F474613

General Info

Members Datasets Scaffolds Average Seq Length
677 276 653 349

Family's Representative Sequence

Representative Sequence 3300049585|Ga0501069_0026292|Ga0501069_0026292_368_1492
Length 374
Sequence MQDGSRPWPGWRPFQGLATVLTGTGNNGVDSRPAGFTLTPNASLRDRNTLRVDARAAWLADIHDAAAIPDLLDQAASRDRPMLLLGEGSNVLFTGDFGGVVVTMKTRGVEILDDVDDAARIRVAAGEHWDSLVRWTLAHGHAGLENLILIPGSVGAAPMQNIGAYGVEVREFIESVETYDLRQRRGAEFRNGDCEFGYRDSIFKRHPDRWLITAVTLRLPRAWAPRIEYSGVQEELRRMGVERPAPIHVADAVVALRTRKLPDPAVIGNAGSFFKNPLIPAAQATTLLAEHPQLPCWPVPNDMSKLSAAWLIEASGFKGLREGDVGISNRHALVLVNHGNATGEQLWALAQRVREGVRERFGVELEPEPRVAAA

Samples

Sample ID Description Type Environment
1 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
2 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
3 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
4 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
5 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
6 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
7 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
8 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
9 2734482264 Dyella sp. AD052 Isolate Unclassified
10 2738543009 Luteibacter sp. OK325 Isolate Unclassified
11 2739367700 Dyella sp. YR388 Isolate Unclassified
12 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
13 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
14 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
15 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
16 2884411467 Dyella sp. AD56 Isolate Rhizosphere
17 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
18 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
19 2919085039 Luteibacter sp. 1214 Isolate Unclassified
20 2919404418 Luteibacter sp. 3190 Isolate Unclassified
21 2928963466 Dyella japonica 1073 Isolate Unclassified
22 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
23 2941471342 Luteibacter sp. 621 Isolate Unclassified
24 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
25 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
26 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
27 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
28 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
29 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
30 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
31 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
32 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
33 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
34 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
35 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
36 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
37 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
38 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
39 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
40 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
41 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
42 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
43 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
44 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
45 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
46 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
47 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
48 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
49 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
50 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
51 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
52 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
53 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
54 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
55 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
56 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
57 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
58 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
59 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
60 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
61 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
62 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
63 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
64 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
65 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
66 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
67 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
68 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
69 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
70 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
71 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
72 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
73 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
74 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
75 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
76 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
77 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
78 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
79 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
80 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
81 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
82 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
83 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
84 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
85 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
86 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
94 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
95 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
105 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
106 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
107 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
108 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
115 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
116 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
117 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
123 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
124 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
126 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
127 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
129 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
130 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
131 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
133 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
172 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
173 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
174 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
175 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
176 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
177 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
178 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
179 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
180 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
181 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
182 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
183 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
184 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
185 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
186 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
187 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
188 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
189 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
190 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
191 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
192 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
193 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
194 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
195 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
196 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
197 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
198 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
199 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
200 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
201 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
202 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
203 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
204 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
205 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
206 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
207 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
208 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
209 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
210 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
211 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
212 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
213 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
214 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
215 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
216 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
217 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
218 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
219 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
220 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
221 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
222 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
223 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
224 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
225 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
226 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
227 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
228 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
229 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
230 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
231 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
232 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
233 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
234 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
235 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
236 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
237 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
238 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
239 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
240 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
241 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
242 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
243 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
244 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
245 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
246 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
247 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
248 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
261 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
262 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
263 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
264 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
265 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
266 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
267 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
270 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
271 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
272 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
273 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
274 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
275 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
276 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.13
Metatranscriptomes 1.33
Isolates 3.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.88
Nodule 0
Rhizoplane 2.36
Rhizosphere 69.42
Stem 0
Stem Tuber 0
Unclassified 14.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1003793 3300001904 Bacteria 2606
2 JGI24741J21665_1000657 3300001915 Bacteria 10437
3 JGI24741J21665_1002272 3300001915 Bacteria 5061
4 JGI24741J21665_1003851 3300001915 Bacteria 3466
5 JGI24740J21852_10003823 3300001979 Bacteria 6545
6 JGI24740J21852_10006323 3300001979 Bacteria 4917
7 JGI24740J21852_10008388 3300001979 Bacteria 4118
8 JGI24739J22299_10001760 3300001989 Bacteria 8239
9 JGI24737J22298_10001454 3300001990 Bacteria 8441
10 JGI24735J21928_10001618 3300002067 Bacteria 7972
11 JGI24738J21930_10000989 3300002075 Bacteria 8151
12 JGI25156J39149_1004866 3300002705 Bacteria 3997
13 JGI25156J39149_1010264 3300002705 Bacteria 2213
14 JGI25156J39149_1012543 3300002705 Bacteria 1854
15 JGI25156J39149_1015099 3300002705 Bacteria 1561
16 JGI25162J39368_1000068 3300002737 Bacteria 129594
17 JGI25162J39368_1000270 3300002737 Bacteria 50050
18 JGI25162J39368_1000991 3300002737 Bacteria 17952
19 JGI25162J39368_1001266 3300002737 Bacteria 14404
20 JGI25162J39368_1001649 3300002737 Bacteria 11104
21 JGI25162J39368_1002007 3300002737 Bacteria 9042
22 JGI25157J39369_1000068 3300002741 Bacteria 94833
23 JGI25157J39369_1000333 3300002741 Bacteria 33433
24 JGI25157J39369_1004281 3300002741 Bacteria 2639
25 JGI25157J39369_1004468 3300002741 Bacteria 2528
26 JGI25157J39369_1006344 3300002741 Bacteria 1810
27 JGI25163J39215_1000711 3300002771 Bacteria 8660
28 JGI25164J39214_1000113 3300002772 Bacteria 78046
29 JGI25164J39214_1000216 3300002772 Bacteria 47222
30 JGI25164J39214_1000366 3300002772 Bacteria 26967
31 JGI25164J39214_1000931 3300002772 Bacteria 9574
32 JGI25165J46597_1000058 3300003214 Bacteria 212833
33 JGI25165J46597_1000158 3300003214 Bacteria 108257
34 JGI25165J46597_1000405 3300003214 Bacteria 45672
35 JGI25165J46597_1002857 3300003214 Bacteria 4937
36 JGI25153J46596_10015617 3300003215 Bacteria 3083
37 rootH1_10079021 3300003316 Bacteria 2610
38 rootH2_10020728 3300003320 Bacteria 16631
39 Ga0006562J51391_1025482 3300003578 Bacteria 5720
40 Ga0006562J51391_1025483 3300003578 Bacteria 7220
41 Ga0055538_1000519 3300003751 Bacteria 13752
42 Ga0055533_1000980 3300003756 Bacteria 8350
43 Ga0055527_1000066 3300003760 Bacteria 88276
44 Ga0055527_1000092 3300003760 Bacteria 69389
45 Ga0055527_1000340 3300003760 Bacteria 23889
46 Ga0055535_1000034 3300003761 Bacteria 181954
47 Ga0055535_1000058 3300003761 Bacteria 125370
48 Ga0055535_1000149 3300003761 Bacteria 74091
49 Ga0055535_1000424 3300003761 Bacteria 39544
50 Ga0055542_1000081 3300003762 Bacteria 129595
51 Ga0055542_1000085 3300003762 Bacteria 125370
52 Ga0055542_1000112 3300003762 Bacteria 107429
53 Ga0055542_1000134 3300003762 Bacteria 94890
54 Ga0055542_1000250 3300003762 Bacteria 61397
55 Ga0055542_1000503 3300003762 Bacteria 35709
56 Ga0055529_1000083 3300003763 Bacteria 146729
57 Ga0055529_1000107 3300003763 Bacteria 122905
58 Ga0055529_1000173 3300003763 Bacteria 88663
59 Ga0055529_1000830 3300003763 Bacteria 18257
60 Ga0055529_1004448 3300003763 Bacteria 2130
61 Ga0065165_1000157 3300005262 Bacteria 118005
62 Ga0070658_10020024 3300005327 Bacteria 5359
63 Ga0070676_10029931 3300005328 Bacteria 3100
64 Ga0068869_100133004 3300005334 Bacteria 1914
65 Ga0070666_10000005 3300005335 Bacteria 343092
66 Ga0070680_100000962 3300005336 Bacteria 20385
67 Ga0070680_100211347 3300005336 Bacteria 1637
68 Ga0070682_100013674 3300005337 Bacteria 4676
69 Ga0070682_100036100 3300005337 Bacteria 3020
70 Ga0070682_100052640 3300005337 Bacteria 2548
71 Ga0070682_100083093 3300005337 Bacteria 2077
72 Ga0068868_100060198 3300005338 Bacteria 3006
73 Ga0070660_100021136 3300005339 Bacteria 4795
74 Ga0070660_100026970 3300005339 Bacteria 4282
75 Ga0070660_100070386 3300005339 Bacteria 2730
76 Ga0070689_100003960 3300005340 Bacteria 9945
77 Ga0070691_10000750 3300005341 Bacteria 12791
78 Ga0070661_100002828 3300005344 Bacteria 11929
79 Ga0070661_100025681 3300005344 Bacteria 4235
80 Ga0070661_100144397 3300005344 Bacteria 1795
81 Ga0070692_10003484 3300005345 Bacteria 6385
82 Ga0070692_10047255 3300005345 Bacteria 2227
83 Ga0070668_100014597 3300005347 Bacteria 5872
84 Ga0070675_100081524 3300005354 Bacteria 2698
85 Ga0070659_100008670 3300005366 Bacteria 7436
86 Ga0070659_100106952 3300005366 Bacteria 2255
87 Ga0070659_100153987 3300005366 Bacteria 1876
88 Ga0070714_100000079 3300005435 Bacteria 82899
89 Ga0070714_100001985 3300005435 Bacteria 14951
90 Ga0070714_100104506 3300005435 Bacteria 2499
91 Ga0070711_100043758 3300005439 Bacteria 3035
92 Ga0070711_100338174 3300005439 Bacteria 1207
93 Ga0070663_100076485 3300005455 Bacteria 2448
94 Ga0070662_100072022 3300005457 Bacteria 2550
95 Ga0070681_10001678 3300005458 Bacteria 19781
96 Ga0070681_10003236 3300005458 Bacteria 15189
97 Ga0070681_10019170 3300005458 Bacteria 6846
98 Ga0070681_10040729 3300005458 Bacteria 4654
99 Ga0070681_10049674 3300005458 Bacteria 4188
100 Ga0070681_10065542 3300005458 Bacteria 3600
101 Ga0070681_10364768 3300005458 Bacteria 1355
102 Ga0068867_100392717 3300005459 Bacteria 1168
103 Ga0070685_10010099 3300005466 Bacteria 4897
104 Ga0070679_100000544 3300005530 Bacteria 32045
105 Ga0070679_100001710 3300005530 Bacteria 19781
106 Ga0070679_100002570 3300005530 Bacteria 16476
107 Ga0070679_100111886 3300005530 Bacteria 2716
108 Ga0070679_100114322 3300005530 Bacteria 2684
109 Ga0068853_100042501 3300005539 Bacteria 3886
110 Ga0068853_100213545 3300005539 Bacteria 1759
111 Ga0070672_100061062 3300005543 Bacteria 2970
112 Ga0070696_100012517 3300005546 Bacteria 5694
113 Ga0070696_100039428 3300005546 Bacteria 3261
114 Ga0070693_100019676 3300005547 Bacteria 3545
115 Ga0070665_100002911 3300005548 Bacteria 18499
116 Ga0070665_100006594 3300005548 Bacteria 11798
117 Ga0068855_100009625 3300005563 Bacteria 11657
118 Ga0068855_100021410 3300005563 Bacteria 7753
119 Ga0068855_100028046 3300005563 Bacteria 6734
120 Ga0068855_100113488 3300005563 Bacteria 3108
121 Ga0068855_100321170 3300005563 Bacteria 1711
122 Ga0070664_100220520 3300005564 Bacteria 1697
123 Ga0068857_100000573 3300005577 Bacteria 26921
124 Ga0068857_100036303 3300005577 Bacteria 4368
125 Ga0068857_100251419 3300005577 Bacteria 1620
126 Ga0068854_100000455 3300005578 Bacteria 25249
127 Ga0068854_100004459 3300005578 Bacteria 8831
128 Ga0068854_100033157 3300005578 Bacteria 3599
129 Ga0068854_100047091 3300005578 Bacteria 3072
130 Ga0068854_100095115 3300005578 Bacteria 2223
131 Ga0068856_100001826 3300005614 Bacteria 22258
132 Ga0068856_100011459 3300005614 Bacteria 8605
133 Ga0068852_100014031 3300005616 Bacteria 6149
134 Ga0068852_100029880 3300005616 Bacteria 4480
135 Ga0068852_100103311 3300005616 Bacteria 2577
136 Ga0068852_100167194 3300005616 Bacteria 2058
137 Ga0068852_100255423 3300005616 Bacteria 1681
138 Ga0068851_10014337 3300005834 Bacteria 3763
139 Ga0068858_100058951 3300005842 Bacteria 3548
140 Ga0068860_100118857 3300005843 Bacteria 2530
141 Ga0070712_100087436 3300006175 Bacteria 2274
142 Ga0105240_10000298 3300009093 Bacteria 96724
143 Ga0105240_10001857 3300009093 Bacteria 35309
144 Ga0105240_10008267 3300009093 Bacteria 14897
145 Ga0105240_10033211 3300009093 Bacteria 6670
146 Ga0105240_10104508 3300009093 Bacteria 3439
147 Ga0105240_10156323 3300009093 Bacteria 2711
148 Ga0105247_10003125 3300009101 Bacteria 10930
149 Ga0105241_10011431 3300009174 Bacteria 6508
150 Ga0105241_10044962 3300009174 Bacteria 3348
151 Ga0105241_10155036 3300009174 Bacteria 1877
152 Ga0105237_10000023 3300009545 Bacteria 226144
153 Ga0105237_10132777 3300009545 Bacteria 2484
154 Ga0105237_10394014 3300009545 Bacteria 1389
155 Ga0105238_10000060 3300009551 Bacteria 129934
156 Ga0105238_10014194 3300009551 Bacteria 8058
157 Ga0105238_10016291 3300009551 Bacteria 7524
158 Ga0105239_10000044 3300010375 Bacteria 187680
159 Ga0105239_10021311 3300010375 Bacteria 7146
160 Ga0105239_10025794 3300010375 Bacteria 6473
161 Ga0105239_10029949 3300010375 Bacteria 5986
162 Ga0105239_10040405 3300010375 Bacteria 5111
163 Ga0105239_10046422 3300010375 Bacteria 4760
164 Ga0105239_10223572 3300010375 Bacteria 2111
165 Ga0157314_1000032 3300012500 Bacteria 13500
166 Ga0157373_10025438 3300013100 Bacteria 4281
167 Ga0157373_10081770 3300013100 Bacteria 2277
168 Ga0157373_10085090 3300013100 Bacteria 2229
169 Ga0157371_10015942 3300013102 Bacteria 5622
170 Ga0157371_10076776 3300013102 Bacteria 2365
171 Ga0157371_10128027 3300013102 Bacteria 1806
172 Ga0157370_10000813 3300013104 Bacteria 39470
173 Ga0157370_10003679 3300013104 Bacteria 17908
174 Ga0157370_10005119 3300013104 Bacteria 14786
175 Ga0157370_10009565 3300013104 Bacteria 10329
176 Ga0157370_10015593 3300013104 Bacteria 7721
177 Ga0157370_10018018 3300013104 Bacteria 7108
178 Ga0157370_10105705 3300013104 Bacteria 2635
179 Ga0157370_10246668 3300013104 Bacteria 1652
180 Ga0157370_10290728 3300013104 Bacteria 1509
181 Ga0157369_10000028 3300013105 Bacteria 213910
182 Ga0157369_10000080 3300013105 Bacteria 133011
183 Ga0157369_10021166 3300013105 Bacteria 7271
184 Ga0157369_10128534 3300013105 Bacteria 2686
185 Ga0157369_10129308 3300013105 Bacteria 2677
186 Ga0157374_10083523 3300013296 Bacteria 3034
187 Ga0163162_10000060 3300013306 Bacteria 106982
188 Ga0157372_10003349 3300013307 Bacteria 17301
189 Ga0157372_10028027 3300013307 Bacteria 6143
190 Ga0157372_10029412 3300013307 Bacteria 5998
191 Ga0157372_10051236 3300013307 Bacteria 4594
192 Ga0157380_10172436 3300014326 Bacteria 1892
193 Ga0182008_10005463 3300014497 Bacteria 7237
194 Ga0182008_10034216 3300014497 Bacteria 2548
195 Ga0157376_10279957 3300014969 Bacteria 1570
196 Ga0182006_1000140 3300015261 Bacteria 77650
197 Ga0182006_1000222 3300015261 Bacteria 55421
198 Ga0182007_10036061 3300015262 Bacteria 1665
199 Ga0182007_10036761 3300015262 Bacteria 1646
200 Ga0182005_1000028 3300015265 Bacteria 221889
201 Ga0182005_1003015 3300015265 Bacteria 5821
202 Ga0182005_1004381 3300015265 Bacteria 4575
203 Ga0182005_1011020 3300015265 Bacteria 2587
204 Ga0183369_1008 3300015685 Bacteria 346514
205 Ga0183368_1003 3300015687 Bacteria 1276390
206 Ga0163161_10001842 3300017792 Bacteria 15488
207 Ga0197907_10018156 3300020069 Bacteria 1245
208 Ga0206356_10117802 3300020070 Bacteria 11463
209 Ga0206356_10611923 3300020070 Bacteria 4503
210 Ga0206354_10508562 3300020081 Bacteria 3128
211 Ga0206354_10839745 3300020081 Bacteria 4579
212 Ga0206353_10202306 3300020082 Bacteria 4519
213 Ga0154015_1117584 3300020610 Bacteria 5500
214 Ga0209435_101622 3300025206 Bacteria 2768
215 Ga0209760_100241 3300025207 Bacteria 22788
216 Ga0209784_100016 3300025224 Bacteria 481036
217 Ga0209566_101596 3300025225 Bacteria 5993
218 Ga0209674_100012 3300025226 Bacteria 950162
219 Ga0209674_100141 3300025226 Bacteria 108978
220 Ga0209674_101045 3300025226 Bacteria 8400
221 Ga0209674_101076 3300025226 Bacteria 8165
222 Ga0209672_100007 3300025228 Bacteria 959482
223 Ga0209672_100018 3300025228 Bacteria 432924
224 Ga0209672_100161 3300025228 Bacteria 57457
225 Ga0209672_100446 3300025228 Bacteria 23350
226 Ga0209672_102265 3300025228 Bacteria 4953
227 Ga0209563_100071 3300025230 Bacteria 232653
228 Ga0207427_100019 3300025231 Bacteria 513977
229 Ga0207427_100036 3300025231 Bacteria 309540
230 Ga0207427_100050 3300025231 Bacteria 227233
231 Ga0207427_100123 3300025231 Bacteria 98859
232 Ga0207427_101984 3300025231 Bacteria 6231
233 Ga0209437_100012 3300025233 Bacteria 792625
234 Ga0209437_100120 3300025233 Bacteria 205054
235 Ga0209437_100127 3300025233 Bacteria 190741
236 Ga0209437_100227 3300025233 Bacteria 98939
237 Ga0209437_100289 3300025233 Bacteria 73049
238 Ga0209437_102524 3300025233 Bacteria 3524
239 Ga0209258_100017 3300025242 Bacteria 590785
240 Ga0209258_100024 3300025242 Bacteria 542096
241 Ga0209258_100035 3300025242 Bacteria 430864
242 Ga0209258_100039 3300025242 Bacteria 386366
243 Ga0209258_100256 3300025242 Bacteria 93548
244 Ga0209258_100308 3300025242 Bacteria 77195
245 Ga0209646_1000426 3300025246 Bacteria 23498
246 Ga0209646_1001098 3300025246 Bacteria 8038
247 Ga0209646_1007686 3300025246 Bacteria 1750
248 Ga0209026_1000012 3300025250 Bacteria 480426
249 Ga0209026_1000281 3300025250 Bacteria 58797
250 Ga0209026_1000370 3300025250 Bacteria 41493
251 Ga0209026_1000594 3300025250 Bacteria 23615
252 Ga0209026_1001678 3300025250 Bacteria 9299
253 Ga0209026_1002746 3300025250 Bacteria 6297
254 Ga0209026_1008071 3300025250 Bacteria 2255
255 Ga0209148_1000001 3300025254 Bacteria 2545271
256 Ga0209148_1000005 3300025254 Bacteria 1806504
257 Ga0209148_1000009 3300025254 Bacteria 1395625
258 Ga0209148_1000045 3300025254 Bacteria 448076
259 Ga0209148_1000048 3300025254 Bacteria 430913
260 Ga0209148_1000084 3300025254 Bacteria 268147
261 Ga0209148_1001279 3300025254 Bacteria 13736
262 Ga0209759_1000450 3300025256 Bacteria 47646
263 Ga0209759_1000616 3300025256 Bacteria 34040
264 Ga0209759_1001730 3300025256 Bacteria 11243
265 Ga0209759_1003861 3300025256 Bacteria 5801
266 Ga0209759_1004008 3300025256 Bacteria 5644
267 Ga0209759_1004592 3300025256 Bacteria 5090
268 Ga0209129_1001077 3300025258 Bacteria 16093
269 Ga0209129_1002771 3300025258 Bacteria 8166
270 Ga0209233_1000002 3300025261 Bacteria 2501366
271 Ga0209233_1000101 3300025261 Bacteria 286063
272 Ga0209233_1000174 3300025261 Bacteria 144639
273 Ga0209233_1000283 3300025261 Bacteria 70137
274 Ga0209233_1013154 3300025261 Bacteria 2369
275 Ga0209455_1000010 3300025272 Bacteria 959482
276 Ga0209455_1000029 3300025272 Bacteria 542096
277 Ga0209455_1000035 3300025272 Bacteria 479071
278 Ga0209455_1000039 3300025272 Bacteria 437734
279 Ga0209455_1000465 3300025272 Bacteria 30599
280 Ga0209455_1003533 3300025272 Bacteria 5487
281 Ga0209455_1007348 3300025272 Bacteria 3122
282 Ga0209758_1001696 3300025297 Bacteria 24789
283 Ga0207680_10000002 3300025903 Bacteria 1018646
284 Ga0207647_10000099 3300025904 Bacteria 66290
285 Ga0207647_10000508 3300025904 Bacteria 31144
286 Ga0207647_10008285 3300025904 Bacteria 7461
287 Ga0207647_10010351 3300025904 Bacteria 6585
288 Ga0207647_10076669 3300025904 Bacteria 2011
289 Ga0207647_10123863 3300025904 Bacteria 1523
290 Ga0207647_10131835 3300025904 Bacteria 1468
291 Ga0207645_10008451 3300025907 Bacteria 7181
292 Ga0207705_10000177 3300025909 Bacteria 67227
293 Ga0207705_10001625 3300025909 Bacteria 17827
294 Ga0207705_10001831 3300025909 Bacteria 16737
295 Ga0207705_10015872 3300025909 Bacteria 5408
296 Ga0207705_10174247 3300025909 Bacteria 1621
297 Ga0207705_10249795 3300025909 Bacteria 1353
298 Ga0207654_10016196 3300025911 Bacteria 3879
299 Ga0207707_10000057 3300025912 Bacteria 113186
300 Ga0207707_10000175 3300025912 Bacteria 66455
301 Ga0207707_10000349 3300025912 Bacteria 48530
302 Ga0207707_10002782 3300025912 Bacteria 15602
303 Ga0207707_10004791 3300025912 Bacteria 11869
304 Ga0207707_10009108 3300025912 Bacteria 8624
305 Ga0207707_10013431 3300025912 Bacteria 7138
306 Ga0207695_10000294 3300025913 Bacteria 123676
307 Ga0207695_10001363 3300025913 Bacteria 41421
308 Ga0207695_10001492 3300025913 Bacteria 39028
309 Ga0207695_10004050 3300025913 Bacteria 20151
310 Ga0207695_10005500 3300025913 Bacteria 16770
311 Ga0207695_10009944 3300025913 Bacteria 11691
312 Ga0207695_10024639 3300025913 Bacteria 6759
313 Ga0207695_10033006 3300025913 Bacteria 5656
314 Ga0207695_10038003 3300025913 Bacteria 5190
315 Ga0207695_10064214 3300025913 Bacteria 3781
316 Ga0207671_10000020 3300025914 Bacteria 309636
317 Ga0207671_10000033 3300025914 Bacteria 245869
318 Ga0207671_10000374 3300025914 Bacteria 63535
319 Ga0207671_10004418 3300025914 Bacteria 13469
320 Ga0207693_10109038 3300025915 Bacteria 2172
321 Ga0207663_10066747 3300025916 Bacteria 2304
322 Ga0207660_10000836 3300025917 Bacteria 20276
323 Ga0207660_10001207 3300025917 Bacteria 17303
324 Ga0207660_10001350 3300025917 Bacteria 16443
325 Ga0207660_10004194 3300025917 Bacteria 9380
326 Ga0207660_10006503 3300025917 Bacteria 7583
327 Ga0207660_10100704 3300025917 Bacteria 2158
328 Ga0207660_10148984 3300025917 Bacteria 1796
329 Ga0207657_10007838 3300025919 Bacteria 10897
330 Ga0207657_10063806 3300025919 Bacteria 3147
331 Ga0207657_10076899 3300025919 Bacteria 2815
332 Ga0207657_10081366 3300025919 Bacteria 2721
333 Ga0207649_10035698 3300025920 Bacteria 2989
334 Ga0207649_10057799 3300025920 Bacteria 2426
335 Ga0207649_10123433 3300025920 Bacteria 1749
336 Ga0207652_10000135 3300025921 Bacteria 78257
337 Ga0207652_10000433 3300025921 Bacteria 43405
338 Ga0207652_10002130 3300025921 Bacteria 16981
339 Ga0207652_10021550 3300025921 Bacteria 5318
340 Ga0207652_10022180 3300025921 Bacteria 5248
341 Ga0207652_10226015 3300025921 Bacteria 1687
342 Ga0207694_10000401 3300025924 Bacteria 40347
343 Ga0207694_10074539 3300025924 Bacteria 2656
344 Ga0207694_10146502 3300025924 Bacteria 1901
345 Ga0207700_10016919 3300025928 Bacteria 4856
346 Ga0207664_10000036 3300025929 Bacteria 173396
347 Ga0207664_10000858 3300025929 Bacteria 20574
348 Ga0207690_10005624 3300025932 Bacteria 7407
349 Ga0207690_10014477 3300025932 Bacteria 4764
350 Ga0207690_10015534 3300025932 Bacteria 4615
351 Ga0207690_10031465 3300025932 Bacteria 3395
352 Ga0207690_10055295 3300025932 Bacteria 2672
353 Ga0207706_10015842 3300025933 Bacteria 6817
354 Ga0207706_10060077 3300025933 Bacteria 3348
355 Ga0207706_10175507 3300025933 Bacteria 1882
356 Ga0207670_10001638 3300025936 Bacteria 11687
357 Ga0207691_10078303 3300025940 Bacteria 2976
358 Ga0207711_10357794 3300025941 Bacteria 1352
359 Ga0207689_10103565 3300025942 Bacteria 2338
360 Ga0207661_10001782 3300025944 Bacteria 14719
361 Ga0207661_10032861 3300025944 Bacteria 4023
362 Ga0207679_10173327 3300025945 Bacteria 1778
363 Ga0207679_10195374 3300025945 Bacteria 1686
364 Ga0207667_10000094 3300025949 Bacteria 145771
365 Ga0207667_10000238 3300025949 Bacteria 76840
366 Ga0207667_10000715 3300025949 Bacteria 43073
367 Ga0207667_10001738 3300025949 Bacteria 27400
368 Ga0207667_10005232 3300025949 Bacteria 15828
369 Ga0207667_10014090 3300025949 Bacteria 9128
370 Ga0207667_10037122 3300025949 Bacteria 5211
371 Ga0207667_10126925 3300025949 Bacteria 2628
372 Ga0207668_10102234 3300025972 Bacteria 2132
373 Ga0207640_10000043 3300025981 Bacteria 102669
374 Ga0207640_10000277 3300025981 Bacteria 34453
375 Ga0207640_10008705 3300025981 Bacteria 5645
376 Ga0207640_10010637 3300025981 Bacteria 5189
377 Ga0207640_10032779 3300025981 Bacteria 3224
378 Ga0207640_10041767 3300025981 Bacteria 2919
379 Ga0207640_10092929 3300025981 Bacteria 2094
380 Ga0207703_10072134 3300026035 Bacteria 2854
381 Ga0207639_10000896 3300026041 Bacteria 20197
382 Ga0207639_10028522 3300026041 Bacteria 4076
383 Ga0207639_10058456 3300026041 Bacteria 2966
384 Ga0207639_10064337 3300026041 Bacteria 2843
385 Ga0207678_10003994 3300026067 Bacteria 13273
386 Ga0207678_10005247 3300026067 Bacteria 11604
387 Ga0207678_10037497 3300026067 Bacteria 4215
388 Ga0207678_10060292 3300026067 Bacteria 3263
389 Ga0207678_10252592 3300026067 Bacteria 1510
390 Ga0207702_10000167 3300026078 Bacteria 78662
391 Ga0207702_10003104 3300026078 Bacteria 15406
392 Ga0207702_10023241 3300026078 Bacteria 5141
393 Ga0207702_10216431 3300026078 Bacteria 1783
394 Ga0207702_10312871 3300026078 Bacteria 1493
395 Ga0207674_10000074 3300026116 Bacteria 105369
396 Ga0207674_10005145 3300026116 Bacteria 15602
397 Ga0207674_10010110 3300026116 Bacteria 10726
398 Ga0207674_10047914 3300026116 Bacteria 4378
399 Ga0207698_10008359 3300026142 Bacteria 6541
400 Ga0207698_10013399 3300026142 Bacteria 5408
401 Ga0207698_10023562 3300026142 Bacteria 4302
402 Ga0207698_10083089 3300026142 Bacteria 2591
403 Ga0207698_10213689 3300026142 Bacteria 1737
404 Ga0209974_10016508 3300027876 Bacteria 2452
405 Ga0268266_10000004 3300028379 Bacteria 1495817
406 Ga0268265_10104729 3300028380 Bacteria 2294
407 Ga0268264_10099024 3300028381 Bacteria 2530
408 Ga0316575_10021316 3300031665 Bacteria 2493
409 Ga0307412_10001235 3300031911 Bacteria 14469
410 Ga0307510_10018989 3300033180 Bacteria 8066
411 Ga0307510_10026445 3300033180 Bacteria 6670
412 Ga0395899_0000119 3300037312 Bacteria 127184
413 Ga0395899_0026995 3300037312 Bacteria 4331
414 Ga0395899_0059325 3300037312 Bacteria 2820
415 Ga0395899_0064622 3300037312 Bacteria 2690
416 Ga0395899_0102191 3300037312 Bacteria 2068
417 Ga0395899_0108314 3300037312 Bacteria 1999
418 Ga0395900_0000333 3300037418 Bacteria 69342
419 Ga0395900_0029174 3300037418 Bacteria 5658
420 Ga0395900_0173886 3300037418 Bacteria 2191
421 Ga0395900_0303022 3300037418 Bacteria 1583
422 Ga0395898_0000078 3300037466 Bacteria 244514
423 Ga0395898_0000211 3300037466 Bacteria 149301
424 Ga0395898_0059229 3300037466 Bacteria 3726
425 Ga0395898_0109761 3300037466 Bacteria 2644
426 Ga0395898_0274355 3300037466 Bacteria 1608
427 Ga0395905_0271372 3300037471 Bacteria 1582
428 Ga0395901_0003349 3300038443 Bacteria 16152
429 Ga0395901_0015121 3300038443 Bacteria 7848
430 Ga0395901_0040362 3300038443 Bacteria 4833
431 Ga0395901_0073213 3300038443 Bacteria 3572
432 Ga0395901_0153632 3300038443 Bacteria 2417
433 Ga0436365_0822627 3300039437 Bacteria 2088
434 Ga0439436_0000011 3300041404 Bacteria 100668
435 Ga0439465_0003294 3300041413 Bacteria 5275
436 Ga0451793_1639987 3300041452 Bacteria 4526
437 Ga0451807_0380006 3300041486 Bacteria 1796
438 Ga0451807_1531267 3300041486 Bacteria 2332
439 Ga0451837_0923555 3300041494 Bacteria 3599
440 Ga0450908_000023 3300042184 Bacteria 36671
441 Ga0439459_0008053 3300042438 Bacteria 1792
442 Ga0451577_0173121 3300042876 Bacteria 1945
443 Ga0466982_0000009 3300044672 Bacteria 221166
444 Ga0466982_0000036 3300044672 Bacteria 43109
445 Ga0466965_0015843 3300044683 Bacteria 3581
446 Ga0466966_0038369 3300044684 Bacteria 3087
447 Ga0466961_0001124 3300044693 Bacteria 16407
448 Ga0466961_0002245 3300044693 Bacteria 12024
449 Ga0466961_0003441 3300044693 Bacteria 9872
450 Ga0466961_0097413 3300044693 Bacteria 1854
451 Ga0466961_0100959 3300044693 Bacteria 1817
452 Ga0453684_0064854 3300044712 Bacteria 4661
453 Ga0453684_0079373 3300044712 Bacteria 4103
454 Ga0466968_0000703 3300044735 Bacteria 11544
455 Ga0466957_0011086 3300044842 Bacteria 5189
456 Ga0466957_0011406 3300044842 Bacteria 5127
457 Ga0466957_0011738 3300044842 Bacteria 5063
458 Ga0466960_0007138 3300044901 Bacteria 4520
459 Ga0466959_0000007 3300045049 Bacteria 184664
460 Ga0466959_0012370 3300045049 Bacteria 6164
461 Ga0466959_0089661 3300045049 Bacteria 2209
462 Ga0466958_0033562 3300045836 Bacteria 3058
463 Ga0466967_0100901 3300045976 Bacteria 2637
464 Ga0495617_000077 3300046452 Bacteria 77203
465 Ga0495638_0000007 3300046460 Bacteria 602783
466 Ga0495638_0000078 3300046460 Bacteria 157545
467 Ga0495638_0000159 3300046460 Bacteria 106490
468 Ga0495638_0000161 3300046460 Bacteria 104406
469 Ga0495650_0000197 3300046471 Bacteria 131300
470 Ga0495650_0000686 3300046471 Bacteria 43752
471 Ga0495650_0000984 3300046471 Bacteria 32560
472 Ga0495650_0045039 3300046471 Bacteria 1860
473 Ga0495585_0000080 3300046492 Bacteria 99617
474 Ga0495585_0001139 3300046492 Bacteria 21767
475 Ga0495607_0000144 3300046501 Bacteria 74813
476 Ga0495607_0000954 3300046501 Bacteria 26747
477 Ga0495606_0000227 3300046507 Bacteria 99782
478 Ga0495606_0000340 3300046507 Bacteria 80328
479 Ga0495606_0001905 3300046507 Bacteria 25977
480 Ga0495606_0011714 3300046507 Bacteria 7116
481 Ga0495606_0200041 3300046507 Bacteria 1139
482 Ga0495610_0001128 3300046512 Bacteria 24366
483 Ga0495616_0000036 3300046513 Bacteria 128264
484 Ga0495620_0000164 3300046515 Bacteria 52861
485 Ga0495620_0002441 3300046515 Bacteria 10767
486 Ga0495631_0000017 3300046518 Bacteria 98047
487 Ga0495631_0001882 3300046518 Bacteria 12374
488 Ga0495632_0000004 3300046519 Bacteria 381372
489 Ga0495632_0000786 3300046519 Bacteria 28264
490 Ga0495632_0012006 3300046519 Bacteria 5018
491 Ga0495648_0001369 3300046524 Bacteria 24049
492 Ga0495648_0005091 3300046524 Bacteria 11030
493 Ga0495668_0014064 3300046616 Bacteria 4702
494 Ga0495668_0101678 3300046616 Bacteria 1572
495 Ga0495611_0000001 3300046648 Bacteria 2628469
496 Ga0495611_0000022 3300046648 Bacteria 122452
497 Ga0495625_0000347 3300046660 Bacteria 70714
498 Ga0495625_0002925 3300046660 Bacteria 17828
499 Ga0495661_0000657 3300046665 Bacteria 34630
500 Ga0495661_0145488 3300046665 Bacteria 1285
501 Ga0495588_0084149 3300046674 Bacteria 1662
502 Ga0495670_0008759 3300046691 Bacteria 4979
503 Ga0495671_0000240 3300046692 Bacteria 47354
504 Ga0495649_0010282 3300046694 Bacteria 5525
505 Ga0495649_0011052 3300046694 Bacteria 5318
506 Ga0495589_0000053 3300046794 Bacteria 111458
507 Ga0495660_0000094 3300046810 Bacteria 94870
508 Ga0495660_0000233 3300046810 Bacteria 54493
509 Ga0495683_0001315 3300047323 Bacteria 16676
510 Ga0495679_000004 3300047446 Bacteria 748056
511 Ga0495673_0000004 3300047469 Bacteria 1354526
512 Ga0495673_0000048 3300047469 Bacteria 265950
513 Ga0495673_0000644 3300047469 Bacteria 34268
514 Ga0495673_0104932 3300047469 Bacteria 1137
515 Ga0495681_0043956 3300047470 Bacteria 2151
516 Ga0495681_0111610 3300047470 Bacteria 1183
517 Ga0495686_0000017 3300047472 Bacteria 435554
518 Ga0495686_0000295 3300047472 Bacteria 86824
519 Ga0495686_0087615 3300047472 Bacteria 1893
520 Ga0495686_0120563 3300047472 Bacteria 1564
521 Ga0496100_0005392 3300048903 Bacteria 6882
522 Ga0496101_0004248 3300048904 Bacteria 8986
523 Ga0496102_0163985 3300048905 Bacteria 2091
524 Ga0496104_0032740 3300048907 Bacteria 4839
525 Ga0496105_0002731 3300048908 Bacteria 12871
526 Ga0496106_0005759 3300048909 Bacteria 9161
527 Ga0496107_0020194 3300048910 Bacteria 4704
528 Ga0496113_0018146 3300048916 Bacteria 4897
529 Ga0496115_0000025 3300048918 Bacteria 151658
530 Ga0496115_0000456 3300048918 Bacteria 32724
531 Ga0496115_0016735 3300048918 Bacteria 5587
532 Ga0496115_0017124 3300048918 Bacteria 5531
533 Ga0496115_0023705 3300048918 Bacteria 4763
534 Ga0496116_0093510 3300048919 Bacteria 1820
535 Ga0496117_0004466 3300048920 Bacteria 15403
536 Ga0496117_0011123 3300048920 Bacteria 8092
537 Ga0496117_0024407 3300048920 Bacteria 4784
538 Ga0496118_0000177 3300048921 Bacteria 114183
539 Ga0496118_0000805 3300048921 Bacteria 50087
540 Ga0496118_0001746 3300048921 Bacteria 31556
541 Ga0496118_0002109 3300048921 Bacteria 27873
542 Ga0496118_0023825 3300048921 Bacteria 5305
543 Ga0496118_0079063 3300048921 Bacteria 2323
544 Ga0496119_0000707 3300048922 Bacteria 44778
545 Ga0496119_0019934 3300048922 Bacteria 4913
546 Ga0496120_0000446 3300048923 Bacteria 65398
547 Ga0496120_0001411 3300048923 Bacteria 29019
548 Ga0496120_0068573 3300048923 Bacteria 1956
549 Ga0496121_0000241 3300048924 Bacteria 117612
550 Ga0496121_0000372 3300048924 Bacteria 92348
551 Ga0496121_0002571 3300048924 Bacteria 27457
552 Ga0496121_0005654 3300048924 Bacteria 15904
553 Ga0496121_0027862 3300048924 Bacteria 5276
554 Ga0496121_0028953 3300048924 Bacteria 5141
555 Ga0496121_0068368 3300048924 Bacteria 2874
556 Ga0496122_0013080 3300048925 Bacteria 8170
557 Ga0496122_0055316 3300048925 Bacteria 2970
558 Ga0496122_0109729 3300048925 Bacteria 1815
559 Ga0496122_0139583 3300048925 Bacteria 1519
560 Ga0496122_0140817 3300048925 Bacteria 1509
561 Ga0496123_0008605 3300048926 Bacteria 9342
562 Ga0496123_0022737 3300048926 Bacteria 4822
563 Ga0496123_0088467 3300048926 Bacteria 1849
564 Ga0496124_0008309 3300048927 Bacteria 10866
565 Ga0496124_0008669 3300048927 Bacteria 10586
566 Ga0496125_0000892 3300048928 Bacteria 47309
567 Ga0496125_0005101 3300048928 Bacteria 14777
568 Ga0496126_0000199 3300048929 Bacteria 133742
569 Ga0496126_0000769 3300048929 Bacteria 57992
570 Ga0496126_0021995 3300048929 Bacteria 6215
571 Ga0496126_0025347 3300048929 Bacteria 5706
572 Ga0496126_0035482 3300048929 Bacteria 4674
573 Ga0496126_0043088 3300048929 Bacteria 4166
574 Ga0496126_0139067 3300048929 Bacteria 2092
575 Ga0495678_000276 3300049459 Bacteria 56670
576 Ga0495682_0004711 3300049460 Bacteria 5770
577 Ga0501031_0112889 3300049568 Bacteria 1775
578 Ga0501032_0013648 3300049569 Bacteria 5771
579 Ga0501033_0003142 3300049570 Bacteria 13728
580 Ga0501033_0153123 3300049570 Bacteria 1662
581 Ga0501034_0000462 3300049571 Bacteria 67291
582 Ga0501034_0033101 3300049571 Bacteria 5248
583 Ga0501034_0087735 3300049571 Bacteria 3110
584 Ga0501034_0182660 3300049571 Bacteria 2062
585 Ga0501034_0540514 3300049571 Bacteria 1075
586 Ga0501036_0198790 3300049572 Bacteria 1686
587 Ga0501037_0083137 3300049573 Bacteria 2319
588 Ga0501037_0314216 3300049573 Bacteria 1086
589 Ga0501038_0035121 3300049574 Bacteria 4403
590 Ga0501039_0075591 3300049575 Bacteria 2618
591 Ga0501043_0023760 3300049579 Bacteria 4808
592 Ga0501043_0048461 3300049579 Bacteria 3340
593 Ga0501043_0093824 3300049579 Bacteria 2359
594 Ga0501043_0100992 3300049579 Bacteria 2267
595 Ga0501043_0137019 3300049579 Bacteria 1917
596 Ga0501043_0209253 3300049579 Bacteria 1512
597 Ga0501046_0219429 3300049580 Bacteria 1408
598 Ga0501047_0021876 3300049581 Bacteria 6140
599 Ga0501047_0038226 3300049581 Bacteria 4643
600 Ga0501047_0068553 3300049581 Bacteria 3416
601 Ga0501047_0079729 3300049581 Bacteria 3148
602 Ga0501047_0089672 3300049581 Bacteria 2952
603 Ga0501047_0294352 3300049581 Bacteria 1466
604 Ga0501048_0101764 3300049582 Bacteria 2027
605 Ga0501048_0110770 3300049582 Bacteria 1938
606 Ga0501048_0220704 3300049582 Bacteria 1344
607 Ga0501048_0230711 3300049582 Bacteria 1313
608 Ga0501068_0004463 3300049584 Bacteria 7613
609 Ga0501069_0000202 3300049585 Bacteria 26292
610 Ga0501069_0026292 3300049585 Bacteria 3187
611 Ga0501070_0000062 3300049586 Bacteria 92290
612 Ga0501070_0001521 3300049586 Bacteria 20654
613 Ga0501070_0003611 3300049586 Bacteria 13360
614 Ga0501070_0008534 3300049586 Bacteria 8664
615 Ga0501070_0011198 3300049586 Bacteria 7571
616 Ga0501070_0023671 3300049586 Bacteria 5146
617 Ga0501070_0062978 3300049586 Bacteria 3072
618 Ga0501073_0014451 3300049589 Bacteria 5736
619 Ga0501073_0016155 3300049589 Bacteria 5410
620 Ga0501073_0018129 3300049589 Bacteria 5089
621 Ga0501073_0028815 3300049589 Bacteria 3968
622 Ga0501073_0079902 3300049589 Bacteria 2276
623 Ga0501073_0390464 3300049589 Bacteria 961
624 Ga0501074_0001791 3300049590 Bacteria 14692
625 Ga0501074_0003782 3300049590 Bacteria 10752
626 Ga0501074_0005621 3300049590 Bacteria 9027
627 Ga0501074_0014312 3300049590 Bacteria 5770
628 Ga0501079_0064932 3300049741 Bacteria 2816
629 Ga0501080_0001205 3300049742 Bacteria 21436
630 Ga0501080_0017505 3300049742 Bacteria 6627
631 Ga0501080_0107539 3300049742 Bacteria 2585
632 Ga0501080_0202074 3300049742 Bacteria 1824
633 Ga0501080_0272920 3300049742 Bacteria 1539
634 Ga0501035_0013449 3300049822 Bacteria 7556
635 Ga0501035_0020895 3300049822 Bacteria 6016
636 Ga0501035_0039148 3300049822 Bacteria 4291
637 Ga0501035_0076121 3300049822 Bacteria 2968
638 Ga0501035_0196950 3300049822 Bacteria 1730
639 Ga0501044_0016312 3300049823 Bacteria 7979
640 Ga0501044_0027747 3300049823 Bacteria 5977
641 Ga0501044_0035105 3300049823 Bacteria 5253
642 Ga0501044_0042303 3300049823 Bacteria 4739
643 Ga0501044_0052151 3300049823 Bacteria 4216
644 Ga0501044_0053580 3300049823 Bacteria 4150
645 Ga0501044_0102082 3300049823 Bacteria 2884
646 Ga0501045_0176358 3300049824 Bacteria 1592
647 Ga0500643_000020 3300053087 Bacteria 290328
648 Ga0500651_0000201 3300053093 Bacteria 37864
649 Ga0500555_000855 3300053103 Bacteria 10885
650 Ga0500633_0005303 3300053160 Bacteria 3050
651 Ga0500645_001658 3300053730 Bacteria 10941
652 Ga0466962_0004485 3300061719 Bacteria 6692
653 Ga0530510_0191094 3300061734 Bacteria 1520

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037418 Ga0395900_0303022 Ga0395900_0303022_18_899 290
2 3300014326 Ga0157380_10172436 Ga0157380_101724362 299
3 3300049589 Ga0501073_0390464 Ga0501073_0390464_27_935 301
4 3300047470 Ga0495681_0111610 Ga0495681_0111610_14_994 320
5 3300044693 Ga0466961_0100959 Ga0466961_0100959_17_994 322
6 3300005563 Ga0068855_100113488 Ga0068855_1001134884 334
7 iso_pu_bacteria 2537561836 2538832874 335
8 iso_pu_bacteria 2643221577 2643895319 335
9 iso_pu_bacteria 2643221685 2644477489 335
10 3300002705 JGI25156J39149_1012543 JGI25156J39149_10125432 339
11 3300003763 Ga0055529_1004448 Ga0055529_10044482 339
12 3300005614 Ga0068856_100011459 Ga0068856_1000114596 339
13 3300013104 Ga0157370_10105705 Ga0157370_101057052 339
14 3300025250 Ga0209026_1008071 Ga0209026_10080712 339
15 3300025256 Ga0209759_1004592 Ga0209759_10045922 339
16 3300025272 Ga0209455_1000465 Ga0209455_100046525 339
17 3300026078 Ga0207702_10000167 Ga0207702_100001676 339
18 3300027876 Ga0209974_10016508 Ga0209974_100165084 339
19 3300049570 Ga0501033_0153123 Ga0501033_0153123_122_1147 339
20 3300049571 Ga0501034_0540514 Ga0501034_0540514_37_1062 339
21 3300049573 Ga0501037_0314216 Ga0501037_0314216_47_1072 339
22 3300049579 Ga0501043_0093824 Ga0501043_0093824_695_1720 339
23 3300049823 Ga0501044_0016312 Ga0501044_0016312_6851_7876 339
24 3300042876 Ga0451577_0173121 Ga0451577_0173121_817_1866 340
25 3300044712 Ga0453684_0064854 Ga0453684_0064854_585_1634 340
26 3300044712 Ga0453684_0079373 Ga0453684_0079373_359_1408 340
27 iso_pu_bacteria 2593339238 2595446898 342
28 iso_pu_bacteria 2593339239 2595449661 342
29 iso_pu_bacteria 2643221562 2643830732 342
30 iso_pu_bacteria 2687453130 2687582803 342
31 iso_pu_bacteria 2739367700 2739731782 342
32 iso_pu_bacteria 2842914999 2842917602 342
33 iso_pu_bacteria 2842918807 2842919976 342
34 iso_pu_bacteria 2884411467 2884415035 342
35 iso_pu_bacteria 2895395659 2895396732 342
36 iso_pu_bacteria 2919085039 2919088230 342
37 iso_pu_bacteria 2919404418 2919406179 342
38 iso_pu_bacteria 2928963466 2928967241 342
39 iso_pu_bacteria 2953994433 2953995268 342
40 3300049570 Ga0501033_0003142 Ga0501033_0003142_2352_3398 343
41 3300049574 Ga0501038_0035121 Ga0501038_0035121_37_1083 343
42 3300049581 Ga0501047_0294352 Ga0501047_0294352_38_1084 343
43 3300049582 Ga0501048_0230711 Ga0501048_0230711_236_1282 343
44 3300049823 Ga0501044_0102082 Ga0501044_0102082_977_2023 343
45 iso_pu_bacteria 2718218334 2721026422 343
46 iso_pu_bacteria 2734482264 2735833591 343
47 iso_pu_bacteria 2738543009 2739229709 343
48 3300001915 JGI24741J21665_1000657 JGI24741J21665_10006576 344
49 3300005336 Ga0070680_100000962 Ga0070680_10000096210 344
50 3300005337 Ga0070682_100013674 Ga0070682_1000136742 344
51 3300005341 Ga0070691_10000750 Ga0070691_1000075011 344
52 3300005344 Ga0070661_100002828 Ga0070661_10000282811 344
53 3300005344 Ga0070661_100144397 Ga0070661_1001443972 344
54 3300005345 Ga0070692_10003484 Ga0070692_100034847 344
55 3300005455 Ga0070663_100076485 Ga0070663_1000764852 344
56 3300005458 Ga0070681_10003236 Ga0070681_100032368 344
57 3300005458 Ga0070681_10019170 Ga0070681_100191702 344
58 3300005458 Ga0070681_10364768 Ga0070681_103647681 344
59 3300005530 Ga0070679_100000544 Ga0070679_1000005445 344
60 3300005530 Ga0070679_100002570 Ga0070679_1000025706 344
61 3300005539 Ga0068853_100042501 Ga0068853_1000425014 344
62 3300005547 Ga0070693_100019676 Ga0070693_1000196762 344
63 3300005563 Ga0068855_100021410 Ga0068855_1000214103 344
64 3300005563 Ga0068855_100321170 Ga0068855_1003211702 344
65 3300005578 Ga0068854_100047091 Ga0068854_1000470912 344
66 3300005616 Ga0068852_100014031 Ga0068852_1000140315 344
67 3300005616 Ga0068852_100029880 Ga0068852_1000298804 344
68 3300005616 Ga0068852_100167194 Ga0068852_1001671942 344
69 3300005616 Ga0068852_100255423 Ga0068852_1002554231 344
70 3300005834 Ga0068851_10014337 Ga0068851_100143373 344
71 3300009093 Ga0105240_10104508 Ga0105240_101045082 344
72 3300009093 Ga0105240_10156323 Ga0105240_101563234 344
73 3300009174 Ga0105241_10011431 Ga0105241_100114312 344
74 3300009174 Ga0105241_10155036 Ga0105241_101550361 344
75 3300009545 Ga0105237_10132777 Ga0105237_101327772 344
76 3300009551 Ga0105238_10014194 Ga0105238_100141944 344
77 3300009551 Ga0105238_10016291 Ga0105238_100162916 344
78 3300010375 Ga0105239_10021311 Ga0105239_100213114 344
79 3300013100 Ga0157373_10085090 Ga0157373_100850902 344
80 3300013104 Ga0157370_10003679 Ga0157370_100036796 344
81 3300013104 Ga0157370_10015593 Ga0157370_100155932 344
82 3300013104 Ga0157370_10246668 Ga0157370_102466682 344
83 3300013104 Ga0157370_10290728 Ga0157370_102907282 344
84 3300013105 Ga0157369_10000028 Ga0157369_10000028115 344
85 3300013105 Ga0157369_10021166 Ga0157369_100211663 344
86 3300013105 Ga0157369_10129308 Ga0157369_101293083 344
87 3300013307 Ga0157372_10003349 Ga0157372_100033494 344
88 3300013307 Ga0157372_10051236 Ga0157372_100512365 344
89 3300020070 Ga0206356_10611923 Ga0206356_106119232 344
90 3300020082 Ga0206353_10202306 Ga0206353_102023062 344
91 3300025904 Ga0207647_10000508 Ga0207647_1000050825 344
92 3300025909 Ga0207705_10000177 Ga0207705_1000017715 344
93 3300025909 Ga0207705_10001625 Ga0207705_100016257 344
94 3300025909 Ga0207705_10249795 Ga0207705_102497952 344
95 3300025911 Ga0207654_10016196 Ga0207654_100161962 344
96 3300025912 Ga0207707_10000057 Ga0207707_1000005742 344
97 3300025912 Ga0207707_10000175 Ga0207707_1000017512 344
98 3300025912 Ga0207707_10002782 Ga0207707_1000278211 344
99 3300025913 Ga0207695_10001492 Ga0207695_1000149214 344
100 3300025913 Ga0207695_10004050 Ga0207695_100040503 344
101 3300025913 Ga0207695_10009944 Ga0207695_100099443 344
102 3300025913 Ga0207695_10038003 Ga0207695_100380034 344
103 3300025914 Ga0207671_10004418 Ga0207671_1000441811 344
104 3300025917 Ga0207660_10000836 Ga0207660_1000083613 344
105 3300025917 Ga0207660_10001207 Ga0207660_1000120715 344
106 3300025917 Ga0207660_10004194 Ga0207660_100041945 344
107 3300025919 Ga0207657_10007838 Ga0207657_100078387 344
108 3300025920 Ga0207649_10057799 Ga0207649_100577992 344
109 3300025920 Ga0207649_10123433 Ga0207649_101234333 344
110 3300025921 Ga0207652_10000135 Ga0207652_1000013549 344
111 3300025921 Ga0207652_10000433 Ga0207652_100004335 344
112 3300025924 Ga0207694_10074539 Ga0207694_100745392 344
113 3300025932 Ga0207690_10005624 Ga0207690_100056248 344
114 3300025933 Ga0207706_10015842 Ga0207706_100158425 344
115 3300025944 Ga0207661_10001782 Ga0207661_100017828 344
116 3300025949 Ga0207667_10000715 Ga0207667_100007152 344
117 3300025949 Ga0207667_10005232 Ga0207667_100052325 344
118 3300025949 Ga0207667_10014090 Ga0207667_100140909 344
119 3300025949 Ga0207667_10126925 Ga0207667_101269252 344
120 3300025981 Ga0207640_10008705 Ga0207640_100087056 344
121 3300025981 Ga0207640_10032779 Ga0207640_100327791 344
122 3300025981 Ga0207640_10092929 Ga0207640_100929292 344
123 3300026041 Ga0207639_10000896 Ga0207639_100008966 344
124 3300026041 Ga0207639_10028522 Ga0207639_100285226 344
125 3300026041 Ga0207639_10064337 Ga0207639_100643373 344
126 3300026067 Ga0207678_10003994 Ga0207678_100039942 344
127 3300026067 Ga0207678_10005247 Ga0207678_100052477 344
128 3300026078 Ga0207702_10216431 Ga0207702_102164313 344
129 3300026078 Ga0207702_10312871 Ga0207702_103128712 344
130 3300026116 Ga0207674_10005145 Ga0207674_100051455 344
131 3300026142 Ga0207698_10013399 Ga0207698_100133995 344
132 3300026142 Ga0207698_10023562 Ga0207698_100235625 344
133 3300026142 Ga0207698_10213689 Ga0207698_102136892 344
134 3300037312 Ga0395899_0026995 Ga0395899_0026995_2662_3705 344
135 3300037312 Ga0395899_0102191 Ga0395899_0102191_143_1186 344
136 3300037418 Ga0395900_0173886 Ga0395900_0173886_598_1641 344
137 3300037466 Ga0395898_0109761 Ga0395898_0109761_1240_2283 344
138 3300037466 Ga0395898_0274355 Ga0395898_0274355_553_1596 344
139 3300038443 Ga0395901_0040362 Ga0395901_0040362_451_1494 344
140 3300041486 Ga0451807_0380006 Ga0451807_0380006_424_1464 344
141 3300041494 Ga0451837_0923555 Ga0451837_0923555_661_1701 344
142 3300042438 Ga0439459_0008053 Ga0439459_0008053_170_1213 344
143 3300048907 Ga0496104_0032740 Ga0496104_0032740_1759_2799 344
144 3300049579 Ga0501043_0100992 Ga0501043_0100992_320_1363 344
145 3300049580 Ga0501046_0219429 Ga0501046_0219429_100_1143 344
146 3300049581 Ga0501047_0021876 Ga0501047_0021876_4771_5814 344
147 3300049582 Ga0501048_0101764 Ga0501048_0101764_129_1163 344
148 3300049582 Ga0501048_0220704 Ga0501048_0220704_114_1157 344
149 3300049584 Ga0501068_0004463 Ga0501068_0004463_37_1080 344
150 3300049590 Ga0501074_0003782 Ga0501074_0003782_2208_3251 344
151 3300049742 Ga0501080_0272920 Ga0501080_0272920_130_1179 344
152 3300061734 Ga0530510_0191094 Ga0530510_0191094_61_1104 344
153 iso_pu_bacteria 2818991440 2819564051 344
154 iso_pu_bacteria 2884338543 2884341575 344
155 iso_pu_bacteria 2904463128 2904464687 344
156 iso_pu_bacteria 2941471342 2941473017 344
157 3300005328 Ga0070676_10029931 Ga0070676_100299312 345
158 3300005334 Ga0068869_100133004 Ga0068869_1001330042 345
159 3300005338 Ga0068868_100060198 Ga0068868_1000601982 345
160 3300005347 Ga0070668_100014597 Ga0070668_1000145975 345
161 3300005354 Ga0070675_100081524 Ga0070675_1000815243 345
162 3300005439 Ga0070711_100043758 Ga0070711_1000437584 345
163 3300005543 Ga0070672_100061062 Ga0070672_1000610622 345
164 3300005548 Ga0070665_100006594 Ga0070665_1000065947 345
165 3300010375 Ga0105239_10223572 Ga0105239_102235722 345
166 3300013102 Ga0157371_10128027 Ga0157371_101280272 345
167 3300013307 Ga0157372_10029412 Ga0157372_100294125 345
168 3300025907 Ga0207645_10008451 Ga0207645_100084514 345
169 3300025916 Ga0207663_10066747 Ga0207663_100667473 345
170 3300025933 Ga0207706_10175507 Ga0207706_101755072 345
171 3300025940 Ga0207691_10078303 Ga0207691_100783032 345
172 3300025941 Ga0207711_10357794 Ga0207711_103577941 345
173 3300025942 Ga0207689_10103565 Ga0207689_101035652 345
174 3300046460 Ga0495638_0000007 Ga0495638_0000007_74282_75328 345
175 3300049585 Ga0501069_0000202 Ga0501069_0000202_11983_13032 345
176 3300001915 JGI24741J21665_1003851 JGI24741J21665_10038514 346
177 3300001979 JGI24740J21852_10006323 JGI24740J21852_100063232 346
178 3300002067 JGI24735J21928_10001618 JGI24735J21928_100016182 346
179 3300002075 JGI24738J21930_10000989 JGI24738J21930_100009893 346
180 3300002705 JGI25156J39149_1004866 JGI25156J39149_10048662 346
181 3300002705 JGI25156J39149_1010264 JGI25156J39149_10102642 346
182 3300002705 JGI25156J39149_1015099 JGI25156J39149_10150992 346
183 3300002737 JGI25162J39368_1000068 JGI25162J39368_1000068123 346
184 3300002737 JGI25162J39368_1000270 JGI25162J39368_100027035 346
185 3300002737 JGI25162J39368_1000991 JGI25162J39368_10009912 346
186 3300002737 JGI25162J39368_1002007 JGI25162J39368_10020076 346
187 3300002741 JGI25157J39369_1000068 JGI25157J39369_1000068125 346
188 3300002741 JGI25157J39369_1000333 JGI25157J39369_10003335 346
189 3300002741 JGI25157J39369_1004281 JGI25157J39369_10042812 346
190 3300002741 JGI25157J39369_1004468 JGI25157J39369_10044682 346
191 3300002741 JGI25157J39369_1006344 JGI25157J39369_10063441 346
192 3300002771 JGI25163J39215_1000711 JGI25163J39215_10007114 346
193 3300002772 JGI25164J39214_1000113 JGI25164J39214_100011375 346
194 3300002772 JGI25164J39214_1000216 JGI25164J39214_10002165 346
195 3300002772 JGI25164J39214_1000931 JGI25164J39214_10009314 346
196 3300003214 JGI25165J46597_1000058 JGI25165J46597_100005834 346
197 3300003214 JGI25165J46597_1000158 JGI25165J46597_100015899 346
198 3300003214 JGI25165J46597_1002857 JGI25165J46597_10028574 346
199 3300003320 rootH2_10020728 rootH2_1002072811 346
200 3300003751 Ga0055538_1000519 Ga0055538_10005192 346
201 3300003756 Ga0055533_1000980 Ga0055533_10009804 346
202 3300003760 Ga0055527_1000066 Ga0055527_100006610 346
203 3300003760 Ga0055527_1000092 Ga0055527_100009215 346
204 3300003760 Ga0055527_1000340 Ga0055527_10003407 346
205 3300003761 Ga0055535_1000034 Ga0055535_1000034183 346
206 3300003761 Ga0055535_1000058 Ga0055535_100005880 346
207 3300003761 Ga0055535_1000149 Ga0055535_100014925 346
208 3300003761 Ga0055535_1000424 Ga0055535_100042420 346
209 3300003762 Ga0055542_1000081 Ga0055542_1000081124 346
210 3300003762 Ga0055542_1000085 Ga0055542_100008580 346
211 3300003762 Ga0055542_1000112 Ga0055542_100011252 346
212 3300003762 Ga0055542_1000134 Ga0055542_100013446 346
213 3300003762 Ga0055542_1000250 Ga0055542_100025016 346
214 3300003762 Ga0055542_1000503 Ga0055542_10005035 346
215 3300003763 Ga0055529_1000083 Ga0055529_100008334 346
216 3300003763 Ga0055529_1000107 Ga0055529_100010770 346
217 3300003763 Ga0055529_1000173 Ga0055529_100017325 346
218 3300003763 Ga0055529_1000830 Ga0055529_100083017 346
219 3300005262 Ga0065165_1000157 Ga0065165_100015752 346
220 3300005327 Ga0070658_10020024 Ga0070658_100200245 346
221 3300005335 Ga0070666_10000005 Ga0070666_10000005277 346
222 3300005337 Ga0070682_100052640 Ga0070682_1000526402 346
223 3300005337 Ga0070682_100083093 Ga0070682_1000830932 346
224 3300005340 Ga0070689_100003960 Ga0070689_1000039607 346
225 3300005366 Ga0070659_100106952 Ga0070659_1001069521 346
226 3300005435 Ga0070714_100104506 Ga0070714_1001045062 346
227 3300005439 Ga0070711_100338174 Ga0070711_1003381741 346
228 3300005458 Ga0070681_10065542 Ga0070681_100655423 346
229 3300005459 Ga0068867_100392717 Ga0068867_1003927171 346
230 3300005466 Ga0070685_10010099 Ga0070685_100100992 346
231 3300005548 Ga0070665_100002911 Ga0070665_10000291114 346
232 3300005577 Ga0068857_100036303 Ga0068857_1000363034 346
233 3300005577 Ga0068857_100251419 Ga0068857_1002514192 346
234 3300005578 Ga0068854_100033157 Ga0068854_1000331572 346
235 3300005578 Ga0068854_100095115 Ga0068854_1000951152 346
236 3300005614 Ga0068856_100001826 Ga0068856_1000018263 346
237 3300005843 Ga0068860_100118857 Ga0068860_1001188572 346
238 3300006175 Ga0070712_100087436 Ga0070712_1000874362 346
239 3300009093 Ga0105240_10001857 Ga0105240_1000185718 346
240 3300009174 Ga0105241_10044962 Ga0105241_100449624 346
241 3300009551 Ga0105238_10000060 Ga0105238_1000006066 346
242 3300010375 Ga0105239_10025794 Ga0105239_100257946 346
243 3300010375 Ga0105239_10029949 Ga0105239_100299492 346
244 3300013100 Ga0157373_10081770 Ga0157373_100817703 346
245 3300013102 Ga0157371_10015942 Ga0157371_100159422 346
246 3300013104 Ga0157370_10000813 Ga0157370_1000081319 346
247 3300013296 Ga0157374_10083523 Ga0157374_100835232 346
248 3300013306 Ga0163162_10000060 Ga0163162_1000006016 346
249 3300014497 Ga0182008_10005463 Ga0182008_100054633 346
250 3300014969 Ga0157376_10279957 Ga0157376_102799572 346
251 3300015261 Ga0182006_1000222 Ga0182006_100022223 346
252 3300015262 Ga0182007_10036061 Ga0182007_100360611 346
253 3300015265 Ga0182005_1000028 Ga0182005_100002845 346
254 3300015265 Ga0182005_1004381 Ga0182005_10043812 346
255 3300015265 Ga0182005_1011020 Ga0182005_10110202 346
256 3300015685 Ga0183369_1008 Ga0183369_100822 346
257 3300015687 Ga0183368_1003 Ga0183368_1003968 346
258 3300025206 Ga0209435_101622 Ga0209435_1016222 346
259 3300025207 Ga0209760_100241 Ga0209760_10024118 346
260 3300025224 Ga0209784_100016 Ga0209784_100016274 346
261 3300025225 Ga0209566_101596 Ga0209566_1015963 346
262 3300025226 Ga0209674_100012 Ga0209674_100012714 346
263 3300025226 Ga0209674_100141 Ga0209674_10014131 346
264 3300025226 Ga0209674_101045 Ga0209674_1010456 346
265 3300025226 Ga0209674_101076 Ga0209674_1010765 346
266 3300025228 Ga0209672_100007 Ga0209672_100007364 346
267 3300025228 Ga0209672_100018 Ga0209672_100018159 346
268 3300025228 Ga0209672_100161 Ga0209672_10016146 346
269 3300025228 Ga0209672_100446 Ga0209672_10044616 346
270 3300025228 Ga0209672_102265 Ga0209672_1022652 346
271 3300025230 Ga0209563_100071 Ga0209563_10007140 346
272 3300025231 Ga0207427_100019 Ga0207427_100019140 346
273 3300025231 Ga0207427_100036 Ga0207427_100036137 346
274 3300025231 Ga0207427_100050 Ga0207427_100050177 346
275 3300025231 Ga0207427_101984 Ga0207427_1019842 346
276 3300025233 Ga0209437_100012 Ga0209437_10001233 346
277 3300025233 Ga0209437_100120 Ga0209437_100120165 346
278 3300025233 Ga0209437_100127 Ga0209437_10012780 346
279 3300025233 Ga0209437_100289 Ga0209437_10028951 346
280 3300025233 Ga0209437_102524 Ga0209437_1025243 346
281 3300025242 Ga0209258_100017 Ga0209258_100017453 346
282 3300025242 Ga0209258_100024 Ga0209258_100024265 346
283 3300025242 Ga0209258_100035 Ga0209258_100035108 346
284 3300025242 Ga0209258_100039 Ga0209258_100039279 346
285 3300025242 Ga0209258_100256 Ga0209258_10025679 346
286 3300025242 Ga0209258_100308 Ga0209258_10030863 346
287 3300025246 Ga0209646_1000426 Ga0209646_100042621 346
288 3300025246 Ga0209646_1001098 Ga0209646_10010987 346
289 3300025246 Ga0209646_1007686 Ga0209646_10076861 346
290 3300025250 Ga0209026_1000012 Ga0209026_1000012212 346
291 3300025250 Ga0209026_1000281 Ga0209026_100028130 346
292 3300025250 Ga0209026_1000370 Ga0209026_100037019 346
293 3300025250 Ga0209026_1000594 Ga0209026_100059423 346
294 3300025250 Ga0209026_1001678 Ga0209026_10016782 346
295 3300025250 Ga0209026_1002746 Ga0209026_10027465 346
296 3300025254 Ga0209148_1000001 Ga0209148_10000011544 346
297 3300025254 Ga0209148_1000005 Ga0209148_1000005745 346
298 3300025254 Ga0209148_1000009 Ga0209148_1000009593 346
299 3300025254 Ga0209148_1000045 Ga0209148_1000045133 346
300 3300025254 Ga0209148_1000048 Ga0209148_1000048253 346
301 3300025254 Ga0209148_1000084 Ga0209148_1000084157 346
302 3300025254 Ga0209148_1001279 Ga0209148_100127910 346
303 3300025256 Ga0209759_1000450 Ga0209759_10004505 346
304 3300025256 Ga0209759_1000616 Ga0209759_100061627 346
305 3300025256 Ga0209759_1001730 Ga0209759_10017302 346
306 3300025256 Ga0209759_1003861 Ga0209759_10038612 346
307 3300025256 Ga0209759_1004008 Ga0209759_10040084 346
308 3300025258 Ga0209129_1001077 Ga0209129_10010773 346
309 3300025261 Ga0209233_1000002 Ga0209233_1000002687 346
310 3300025261 Ga0209233_1000101 Ga0209233_1000101137 346
311 3300025261 Ga0209233_1000174 Ga0209233_10001746 346
312 3300025261 Ga0209233_1013154 Ga0209233_10131542 346
313 3300025272 Ga0209455_1000010 Ga0209455_1000010364 346
314 3300025272 Ga0209455_1000029 Ga0209455_1000029265 346
315 3300025272 Ga0209455_1000035 Ga0209455_1000035134 346
316 3300025272 Ga0209455_1000039 Ga0209455_1000039279 346
317 3300025272 Ga0209455_1003533 Ga0209455_10035332 346
318 3300025272 Ga0209455_1007348 Ga0209455_10073483 346
319 3300025903 Ga0207680_10000002 Ga0207680_10000002897 346
320 3300025904 Ga0207647_10076669 Ga0207647_100766692 346
321 3300025904 Ga0207647_10131835 Ga0207647_101318351 346
322 3300025909 Ga0207705_10174247 Ga0207705_101742472 346
323 3300025913 Ga0207695_10000294 Ga0207695_1000029430 346
324 3300025913 Ga0207695_10005500 Ga0207695_100055008 346
325 3300025913 Ga0207695_10024639 Ga0207695_100246395 346
326 3300025914 Ga0207671_10000374 Ga0207671_1000037449 346
327 3300025915 Ga0207693_10109038 Ga0207693_101090381 346
328 3300025924 Ga0207694_10000401 Ga0207694_1000040110 346
329 3300025924 Ga0207694_10146502 Ga0207694_101465022 346
330 3300025928 Ga0207700_10016919 Ga0207700_100169193 346
331 3300025936 Ga0207670_10001638 Ga0207670_100016387 346
332 3300025972 Ga0207668_10102234 Ga0207668_101022342 346
333 3300025981 Ga0207640_10010637 Ga0207640_100106373 346
334 3300026067 Ga0207678_10252592 Ga0207678_102525921 346
335 3300026078 Ga0207702_10003104 Ga0207702_100031047 346
336 3300026116 Ga0207674_10047914 Ga0207674_100479142 346
337 3300028379 Ga0268266_10000004 Ga0268266_10000004891 346
338 3300028380 Ga0268265_10104729 Ga0268265_101047292 346
339 3300028381 Ga0268264_10099024 Ga0268264_100990243 346
340 3300031911 Ga0307412_10001235 Ga0307412_100012353 346
341 3300033180 Ga0307510_10018989 Ga0307510_100189894 346
342 3300033180 Ga0307510_10026445 Ga0307510_100264455 346
343 3300037312 Ga0395899_0000119 Ga0395899_0000119_30647_31696 346
344 3300037312 Ga0395899_0059325 Ga0395899_0059325_1663_2703 346
345 3300037312 Ga0395899_0064622 Ga0395899_0064622_59_1102 346
346 3300037312 Ga0395899_0108314 Ga0395899_0108314_246_1286 346
347 3300037418 Ga0395900_0000333 Ga0395900_0000333_61871_62920 346
348 3300037418 Ga0395900_0029174 Ga0395900_0029174_2608_3648 346
349 3300037466 Ga0395898_0000078 Ga0395898_0000078_229969_231012 346
350 3300037466 Ga0395898_0000211 Ga0395898_0000211_133999_135048 346
351 3300037466 Ga0395898_0059229 Ga0395898_0059229_1120_2160 346
352 3300037471 Ga0395905_0271372 Ga0395905_0271372_294_1334 346
353 3300038443 Ga0395901_0003349 Ga0395901_0003349_714_1754 346
354 3300038443 Ga0395901_0073213 Ga0395901_0073213_1820_2860 346
355 3300038443 Ga0395901_0153632 Ga0395901_0153632_839_1879 346
356 3300039437 Ga0436365_0822627 Ga0436365_0822627_201_1253 346
357 3300041404 Ga0439436_0000011 Ga0439436_0000011_70928_71968 346
358 3300041413 Ga0439465_0003294 Ga0439465_0003294_3761_4801 346
359 3300041452 Ga0451793_1639987 Ga0451793_1639987_2123_3187 346
360 3300041486 Ga0451807_1531267 Ga0451807_1531267_642_1700 346
361 3300042184 Ga0450908_000023 Ga0450908_000023_27833_28873 346
362 3300044672 Ga0466982_0000036 Ga0466982_0000036_13486_14526 346
363 3300044693 Ga0466961_0003441 Ga0466961_0003441_3691_4740 346
364 3300044693 Ga0466961_0097413 Ga0466961_0097413_450_1499 346
365 3300044842 Ga0466957_0011086 Ga0466957_0011086_3311_4360 346
366 3300044842 Ga0466957_0011406 Ga0466957_0011406_1385_2434 346
367 3300044842 Ga0466957_0011738 Ga0466957_0011738_1506_2546 346
368 3300045049 Ga0466959_0012370 Ga0466959_0012370_1386_2435 346
369 3300045836 Ga0466958_0033562 Ga0466958_0033562_830_1879 346
370 3300045976 Ga0466967_0100901 Ga0466967_0100901_244_1296 346
371 3300046460 Ga0495638_0000159 Ga0495638_0000159_45393_46433 346
372 3300046460 Ga0495638_0000161 Ga0495638_0000161_61361_62401 346
373 3300046471 Ga0495650_0000197 Ga0495650_0000197_43848_44888 346
374 3300046471 Ga0495650_0000984 Ga0495650_0000984_6516_7559 346
375 3300046501 Ga0495607_0000144 Ga0495607_0000144_50188_51228 346
376 3300046507 Ga0495606_0001905 Ga0495606_0001905_3652_4692 346
377 3300046512 Ga0495610_0001128 Ga0495610_0001128_22104_23144 346
378 3300046519 Ga0495632_0000004 Ga0495632_0000004_49792_50832 346
379 3300046674 Ga0495588_0084149 Ga0495588_0084149_365_1414 346
380 3300046694 Ga0495649_0010282 Ga0495649_0010282_2962_4002 346
381 3300046694 Ga0495649_0011052 Ga0495649_0011052_563_1603 346
382 3300047472 Ga0495686_0120563 Ga0495686_0120563_424_1482 346
383 3300048916 Ga0496113_0018146 Ga0496113_0018146_3550_4590 346
384 3300048918 Ga0496115_0000025 Ga0496115_0000025_18545_19585 346
385 3300048918 Ga0496115_0000456 Ga0496115_0000456_22941_23993 346
386 3300048918 Ga0496115_0016735 Ga0496115_0016735_794_1834 346
387 3300048918 Ga0496115_0023705 Ga0496115_0023705_2420_3460 346
388 3300048922 Ga0496119_0019934 Ga0496119_0019934_1323_2363 346
389 3300048923 Ga0496120_0001411 Ga0496120_0001411_24267_25310 346
390 3300048923 Ga0496120_0068573 Ga0496120_0068573_426_1466 346
391 3300048924 Ga0496121_0068368 Ga0496121_0068368_1032_2075 346
392 3300048925 Ga0496122_0013080 Ga0496122_0013080_2740_3780 346
393 3300048925 Ga0496122_0139583 Ga0496122_0139583_371_1411 346
394 3300048926 Ga0496123_0022737 Ga0496123_0022737_1086_2126 346
395 3300048927 Ga0496124_0008309 Ga0496124_0008309_39_1079 346
396 3300048927 Ga0496124_0008669 Ga0496124_0008669_39_1079 346
397 3300048929 Ga0496126_0000199 Ga0496126_0000199_94720_95772 346
398 3300048929 Ga0496126_0021995 Ga0496126_0021995_1542_2582 346
399 3300048929 Ga0496126_0025347 Ga0496126_0025347_2605_3648 346
400 3300048929 Ga0496126_0035482 Ga0496126_0035482_1272_2315 346
401 3300048929 Ga0496126_0043088 Ga0496126_0043088_536_1576 346
402 3300049568 Ga0501031_0112889 Ga0501031_0112889_609_1649 346
403 3300049569 Ga0501032_0013648 Ga0501032_0013648_2183_3223 346
404 3300049571 Ga0501034_0000462 Ga0501034_0000462_32697_33773 346
405 3300049571 Ga0501034_0033101 Ga0501034_0033101_149_1225 346
406 3300049571 Ga0501034_0087735 Ga0501034_0087735_182_1231 346
407 3300049571 Ga0501034_0182660 Ga0501034_0182660_875_1915 346
408 3300049572 Ga0501036_0198790 Ga0501036_0198790_435_1475 346
409 3300049573 Ga0501037_0083137 Ga0501037_0083137_1192_2232 346
410 3300049579 Ga0501043_0023760 Ga0501043_0023760_1550_2626 346
411 3300049579 Ga0501043_0048461 Ga0501043_0048461_1880_2929 346
412 3300049579 Ga0501043_0137019 Ga0501043_0137019_93_1133 346
413 3300049579 Ga0501043_0209253 Ga0501043_0209253_398_1453 346
414 3300049581 Ga0501047_0038226 Ga0501047_0038226_3331_4371 346
415 3300049581 Ga0501047_0068553 Ga0501047_0068553_1687_2742 346
416 3300049581 Ga0501047_0079729 Ga0501047_0079729_1035_2111 346
417 3300049581 Ga0501047_0089672 Ga0501047_0089672_22_1077 346
418 3300049585 Ga0501069_0026292 Ga0501069_0026292_368_1492 346
419 3300049586 Ga0501070_0000062 Ga0501070_0000062_29384_30508 346
420 3300049586 Ga0501070_0001521 Ga0501070_0001521_10330_11382 346
421 3300049586 Ga0501070_0003611 Ga0501070_0003611_8400_9455 346
422 3300049586 Ga0501070_0008534 Ga0501070_0008534_6838_7881 346
423 3300049586 Ga0501070_0011198 Ga0501070_0011198_245_1321 346
424 3300049586 Ga0501070_0023671 Ga0501070_0023671_891_1940 346
425 3300049586 Ga0501070_0062978 Ga0501070_0062978_128_1183 346
426 3300049589 Ga0501073_0014451 Ga0501073_0014451_4644_5699 346
427 3300049589 Ga0501073_0016155 Ga0501073_0016155_2027_3103 346
428 3300049589 Ga0501073_0018129 Ga0501073_0018129_3892_4947 346
429 3300049589 Ga0501073_0079902 Ga0501073_0079902_865_1941 346
430 3300049590 Ga0501074_0001791 Ga0501074_0001791_12875_13930 346
431 3300049590 Ga0501074_0005621 Ga0501074_0005621_523_1578 346
432 3300049590 Ga0501074_0014312 Ga0501074_0014312_2790_3866 346
433 3300049741 Ga0501079_0064932 Ga0501079_0064932_57_1112 346
434 3300049742 Ga0501080_0001205 Ga0501080_0001205_17793_18869 346
435 3300049742 Ga0501080_0017505 Ga0501080_0017505_1576_2652 346
436 3300049742 Ga0501080_0107539 Ga0501080_0107539_948_2003 346
437 3300049742 Ga0501080_0202074 Ga0501080_0202074_677_1720 346
438 3300049822 Ga0501035_0013449 Ga0501035_0013449_3173_4222 346
439 3300049822 Ga0501035_0020895 Ga0501035_0020895_1024_2079 346
440 3300049822 Ga0501035_0039148 Ga0501035_0039148_1039_2079 346
441 3300049822 Ga0501035_0076121 Ga0501035_0076121_1314_2369 346
442 3300049822 Ga0501035_0196950 Ga0501035_0196950_347_1423 346
443 3300049823 Ga0501044_0027747 Ga0501044_0027747_2085_3134 346
444 3300049823 Ga0501044_0035105 Ga0501044_0035105_1786_2835 346
445 3300049823 Ga0501044_0042303 Ga0501044_0042303_2077_3132 346
446 3300049823 Ga0501044_0052151 Ga0501044_0052151_1515_2555 346
447 3300049824 Ga0501045_0176358 Ga0501045_0176358_422_1462 346
448 3300053093 Ga0500651_0000201 Ga0500651_0000201_35044_36108 346
449 3300001915 JGI24741J21665_1002272 JGI24741J21665_10022724 347
450 3300001979 JGI24740J21852_10003823 JGI24740J21852_100038232 347
451 3300005336 Ga0070680_100211347 Ga0070680_1002113472 347
452 3300005339 Ga0070660_100026970 Ga0070660_1000269702 347
453 3300005345 Ga0070692_10047255 Ga0070692_100472552 347
454 3300005458 Ga0070681_10001678 Ga0070681_100016786 347
455 3300005530 Ga0070679_100001710 Ga0070679_1000017106 347
456 3300009101 Ga0105247_10003125 Ga0105247_100031255 347
457 3300013100 Ga0157373_10025438 Ga0157373_100254382 347
458 3300013102 Ga0157371_10076776 Ga0157371_100767762 347
459 3300014497 Ga0182008_10034216 Ga0182008_100342162 347
460 3300015261 Ga0182006_1000140 Ga0182006_100014027 347
461 3300015262 Ga0182007_10036761 Ga0182007_100367611 347
462 3300015265 Ga0182005_1003015 Ga0182005_10030153 347
463 3300017792 Ga0163161_10001842 Ga0163161_100018427 347
464 3300020069 Ga0197907_10018156 Ga0197907_100181561 347
465 3300020070 Ga0206356_10117802 Ga0206356_101178022 347
466 3300020081 Ga0206354_10508562 Ga0206354_105085622 347
467 3300020081 Ga0206354_10839745 Ga0206354_108397455 347
468 3300020610 Ga0154015_1117584 Ga0154015_11175842 347
469 3300025904 Ga0207647_10008285 Ga0207647_100082855 347
470 3300025909 Ga0207705_10015872 Ga0207705_100158723 347
471 3300025912 Ga0207707_10000349 Ga0207707_1000034913 347
472 3300025912 Ga0207707_10009108 Ga0207707_100091085 347
473 3300025912 Ga0207707_10013431 Ga0207707_100134315 347
474 3300025913 Ga0207695_10033006 Ga0207695_100330065 347
475 3300025917 Ga0207660_10001350 Ga0207660_1000135014 347
476 3300025917 Ga0207660_10006503 Ga0207660_100065035 347
477 3300025921 Ga0207652_10002130 Ga0207652_100021302 347
478 3300025921 Ga0207652_10021550 Ga0207652_100215501 347
479 3300025921 Ga0207652_10022180 Ga0207652_100221805 347
480 3300025944 Ga0207661_10032861 Ga0207661_100328612 347
481 3300025945 Ga0207679_10173327 Ga0207679_101733272 347
482 3300025949 Ga0207667_10037122 Ga0207667_100371222 347
483 3300025981 Ga0207640_10041767 Ga0207640_100417672 347
484 3300026067 Ga0207678_10037497 Ga0207678_100374974 347
485 3300026142 Ga0207698_10008359 Ga0207698_100083592 347
486 3300038443 Ga0395901_0015121 Ga0395901_0015121_2554_3654 347
487 3300046452 Ga0495617_000077 Ga0495617_000077_28058_29101 347
488 3300046460 Ga0495638_0000078 Ga0495638_0000078_134278_135321 347
489 3300046471 Ga0495650_0000686 Ga0495650_0000686_37040_38083 347
490 3300046471 Ga0495650_0045039 Ga0495650_0045039_137_1180 347
491 3300046492 Ga0495585_0000080 Ga0495585_0000080_51136_52179 347
492 3300046492 Ga0495585_0001139 Ga0495585_0001139_10597_11640 347
493 3300046501 Ga0495607_0000954 Ga0495607_0000954_3215_4258 347
494 3300046507 Ga0495606_0000227 Ga0495606_0000227_20026_21069 347
495 3300046507 Ga0495606_0000340 Ga0495606_0000340_45701_46744 347
496 3300046507 Ga0495606_0011714 Ga0495606_0011714_4144_5187 347
497 3300046507 Ga0495606_0200041 Ga0495606_0200041_79_1122 347
498 3300046513 Ga0495616_0000036 Ga0495616_0000036_75139_76182 347
499 3300046515 Ga0495620_0000164 Ga0495620_0000164_49892_50935 347
500 3300046515 Ga0495620_0002441 Ga0495620_0002441_4988_6031 347
501 3300046518 Ga0495631_0000017 Ga0495631_0000017_85352_86395 347
502 3300046518 Ga0495631_0001882 Ga0495631_0001882_4246_5289 347
503 3300046519 Ga0495632_0000786 Ga0495632_0000786_19_1062 347
504 3300046519 Ga0495632_0012006 Ga0495632_0012006_2701_3744 347
505 3300046524 Ga0495648_0001369 Ga0495648_0001369_11467_12510 347
506 3300046524 Ga0495648_0005091 Ga0495648_0005091_8578_9621 347
507 3300046616 Ga0495668_0014064 Ga0495668_0014064_2929_3972 347
508 3300046616 Ga0495668_0101678 Ga0495668_0101678_457_1500 347
509 3300046648 Ga0495611_0000001 Ga0495611_0000001_2271165_2272208 347
510 3300046648 Ga0495611_0000022 Ga0495611_0000022_50196_51239 347
511 3300046660 Ga0495625_0000347 Ga0495625_0000347_4143_5186 347
512 3300046660 Ga0495625_0002925 Ga0495625_0002925_9412_10455 347
513 3300046665 Ga0495661_0000657 Ga0495661_0000657_3168_4211 347
514 3300046665 Ga0495661_0145488 Ga0495661_0145488_66_1109 347
515 3300046691 Ga0495670_0008759 Ga0495670_0008759_1262_2305 347
516 3300046692 Ga0495671_0000240 Ga0495671_0000240_29844_30887 347
517 3300046794 Ga0495589_0000053 Ga0495589_0000053_49726_50769 347
518 3300046810 Ga0495660_0000094 Ga0495660_0000094_77302_78345 347
519 3300046810 Ga0495660_0000233 Ga0495660_0000233_17247_18290 347
520 3300047323 Ga0495683_0001315 Ga0495683_0001315_8388_9431 347
521 3300047446 Ga0495679_000004 Ga0495679_000004_381937_382980 347
522 3300047469 Ga0495673_0000004 Ga0495673_0000004_216944_217987 347
523 3300047469 Ga0495673_0000048 Ga0495673_0000048_220028_221071 347
524 3300047469 Ga0495673_0000644 Ga0495673_0000644_21964_23007 347
525 3300047469 Ga0495673_0104932 Ga0495673_0104932_83_1126 347
526 3300047470 Ga0495681_0043956 Ga0495681_0043956_295_1338 347
527 3300047472 Ga0495686_0000295 Ga0495686_0000295_42683_43726 347
528 3300047472 Ga0495686_0087615 Ga0495686_0087615_782_1825 347
529 3300048903 Ga0496100_0005392 Ga0496100_0005392_2729_3772 347
530 3300048904 Ga0496101_0004248 Ga0496101_0004248_2677_3720 347
531 3300048909 Ga0496106_0005759 Ga0496106_0005759_2795_3838 347
532 3300048924 Ga0496121_0002571 Ga0496121_0002571_3819_4862 347
533 3300048924 Ga0496121_0005654 Ga0496121_0005654_12256_13299 347
534 3300048925 Ga0496122_0055316 Ga0496122_0055316_1237_2280 347
535 3300048926 Ga0496123_0088467 Ga0496123_0088467_175_1218 347
536 3300049459 Ga0495678_000276 Ga0495678_000276_3215_4258 347
537 3300049460 Ga0495682_0004711 Ga0495682_0004711_2973_4016 347
538 3300049575 Ga0501039_0075591 Ga0501039_0075591_1110_2177 347
539 3300049582 Ga0501048_0110770 Ga0501048_0110770_22_1086 347
540 3300053087 Ga0500643_000020 Ga0500643_000020_139771_140814 347
541 3300053103 Ga0500555_000855 Ga0500555_000855_364_1407 347
542 3300053160 Ga0500633_0005303 Ga0500633_0005303_1612_2655 347
543 3300053730 Ga0500645_001658 Ga0500645_001658_8372_9415 347
544 3300001904 JGI24736J21556_1003793 JGI24736J21556_10037932 348
545 3300001979 JGI24740J21852_10008388 JGI24740J21852_100083882 348
546 3300001989 JGI24739J22299_10001760 JGI24739J22299_100017604 348
547 3300001990 JGI24737J22298_10001454 JGI24737J22298_100014544 348
548 3300002737 JGI25162J39368_1001266 JGI25162J39368_10012666 348
549 3300002737 JGI25162J39368_1001649 JGI25162J39368_10016494 348
550 3300002772 JGI25164J39214_1000366 JGI25164J39214_100036623 348
551 3300003214 JGI25165J46597_1000405 JGI25165J46597_100040525 348
552 3300003215 JGI25153J46596_10015617 JGI25153J46596_100156172 348
553 3300003316 rootH1_10079021 rootH1_100790213 348
554 3300003578 Ga0006562J51391_1025482 Ga0006562J51391_10254825 348
555 3300003578 Ga0006562J51391_1025483 Ga0006562J51391_10254835 348
556 3300005337 Ga0070682_100036100 Ga0070682_1000361002 348
557 3300005339 Ga0070660_100021136 Ga0070660_1000211362 348
558 3300005339 Ga0070660_100070386 Ga0070660_1000703862 348
559 3300005344 Ga0070661_100025681 Ga0070661_1000256815 348
560 3300005366 Ga0070659_100008670 Ga0070659_1000086706 348
561 3300005366 Ga0070659_100153987 Ga0070659_1001539872 348
562 3300005435 Ga0070714_100000079 Ga0070714_10000007985 348
563 3300005435 Ga0070714_100001985 Ga0070714_1000019859 348
564 3300005457 Ga0070662_100072022 Ga0070662_1000720222 348
565 3300005458 Ga0070681_10040729 Ga0070681_100407294 348
566 3300005458 Ga0070681_10049674 Ga0070681_100496746 348
567 3300005530 Ga0070679_100111886 Ga0070679_1001118862 348
568 3300005530 Ga0070679_100114322 Ga0070679_1001143222 348
569 3300005539 Ga0068853_100213545 Ga0068853_1002135451 348
570 3300005546 Ga0070696_100012517 Ga0070696_1000125174 348
571 3300005546 Ga0070696_100039428 Ga0070696_1000394284 348
572 3300005563 Ga0068855_100009625 Ga0068855_1000096258 348
573 3300005563 Ga0068855_100028046 Ga0068855_1000280464 348
574 3300005564 Ga0070664_100220520 Ga0070664_1002205202 348
575 3300005577 Ga0068857_100000573 Ga0068857_10000057321 348
576 3300005578 Ga0068854_100000455 Ga0068854_1000004554 348
577 3300005578 Ga0068854_100004459 Ga0068854_1000044598 348
578 3300005616 Ga0068852_100103311 Ga0068852_1001033112 348
579 3300005842 Ga0068858_100058951 Ga0068858_1000589513 348
580 3300009093 Ga0105240_10000298 Ga0105240_1000029817 348
581 3300009093 Ga0105240_10008267 Ga0105240_100082678 348
582 3300009093 Ga0105240_10033211 Ga0105240_100332114 348
583 3300009545 Ga0105237_10000023 Ga0105237_10000023177 348
584 3300009545 Ga0105237_10394014 Ga0105237_103940142 348
585 3300010375 Ga0105239_10000044 Ga0105239_10000044156 348
586 3300010375 Ga0105239_10040405 Ga0105239_100404052 348
587 3300010375 Ga0105239_10046422 Ga0105239_100464222 348
588 3300012500 Ga0157314_1000032 Ga0157314_10000322 348
589 3300013104 Ga0157370_10005119 Ga0157370_100051192 348
590 3300013104 Ga0157370_10009565 Ga0157370_100095654 348
591 3300013104 Ga0157370_10018018 Ga0157370_100180186 348
592 3300013105 Ga0157369_10000080 Ga0157369_1000008051 348
593 3300013105 Ga0157369_10128534 Ga0157369_101285342 348
594 3300013307 Ga0157372_10028027 Ga0157372_100280275 348
595 3300025231 Ga0207427_100123 Ga0207427_10012324 348
596 3300025233 Ga0209437_100227 Ga0209437_10022773 348
597 3300025258 Ga0209129_1002771 Ga0209129_10027712 348
598 3300025261 Ga0209233_1000283 Ga0209233_100028324 348
599 3300025297 Ga0209758_1001696 Ga0209758_10016964 348
600 3300025904 Ga0207647_10000099 Ga0207647_1000009916 348
601 3300025904 Ga0207647_10010351 Ga0207647_100103515 348
602 3300025904 Ga0207647_10123863 Ga0207647_101238632 348
603 3300025909 Ga0207705_10001831 Ga0207705_1000183111 348
604 3300025912 Ga0207707_10004791 Ga0207707_1000479113 348
605 3300025913 Ga0207695_10001363 Ga0207695_1000136321 348
606 3300025913 Ga0207695_10064214 Ga0207695_100642142 348
607 3300025914 Ga0207671_10000020 Ga0207671_1000002059 348
608 3300025914 Ga0207671_10000033 Ga0207671_10000033196 348
609 3300025917 Ga0207660_10100704 Ga0207660_101007042 348
610 3300025917 Ga0207660_10148984 Ga0207660_101489841 348
611 3300025919 Ga0207657_10063806 Ga0207657_100638064 348
612 3300025919 Ga0207657_10076899 Ga0207657_100768992 348
613 3300025919 Ga0207657_10081366 Ga0207657_100813662 348
614 3300025920 Ga0207649_10035698 Ga0207649_100356983 348
615 3300025921 Ga0207652_10226015 Ga0207652_102260152 348
616 3300025929 Ga0207664_10000036 Ga0207664_10000036153 348
617 3300025929 Ga0207664_10000858 Ga0207664_100008585 348
618 3300025932 Ga0207690_10014477 Ga0207690_100144775 348
619 3300025932 Ga0207690_10015534 Ga0207690_100155343 348
620 3300025932 Ga0207690_10031465 Ga0207690_100314652 348
621 3300025932 Ga0207690_10055295 Ga0207690_100552952 348
622 3300025933 Ga0207706_10060077 Ga0207706_100600772 348
623 3300025945 Ga0207679_10195374 Ga0207679_101953742 348
624 3300025949 Ga0207667_10000094 Ga0207667_1000009458 348
625 3300025949 Ga0207667_10000238 Ga0207667_1000023829 348
626 3300025949 Ga0207667_10001738 Ga0207667_100017382 348
627 3300025981 Ga0207640_10000043 Ga0207640_1000004316 348
628 3300025981 Ga0207640_10000277 Ga0207640_100002778 348
629 3300026035 Ga0207703_10072134 Ga0207703_100721342 348
630 3300026041 Ga0207639_10058456 Ga0207639_100584562 348
631 3300026067 Ga0207678_10060292 Ga0207678_100602922 348
632 3300026078 Ga0207702_10023241 Ga0207702_100232414 348
633 3300026116 Ga0207674_10000074 Ga0207674_1000007465 348
634 3300026116 Ga0207674_10010110 Ga0207674_100101108 348
635 3300026142 Ga0207698_10083089 Ga0207698_100830892 348
636 3300031665 Ga0316575_10021316 Ga0316575_100213162 348
637 3300044672 Ga0466982_0000009 Ga0466982_0000009_3725_4795 348
638 3300044683 Ga0466965_0015843 Ga0466965_0015843_71_1126 348
639 3300044684 Ga0466966_0038369 Ga0466966_0038369_2005_3075 348
640 3300044693 Ga0466961_0001124 Ga0466961_0001124_6223_7302 348
641 3300044693 Ga0466961_0002245 Ga0466961_0002245_3920_4993 348
642 3300044735 Ga0466968_0000703 Ga0466968_0000703_1178_2224 348
643 3300044901 Ga0466960_0007138 Ga0466960_0007138_1451_2521 348
644 3300045049 Ga0466959_0000007 Ga0466959_0000007_56958_58037 348
645 3300045049 Ga0466959_0089661 Ga0466959_0089661_88_1158 348
646 3300047472 Ga0495686_0000017 Ga0495686_0000017_300252_301298 348
647 3300048905 Ga0496102_0163985 Ga0496102_0163985_439_1500 348
648 3300048908 Ga0496105_0002731 Ga0496105_0002731_1855_2916 348
649 3300048910 Ga0496107_0020194 Ga0496107_0020194_1125_2186 348
650 3300048918 Ga0496115_0017124 Ga0496115_0017124_3922_4983 348
651 3300048919 Ga0496116_0093510 Ga0496116_0093510_63_1109 348
652 3300048920 Ga0496117_0004466 Ga0496117_0004466_3458_4504 348
653 3300048920 Ga0496117_0011123 Ga0496117_0011123_1102_2163 348
654 3300048920 Ga0496117_0024407 Ga0496117_0024407_2614_3660 348
655 3300048921 Ga0496118_0000177 Ga0496118_0000177_72347_73423 348
656 3300048921 Ga0496118_0000805 Ga0496118_0000805_37764_38810 348
657 3300048921 Ga0496118_0001746 Ga0496118_0001746_27585_28646 348
658 3300048921 Ga0496118_0002109 Ga0496118_0002109_22335_23396 348
659 3300048921 Ga0496118_0023825 Ga0496118_0023825_1470_2516 348
660 3300048921 Ga0496118_0079063 Ga0496118_0079063_1205_2287 348
661 3300048922 Ga0496119_0000707 Ga0496119_0000707_4499_5560 348
662 3300048923 Ga0496120_0000446 Ga0496120_0000446_25105_26166 348
663 3300048924 Ga0496121_0000241 Ga0496121_0000241_4278_5339 348
664 3300048924 Ga0496121_0000372 Ga0496121_0000372_31522_32568 348
665 3300048924 Ga0496121_0027862 Ga0496121_0027862_1638_2699 348
666 3300048924 Ga0496121_0028953 Ga0496121_0028953_1931_3001 348
667 3300048925 Ga0496122_0109729 Ga0496122_0109729_513_1559 348
668 3300048925 Ga0496122_0140817 Ga0496122_0140817_385_1431 348
669 3300048926 Ga0496123_0008605 Ga0496123_0008605_7368_8414 348
670 3300048928 Ga0496125_0000892 Ga0496125_0000892_37593_38663 348
671 3300048928 Ga0496125_0005101 Ga0496125_0005101_9536_10582 348
672 3300048929 Ga0496126_0000769 Ga0496126_0000769_28954_30015 348
673 3300048929 Ga0496126_0139067 Ga0496126_0139067_125_1171 348
674 3300049589 Ga0501073_0028815 Ga0501073_0028815_1246_2328 348
675 3300049823 Ga0501044_0053580 Ga0501044_0053580_1182_2264 348
676 3300061719 Ga0466962_0004485 Ga0466962_0004485_5212_6282 348
677 iso_pu_bacteria 2939611941 2939614474 348

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02873

MurB_C

UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain

248

372

0.92

PF01565

FAD_binding_4

FAD binding domain

57

183

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
7orz-assembly1.cif.gz_A crystal structure of udp-n-acetylenolpyruvoylglucosamine reductase (murb) from pseudomonas aeruginosa in complex with fad and a pyrazole derivative (fragment 18) 0.9578 15 348
7orz-assembly1.cif.gz_A crystal structure of udp-n-acetylenolpyruvoylglucosamine reductase (murb) from pseudomonas aeruginosa in complex with fad and a pyrazole derivative (fragment 18) 0.9467 15 348
1uxy-assembly1.cif.gz_A murb mutant with ser 229 replaced by ala, complex with enolpyruvyl-udp-n-acetylglucosamine 0.9312 20 348
3i99-assembly1.cif.gz_A the crystal structure of the udp-n-acetylenolpyruvoylglucosamine reductase from the vibrio cholerae o1 biovar tor 0.9306 8 348
2q85-assembly1.cif.gz_A crystal structure of e. coli mur b bound to a naphthyl tetronic acid inihibitor 0.9274 18 348
ID Description Score Start End Superfamily
3tx1A03 Alpha Beta;Alpha-Beta Complex;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 1;UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain 0.9617 284 348 3.90.78.10
4jayA02 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9596 85 237 3.30.465.10
4jayA02 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9475 85 237 3.30.465.10
3i99A03 Alpha Beta;Alpha-Beta Complex;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 1;UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain 0.9303 238 344 3.90.78.10
af_P38960_2_190_2.40.50.1040 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); 0.902 84 100 2.40.50.1040
ID Description Score Start End GO Terms
AF-Q9PAE6-F1-model_v4 UDP-N-acetylenolpyruvoylglucosamine reductase (EC 1.3.1.98) (UDP-N-acetylmuramate dehydrogenase) 0.9791 5 348 GO:0005829
GO:0008360
GO:0008762
GO:0009252
GO:0051301
GO:0071555
GO:0071949
AF-A0A350JMG3-F1-model_v4 UDP-N-acetylmuramate dehydrogenase (EC 1.3.1.98) 0.9713 107 348 GO:0005829
GO:0008360
GO:0008762
GO:0009252
GO:0050660
GO:0051301
GO:0071555
AF-A0A4R3I108-F1-model_v4 UDP-N-acetylenolpyruvoylglucosamine reductase (EC 1.3.1.98) (UDP-N-acetylmuramate dehydrogenase) 0.9712 45 348 GO:0005829
GO:0008360
GO:0008762
GO:0009252
GO:0051301
GO:0071555
GO:0071949
AF-A0A6A5L5C6-F1-model_v4 deleted 0.9706 25 348
AF-Q9K016-F1-model_v4 UDP-N-acetylenolpyruvoylglucosamine reductase (EC 1.3.1.98) (UDP-N-acetylmuramate dehydrogenase) 0.9706 15 347 GO:0005829
GO:0008360
GO:0008762
GO:0009252
GO:0050660
GO:0051301
GO:0071555
GO:0071949

Feature Viewer

pLDDT pTM Quality
91.11 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map