0466959_0089661 | Ga0466959_0089661_88_1158 | 348 |
| 646 | 3300047472 | Ga0495686_0000017 | Ga0495686_0000017_300252_301298 | 348 |
| 647 | 3300048905 | Ga0496102_0163985 | Ga0496102_0163985_439_1500 | 348 |
| 648 | 3300048908 | Ga0496105_0002731 | Ga0496105_0002731_1855_2916 | 348 |
| 649 | 3300048910 | Ga0496107_0020194 | Ga0496107_0020194_1125_2186 | 348 |
| 650 | 3300048918 | Ga0496115_0017124 | Ga0496115_0017124_3922_4983 | 348 |
| 651 | 3300048919 | Ga0496116_0093510 | Ga0496116_0093510_63_1109 | 348 |
| 652 | 3300048920 | Ga0496117_0004466 | Ga0496117_0004466_3458_4504 | 348 |
| 653 | 3300048920 | Ga0496117_0011123 | Ga0496117_0011123_1102_2163 | 348 |
| 654 | 3300048920 | Ga0496117_0024407 | Ga0496117_0024407_2614_3660 | 348 |
| 655 | 3300048921 | Ga0496118_0000177 | Ga0496118_0000177_72347_73423 | 348 |
| 656 | 3300048921 | Ga0496118_0000805 | Ga0496118_0000805_37764_38810 | 348 |
| 657 | 3300048921 | Ga0496118_0001746 | Ga0496118_0001746_27585_28646 | 348 |
| 658 | 3300048921 | Ga0496118_0002109 | Ga0496118_0002109_22335_23396 | 348 |
| 659 | 3300048921 | Ga0496118_0023825 | Ga0496118_0023825_1470_2516 | 348 |
| 660 | 3300048921 | Ga0496118_0079063 | Ga0496118_0079063_1205_2287 | 348 |
| 661 | 3300048922 | Ga0496119_0000707 | Ga0496119_0000707_4499_5560 | 348 |
| 662 | 3300048923 | Ga0496120_0000446 | Ga0496120_0000446_25105_26166 | 348 |
| 663 | 3300048924 | Ga0496121_0000241 | Ga0496121_0000241_4278_5339 | 348 |
| 664 | 3300048924 | Ga0496121_0000372 | Ga0496121_0000372_31522_32568 | 348 |
| 665 | 3300048924 | Ga0496121_0027862 | Ga0496121_0027862_1638_2699 | 348 |
| 666 | 3300048924 | Ga0496121_0028953 | Ga0496121_0028953_1931_3001 | 348 |
| 667 | 3300048925 | Ga0496122_0109729 | Ga0496122_0109729_513_1559 | 348 |
| 668 | 3300048925 | Ga0496122_0140817 | Ga0496122_0140817_385_1431 | 348 |
| 669 | 3300048926 | Ga0496123_0008605 | Ga0496123_0008605_7368_8414 | 348 |
| 670 | 3300048928 | Ga0496125_0000892 | Ga0496125_0000892_37593_38663 | 348 |
| 671 | 3300048928 | Ga0496125_0005101 | Ga0496125_0005101_9536_10582 | 348 |
| 672 | 3300048929 | Ga0496126_0000769 | Ga0496126_0000769_28954_30015 | 348 |
| 673 | 3300048929 | Ga0496126_0139067 | Ga0496126_0139067_125_1171 | 348 |
| 674 | 3300049589 | Ga0501073_0028815 | Ga0501073_0028815_1246_2328 | 348 |
| 675 | 3300049823 | Ga0501044_0053580 | Ga0501044_0053580_1182_2264 | 348 |
| 676 | 3300061719 | Ga0466962_0004485 | Ga0466962_0004485_5212_6282 | 348 |
| 677 | iso_pu_bacteria | 2939611941 | 2939614474 | 348 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7orz-assembly1.cif.gz_A | crystal structure of udp-n-acetylenolpyruvoylglucosamine reductase (murb) from pseudomonas aeruginosa in complex with fad and a pyrazole derivative (fragment 18) | 0.9578 | 15 | 348 |
| 7orz-assembly1.cif.gz_A | crystal structure of udp-n-acetylenolpyruvoylglucosamine reductase (murb) from pseudomonas aeruginosa in complex with fad and a pyrazole derivative (fragment 18) | 0.9467 | 15 | 348 |
| 1uxy-assembly1.cif.gz_A | murb mutant with ser 229 replaced by ala, complex with enolpyruvyl-udp-n-acetylglucosamine | 0.9312 | 20 | 348 |
| 3i99-assembly1.cif.gz_A | the crystal structure of the udp-n-acetylenolpyruvoylglucosamine reductase from the vibrio cholerae o1 biovar tor | 0.9306 | 8 | 348 |
| 2q85-assembly1.cif.gz_A | crystal structure of e. coli mur b bound to a naphthyl tetronic acid inihibitor | 0.9274 | 18 | 348 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3tx1A03 | Alpha Beta;Alpha-Beta Complex;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 1;UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain | 0.9617 | 284 | 348 | 3.90.78.10 |
| 4jayA02 | Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; | 0.9596 | 85 | 237 | 3.30.465.10 |
| 4jayA02 | Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; | 0.9475 | 85 | 237 | 3.30.465.10 |
| 3i99A03 | Alpha Beta;Alpha-Beta Complex;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 1;UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain | 0.9303 | 238 | 344 | 3.90.78.10 |
| af_P38960_2_190_2.40.50.1040 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); | 0.902 | 84 | 100 | 2.40.50.1040 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-Q9PAE6-F1-model_v4 | UDP-N-acetylenolpyruvoylglucosamine reductase (EC 1.3.1.98) (UDP-N-acetylmuramate dehydrogenase) | 0.9791 | 5 | 348 |
GO:0005829
GO:0008360 GO:0008762 GO:0009252 GO:0051301 GO:0071555 GO:0071949 |
| AF-A0A350JMG3-F1-model_v4 | UDP-N-acetylmuramate dehydrogenase (EC 1.3.1.98) | 0.9713 | 107 | 348 |
GO:0005829
GO:0008360 GO:0008762 GO:0009252 GO:0050660 GO:0051301 GO:0071555 |
| AF-A0A4R3I108-F1-model_v4 | UDP-N-acetylenolpyruvoylglucosamine reductase (EC 1.3.1.98) (UDP-N-acetylmuramate dehydrogenase) | 0.9712 | 45 | 348 |
GO:0005829
GO:0008360 GO:0008762 GO:0009252 GO:0051301 GO:0071555 GO:0071949 |
| AF-A0A6A5L5C6-F1-model_v4 | deleted | 0.9706 | 25 | 348 |
|
| AF-Q9K016-F1-model_v4 | UDP-N-acetylenolpyruvoylglucosamine reductase (EC 1.3.1.98) (UDP-N-acetylmuramate dehydrogenase) | 0.9706 | 15 | 347 |
GO:0005829
GO:0008360 GO:0008762 GO:0009252 GO:0050660 GO:0051301 GO:0071555 GO:0071949 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar