F474566
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 677 | 347 | 632 | 870 |
Family's Representative Sequence
| Representative Sequence | 3300001915|JGI24741J21665_1002154|JGI24741J21665_10021543 |
| Length | 940 |
| Sequence | MRTQFLIGVAAAAIMLPGAAYAQSAGTADFEGDIVITATKASKGVGGVEIPDTTKARGVLNQEFISRQTPGNSILDTINALPGVSFQNNDPFGSAGGTLTIRGFDSSRISLTFDGVPLNDTGNYALYSNQQLDPELIEQVNVSYGSTDVDSPTAAASGSTVNYRTIMPTDQFGARLQGSIGDYNFFRVFGLINTGEFTKFGTKAWLSMSHAENNVVFNNFGKIRKAQYNGRVYQPIGSNGDFISIAANYNVNRNNFFGSAPLRYDTHNLSQITAPRSGAPIPGTPTDPTISRTNPFLIDNGLRTAGTGSGNRFPFDRDELPYSIARCQTAAARAGLVDAPAIVNNPXXSNNGQACGASFDERYNPSNTGNIRISSRFTLAPHLVLTVEPSFQYVKANGGGTVTGRESAAGYTQTANATRGAITTPIFGFIGGQYYFGRDLNGDGDKLDTVTLLAPSQTVTHRYGLISSLRYDINDNNTIRIAYSHDYGRHRQTGEVGLLQANGQPFDVFPINNGLTATNGRIVEKRDRLSFAILDQVSGEYRGEFGGLTVNLGVRAPFFKRNLNNFCFTTAANGNVDCLGRGNTADNATYATANPLAAAPQRRVFTYNRVLPNVGATYKFGGGFTAYVNYSKGLQVPGTDNLYQSFFYPLSNPAAHPTPETSDNFDTGVRYTTSKIQATISPWYTRFTNRLASAYDVVTDQTIYRNLGRVDKYGIDGSIAYRPMRELLIYAWGSYLKSDIKNNVEIGKCVGAKNSNDPTVAGNVAVTANCPTVGAPILAQTAGKRESGSPVYTYGLRLQGDIGPLSLGIQGKVTGPRYLNDQNLPNLGCTAALVNQICANASNTLAAFAAPTTSSTFAYGTSYQVYQAKTPAYGTVDVDARLKLGFLGLNDQTFFQVNVQNIFNKYYVGGFTGGSTVQYSAPFVQIGSPRAFIGTLNFQF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2510917021 | Novosphingobium sp. AP12 | Isolate | Rhizosphere |
| 2 | 2512564014 | Sphingobium sp. AP49 | Isolate | Rhizosphere |
| 3 | 2582581293 | Caulobacter henricii YR570 | Isolate | Rhizosphere |
| 4 | 2585428106 | Caulobacter sp. OV484 | Isolate | Rhizosphere |
| 5 | 2643221545 | Caulobacter sp. Root1455 | Isolate | Unclassified |
| 6 | 2643221574 | Brevundimonas sp. Root608 | Isolate | Unclassified |
| 7 | 2643221583 | Caulobacter sp. Root655 | Isolate | Unclassified |
| 8 | 2643221598 | Phenylobacterium sp. Root700 | Isolate | Unclassified |
| 9 | 2643221640 | Caulobacter sp. Root342 | Isolate | Unclassified |
| 10 | 2643221642 | Caulobacter sp. Root343 | Isolate | Unclassified |
| 11 | 2643221663 | Brevundimonas sp. Root1279 | Isolate | Unclassified |
| 12 | 2643221691 | Caulobacter sp. Root487D2Y | Isolate | Unclassified |
| 13 | 2643221699 | Brevundimonas sp. Root1423 | Isolate | Unclassified |
| 14 | 2738541275 | Novosphingobium sp. GV027 | Isolate | Unclassified |
| 15 | 2738541301 | Novosphingobium sp. GV079 | Isolate | Unclassified |
| 16 | 2738541304 | Novosphingobium sp. GV061 | Isolate | Unclassified |
| 17 | 2738543022 | Novosphingobium sp. GV055 | Isolate | Unclassified |
| 18 | 2738543033 | Novosphingobium sp. GV064 | Isolate | Unclassified |
| 19 | 2808606401 | Sphingobium sp. AEW010 | Isolate | Rhizosphere |
| 20 | 2808606404 | Sphingobium sp. AEW013 | Isolate | Rhizosphere |
| 21 | 2808606405 | Sphingobium sp. AEW001 | Isolate | Rhizosphere |
| 22 | 2818991435 | Caulobacter henricii 536 | Isolate | Unclassified |
| 23 | 2818991454 | Caulobacter rhizosphaerae 3260 | Isolate | Rhizosphere |
| 24 | 2849573788 | Caulobacter endophyticus 774 | Isolate | Unclassified |
| 25 | 2852653556 | Sphingopyxis sp. JAI108 | Isolate | Rhizosphere |
| 26 | 2880518877 | Sphingobium sp. JAI105 | Isolate | Rhizosphere |
| 27 | 2896429255 | Sphingomonas rhizophila KACC 19189 | Isolate | Rhizosphere |
| 28 | 2898329390 | Caulobacter sp. 602-2 | Isolate | Rhizosphere |
| 29 | 2919138771 | Novosphingobium sp. 1748 | Isolate | Rhizosphere |
| 30 | 2928027323 | Sphingomonas sp. 1185 | Isolate | Unclassified |
| 31 | 2928100450 | Novosphingobium sp. 1529 | Isolate | Rhizosphere |
| 32 | 2928531327 | Caulobacter sp. 1776 | Isolate | Rhizosphere |
| 33 | 2928959182 | Novosphingobium capsulatum 1057 | Isolate | Unclassified |
| 34 | 2946787523 | Sphingomonas faeni W4I17 | Isolate | Rhizosphere |
| 35 | 2984555340 | Sphingomonas sp. SORGH_AS789 | Isolate | Aerial Root |
| 36 | 2984564862 | Sphingomonas sp. SORGH_AS870 | Isolate | Aerial Root |
| 37 | 2990265787 | Sphingomonas sp. SORGH_AS802 | Isolate | Aerial Root |
| 38 | 2993356040 | Sphingomonas sp. SORGH_AS742 | Isolate | Aerial Root |
| 39 | 2993693658 | Sphingomonas sp. SORGH_AS438 | Isolate | Aerial Root |
| 40 | 3000865235 | Altericroceibacterium indicum DSM 18604 | Isolate | Rhizosphere |
| 41 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 42 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 43 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 44 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 45 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 46 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 47 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 48 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 49 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 50 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 51 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 52 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 53 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 54 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 55 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 56 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 57 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 58 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 59 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 60 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 61 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 62 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 67 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 69 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 86 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 87 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 88 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 89 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 90 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 94 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 96 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 97 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 98 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 100 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 101 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 102 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 103 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 104 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 105 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 106 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 107 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 108 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 109 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 110 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 111 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 112 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 113 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 115 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 116 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 117 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 118 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 119 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 144 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 147 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 148 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 152 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 153 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 155 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 157 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 159 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 162 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 165 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 216 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 220 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 221 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 222 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 223 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 224 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 225 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 226 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 227 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 228 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 229 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 230 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 231 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 232 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 233 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 234 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 235 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 236 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 237 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 238 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 239 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 240 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 241 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 242 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 243 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 244 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 245 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 246 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 247 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 248 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 249 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 286 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 287 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 288 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 289 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 290 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 291 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 292 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 293 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 294 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 295 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 296 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 297 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 298 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 299 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 300 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 301 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 302 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 303 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 304 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 305 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 306 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 307 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 308 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 309 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 310 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 311 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 317 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 322 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 323 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 324 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 325 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 328 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 329 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 330 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 331 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 332 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 333 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 334 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 335 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 336 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 337 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 338 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 339 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 340 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 341 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 342 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 343 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 344 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 345 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 346 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 347 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.8 |
| Metatranscriptomes | 0.15 |
| Isolates | 6.06 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.74 |
| Bulb | 0 |
| Endosphere | 12.26 |
| Nodule | 0 |
| Rhizoplane | 5.32 |
| Rhizosphere | 71.05 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.64 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1002799 | 3300001904 | Bacteria | 3055 |
| 2 | JGI24741J21665_1002154 | 3300001915 | Bacteria | 5239 |
| 3 | JGI24740J21852_10006563 | 3300001979 | Bacteria | 4804 |
| 4 | JGI24740J21852_10010664 | 3300001979 | Bacteria | 3527 |
| 5 | JGI24739J22299_10011254 | 3300001989 | Bacteria | 3305 |
| 6 | JGI24739J22299_10012243 | 3300001989 | Bacteria | 3150 |
| 7 | JGI24737J22298_10004687 | 3300001990 | Bacteria | 4757 |
| 8 | JGI24737J22298_10007492 | 3300001990 | Bacteria | 3682 |
| 9 | JGI24738J21930_10000692 | 3300002075 | Bacteria | 9709 |
| 10 | JGI24034J26672_10000853 | 3300002239 | Bacteria | 3961 |
| 11 | JGI25150J39212_1000195 | 3300002774 | Bacteria | 33776 |
| 12 | JGI25165J46597_1000036 | 3300003214 | Bacteria | 286380 |
| 13 | JGI25165J46597_1000094 | 3300003214 | Bacteria | 164674 |
| 14 | JGI25153J46596_10000208 | 3300003215 | Bacteria | 53467 |
| 15 | JGI25153J46596_10013772 | 3300003215 | Bacteria | 3400 |
| 16 | rootL2_10169340 | 3300003322 | Bacteria | 5103 |
| 17 | Ga0055525_1000037 | 3300003759 | Bacteria | 297990 |
| 18 | Ga0055542_1000286 | 3300003762 | Bacteria | 56470 |
| 19 | Ga0055529_1000207 | 3300003763 | Bacteria | 78124 |
| 20 | Ga0055536_1000512 | 3300003781 | Bacteria | 26760 |
| 21 | Ga0055536_1002435 | 3300003781 | Bacteria | 10457 |
| 22 | Ga0055530_10000640 | 3300003791 | Bacteria | 30110 |
| 23 | Ga0055540_1001676 | 3300003792 | Bacteria | 12815 |
| 24 | Ga0055531_10000771 | 3300003794 | Bacteria | 26726 |
| 25 | Ga0055531_10003434 | 3300003794 | Bacteria | 10107 |
| 26 | Ga0065165_1002251 | 3300005262 | Bacteria | 17089 |
| 27 | Ga0065165_1002736 | 3300005262 | Bacteria | 14081 |
| 28 | Ga0065704_10000479 | 3300005289 | Bacteria | 19901 |
| 29 | Ga0065707_10082051 | 3300005295 | Bacteria | 23464 |
| 30 | Ga0070658_10000037 | 3300005327 | Bacteria | 141493 |
| 31 | Ga0070658_10007123 | 3300005327 | Bacteria | 9026 |
| 32 | Ga0070658_10013616 | 3300005327 | Bacteria | 6525 |
| 33 | Ga0070658_10035423 | 3300005327 | Bacteria | 4020 |
| 34 | Ga0070658_10040746 | 3300005327 | Bacteria | 3747 |
| 35 | Ga0070670_100001616 | 3300005331 | Bacteria | 18214 |
| 36 | Ga0070670_100006019 | 3300005331 | Bacteria | 10255 |
| 37 | Ga0070670_100020117 | 3300005331 | Bacteria | 5734 |
| 38 | Ga0070670_100034580 | 3300005331 | Bacteria | 4349 |
| 39 | Ga0070670_100036835 | 3300005331 | Bacteria | 4208 |
| 40 | Ga0070670_100046132 | 3300005331 | Bacteria | 3747 |
| 41 | Ga0070677_10000384 | 3300005333 | Bacteria | 15496 |
| 42 | Ga0070666_10003370 | 3300005335 | Bacteria | 9689 |
| 43 | Ga0070666_10012793 | 3300005335 | Bacteria | 5304 |
| 44 | Ga0070680_100010173 | 3300005336 | Bacteria | 7254 |
| 45 | Ga0070682_100011170 | 3300005337 | Bacteria | 5124 |
| 46 | Ga0068868_100000269 | 3300005338 | Bacteria | 35173 |
| 47 | Ga0068868_100010680 | 3300005338 | Bacteria | 6654 |
| 48 | Ga0070660_100000517 | 3300005339 | Bacteria | 25756 |
| 49 | Ga0070660_100002339 | 3300005339 | Bacteria | 13020 |
| 50 | Ga0070660_100003837 | 3300005339 | Bacteria | 10378 |
| 51 | Ga0070660_100010005 | 3300005339 | Bacteria | 6687 |
| 52 | Ga0070660_100011146 | 3300005339 | Bacteria | 6377 |
| 53 | Ga0070660_100020181 | 3300005339 | Bacteria | 4893 |
| 54 | Ga0070660_100024970 | 3300005339 | Bacteria | 4438 |
| 55 | Ga0070660_100055360 | 3300005339 | Bacteria | 3065 |
| 56 | Ga0070660_100057743 | 3300005339 | Bacteria | 3007 |
| 57 | Ga0070661_100004811 | 3300005344 | Bacteria | 9295 |
| 58 | Ga0070661_100006733 | 3300005344 | Bacteria | 7922 |
| 59 | Ga0070661_100046650 | 3300005344 | Bacteria | 3170 |
| 60 | Ga0070692_10000336 | 3300005345 | Bacteria | 13607 |
| 61 | Ga0070692_10002274 | 3300005345 | Bacteria | 7377 |
| 62 | Ga0070668_100000426 | 3300005347 | Bacteria | 27786 |
| 63 | Ga0070668_100010941 | 3300005347 | Bacteria | 6750 |
| 64 | Ga0070668_100028146 | 3300005347 | Bacteria | 4267 |
| 65 | Ga0070669_100000160 | 3300005353 | Bacteria | 60712 |
| 66 | Ga0070669_100017384 | 3300005353 | Bacteria | 5130 |
| 67 | Ga0070675_100032470 | 3300005354 | Bacteria | 4226 |
| 68 | Ga0070671_100004621 | 3300005355 | Bacteria | 10917 |
| 69 | Ga0070671_100010596 | 3300005355 | Bacteria | 7401 |
| 70 | Ga0070671_100038781 | 3300005355 | Bacteria | 3954 |
| 71 | Ga0070674_100001269 | 3300005356 | Bacteria | 13284 |
| 72 | Ga0070674_100002821 | 3300005356 | Bacteria | 9609 |
| 73 | Ga0070674_100004870 | 3300005356 | Bacteria | 7695 |
| 74 | Ga0070673_100008675 | 3300005364 | Bacteria | 6775 |
| 75 | Ga0070673_100025134 | 3300005364 | Bacteria | 4378 |
| 76 | Ga0070659_100000025 | 3300005366 | Bacteria | 144955 |
| 77 | Ga0070659_100007854 | 3300005366 | Bacteria | 7768 |
| 78 | Ga0070659_100010876 | 3300005366 | Bacteria | 6710 |
| 79 | Ga0070667_100010417 | 3300005367 | Bacteria | 7674 |
| 80 | Ga0070667_100014231 | 3300005367 | Bacteria | 6572 |
| 81 | Ga0070667_100019910 | 3300005367 | Bacteria | 5568 |
| 82 | Ga0070667_100024786 | 3300005367 | Bacteria | 4984 |
| 83 | Ga0070667_100029798 | 3300005367 | Bacteria | 4550 |
| 84 | Ga0070714_100038998 | 3300005435 | Bacteria | 3998 |
| 85 | Ga0070705_100004988 | 3300005440 | Bacteria | 6466 |
| 86 | Ga0070694_100001237 | 3300005444 | Bacteria | 14786 |
| 87 | Ga0070678_100000152 | 3300005456 | Bacteria | 28847 |
| 88 | Ga0070678_100014896 | 3300005456 | Bacteria | 4922 |
| 89 | Ga0070662_100000794 | 3300005457 | Bacteria | 19386 |
| 90 | Ga0070662_100004016 | 3300005457 | Bacteria | 9228 |
| 91 | Ga0070662_100004268 | 3300005457 | Bacteria | 9017 |
| 92 | Ga0070662_100008146 | 3300005457 | Bacteria | 6828 |
| 93 | Ga0070662_100035798 | 3300005457 | Bacteria | 3508 |
| 94 | Ga0070681_10011466 | 3300005458 | Bacteria | 8775 |
| 95 | Ga0068867_100013928 | 3300005459 | Bacteria | 5692 |
| 96 | Ga0070685_10001187 | 3300005466 | Bacteria | 13922 |
| 97 | Ga0070679_100011514 | 3300005530 | Bacteria | 8432 |
| 98 | Ga0068853_100046429 | 3300005539 | Bacteria | 3724 |
| 99 | Ga0070672_100002560 | 3300005543 | Bacteria | 11596 |
| 100 | Ga0070672_100003962 | 3300005543 | Bacteria | 9657 |
| 101 | Ga0070672_100015151 | 3300005543 | Bacteria | 5481 |
| 102 | Ga0070672_100030997 | 3300005543 | Bacteria | 4022 |
| 103 | Ga0070693_100011018 | 3300005547 | Bacteria | 4545 |
| 104 | Ga0070665_100000444 | 3300005548 | Bacteria | 60379 |
| 105 | Ga0070665_100000924 | 3300005548 | Bacteria | 37601 |
| 106 | Ga0070665_100001375 | 3300005548 | Bacteria | 28649 |
| 107 | Ga0068855_100016050 | 3300005563 | Bacteria | 9009 |
| 108 | Ga0068855_100082566 | 3300005563 | Bacteria | 3724 |
| 109 | Ga0070664_100000675 | 3300005564 | Bacteria | 26078 |
| 110 | Ga0070664_100013905 | 3300005564 | Bacteria | 6561 |
| 111 | Ga0070664_100067024 | 3300005564 | Bacteria | 3067 |
| 112 | Ga0068857_100011184 | 3300005577 | Bacteria | 7805 |
| 113 | Ga0068857_100013092 | 3300005577 | Bacteria | 7228 |
| 114 | Ga0068857_100055120 | 3300005577 | Bacteria | 3528 |
| 115 | Ga0068857_100055649 | 3300005577 | Bacteria | 3510 |
| 116 | Ga0068854_100015038 | 3300005578 | Bacteria | 5116 |
| 117 | Ga0068854_100027206 | 3300005578 | Bacteria | 3939 |
| 118 | Ga0068856_100013973 | 3300005614 | Bacteria | 7764 |
| 119 | Ga0068856_100014424 | 3300005614 | Bacteria | 7635 |
| 120 | Ga0068856_100067422 | 3300005614 | Bacteria | 3536 |
| 121 | Ga0070702_100000880 | 3300005615 | Bacteria | 11673 |
| 122 | Ga0068852_100049090 | 3300005616 | Bacteria | 3609 |
| 123 | Ga0068852_100056353 | 3300005616 | Bacteria | 3396 |
| 124 | Ga0068859_100023222 | 3300005617 | Bacteria | 6223 |
| 125 | Ga0068859_100032226 | 3300005617 | Bacteria | 5264 |
| 126 | Ga0068864_100001220 | 3300005618 | Bacteria | 21354 |
| 127 | Ga0068864_100006953 | 3300005618 | Bacteria | 9280 |
| 128 | Ga0068864_100046691 | 3300005618 | Bacteria | 3717 |
| 129 | Ga0068864_100065816 | 3300005618 | Bacteria | 3144 |
| 130 | Ga0068866_10009864 | 3300005718 | Bacteria | 4073 |
| 131 | Ga0068861_100010626 | 3300005719 | Bacteria | 6391 |
| 132 | Ga0068861_100021361 | 3300005719 | Bacteria | 4652 |
| 133 | Ga0068851_10008698 | 3300005834 | Bacteria | 4702 |
| 134 | Ga0068851_10014299 | 3300005834 | Bacteria | 3767 |
| 135 | Ga0068863_100001606 | 3300005841 | Bacteria | 22340 |
| 136 | Ga0068863_100003094 | 3300005841 | Bacteria | 16438 |
| 137 | Ga0068863_100007922 | 3300005841 | Bacteria | 10386 |
| 138 | Ga0068863_100020341 | 3300005841 | Bacteria | 6346 |
| 139 | Ga0068863_100041114 | 3300005841 | Bacteria | 4395 |
| 140 | Ga0068863_100060635 | 3300005841 | Bacteria | 3577 |
| 141 | Ga0068858_100000079 | 3300005842 | Bacteria | 100753 |
| 142 | Ga0068858_100001226 | 3300005842 | Bacteria | 26511 |
| 143 | Ga0068858_100001536 | 3300005842 | Bacteria | 23689 |
| 144 | Ga0068858_100013557 | 3300005842 | Bacteria | 7691 |
| 145 | Ga0068860_100002090 | 3300005843 | Bacteria | 21029 |
| 146 | Ga0068860_100004969 | 3300005843 | Bacteria | 13552 |
| 147 | Ga0068860_100032161 | 3300005843 | Bacteria | 5043 |
| 148 | Ga0068862_100016228 | 3300005844 | Bacteria | 6197 |
| 149 | Ga0068862_100032419 | 3300005844 | Bacteria | 4415 |
| 150 | Ga0068862_100034412 | 3300005844 | Bacteria | 4286 |
| 151 | Ga0081455_10004270 | 3300005937 | Bacteria | 16097 |
| 152 | Ga0081539_10000058 | 3300005985 | Bacteria | 256212 |
| 153 | Ga0075368_10000008 | 3300006042 | Bacteria | 49008 |
| 154 | Ga0075366_10004006 | 3300006195 | Bacteria | 7873 |
| 155 | Ga0097621_100000498 | 3300006237 | Bacteria | 27559 |
| 156 | Ga0097621_100036492 | 3300006237 | Bacteria | 3933 |
| 157 | Ga0075370_10021303 | 3300006353 | Bacteria | 3552 |
| 158 | Ga0075370_10024430 | 3300006353 | Bacteria | 3338 |
| 159 | Ga0068871_100000406 | 3300006358 | Bacteria | 29738 |
| 160 | Ga0075433_10046828 | 3300006852 | Bacteria | 3761 |
| 161 | Ga0075434_100038812 | 3300006871 | Bacteria | 4718 |
| 162 | Ga0068865_100011844 | 3300006881 | Bacteria | 5470 |
| 163 | Ga0068865_100060355 | 3300006881 | Unclassified | 2655 |
| 164 | Ga0097620_100023225 | 3300006931 | Bacteria | 6223 |
| 165 | Ga0097620_100032226 | 3300006931 | Bacteria | 5264 |
| 166 | Ga0105251_10006302 | 3300009011 | Bacteria | 7590 |
| 167 | Ga0105240_10006078 | 3300009093 | Bacteria | 17832 |
| 168 | Ga0105240_10045363 | 3300009093 | Bacteria | 5577 |
| 169 | Ga0111539_10080121 | 3300009094 | Bacteria | 3841 |
| 170 | Ga0105245_10014978 | 3300009098 | Bacteria | 6755 |
| 171 | Ga0105243_10000278 | 3300009148 | Bacteria | 57245 |
| 172 | Ga0105241_10023208 | 3300009174 | Bacteria | 4599 |
| 173 | Ga0105241_10024226 | 3300009174 | Bacteria | 4507 |
| 174 | Ga0105242_10013827 | 3300009176 | Bacteria | 6247 |
| 175 | Ga0105248_10002150 | 3300009177 | Bacteria | 21793 |
| 176 | Ga0105248_10008338 | 3300009177 | Bacteria | 11388 |
| 177 | Ga0105248_10021987 | 3300009177 | Bacteria | 7068 |
| 178 | Ga0105248_10027068 | 3300009177 | Bacteria | 6379 |
| 179 | Ga0105248_10070297 | 3300009177 | Bacteria | 3931 |
| 180 | Ga0105238_10026317 | 3300009551 | Bacteria | 5929 |
| 181 | Ga0105238_10033510 | 3300009551 | Bacteria | 5227 |
| 182 | Ga0105238_10042358 | 3300009551 | Bacteria | 4611 |
| 183 | Ga0105238_10047069 | 3300009551 | Bacteria | 4350 |
| 184 | Ga0105249_10001260 | 3300009553 | Bacteria | 22219 |
| 185 | Ga0105249_10048566 | 3300009553 | Bacteria | 3869 |
| 186 | Ga0105239_10000025 | 3300010375 | Bacteria | 254049 |
| 187 | Ga0105239_10016097 | 3300010375 | Bacteria | 8273 |
| 188 | Ga0105239_10094196 | 3300010375 | Bacteria | 3307 |
| 189 | Ga0105239_10122728 | 3300010375 | Bacteria | 2886 |
| 190 | Ga0105246_10000491 | 3300011119 | Bacteria | 21441 |
| 191 | Ga0105246_10022644 | 3300011119 | Bacteria | 4056 |
| 192 | Ga0157373_10012355 | 3300013100 | Bacteria | 6278 |
| 193 | Ga0157373_10031816 | 3300013100 | Bacteria | 3798 |
| 194 | Ga0157371_10000285 | 3300013102 | Bacteria | 68525 |
| 195 | Ga0157371_10019625 | 3300013102 | Bacteria | 4980 |
| 196 | Ga0157371_10035051 | 3300013102 | Bacteria | 3598 |
| 197 | Ga0157370_10008766 | 3300013104 | Bacteria | 10871 |
| 198 | Ga0157370_10013844 | 3300013104 | Bacteria | 8284 |
| 199 | Ga0157370_10016460 | 3300013104 | Bacteria | 7485 |
| 200 | Ga0157369_10027670 | 3300013105 | Bacteria | 6282 |
| 201 | Ga0157369_10083649 | 3300013105 | Bacteria | 3412 |
| 202 | Ga0157374_10001212 | 3300013296 | Bacteria | 22054 |
| 203 | Ga0157374_10015708 | 3300013296 | Bacteria | 6647 |
| 204 | Ga0157378_10032569 | 3300013297 | Bacteria | 4606 |
| 205 | Ga0157378_10064221 | 3300013297 | Bacteria | 3283 |
| 206 | Ga0163162_10003408 | 3300013306 | Bacteria | 15175 |
| 207 | Ga0163162_10006458 | 3300013306 | Bacteria | 11358 |
| 208 | Ga0163162_10009765 | 3300013306 | Bacteria | 9344 |
| 209 | Ga0163162_10096226 | 3300013306 | Bacteria | 3049 |
| 210 | Ga0157372_10025212 | 3300013307 | Bacteria | 6463 |
| 211 | Ga0157372_10087211 | 3300013307 | Bacteria | 3540 |
| 212 | Ga0157372_10089604 | 3300013307 | Bacteria | 3495 |
| 213 | Ga0157375_10040091 | 3300013308 | Bacteria | 4513 |
| 214 | Ga0157375_10046829 | 3300013308 | Bacteria | 4219 |
| 215 | Ga0163163_10000015 | 3300014325 | Bacteria | 214881 |
| 216 | Ga0163163_10002967 | 3300014325 | Bacteria | 14354 |
| 217 | Ga0157380_10002463 | 3300014326 | Bacteria | 12468 |
| 218 | Ga0182008_10015332 | 3300014497 | Bacteria | 4000 |
| 219 | Ga0157379_10000931 | 3300014968 | Bacteria | 23657 |
| 220 | Ga0157379_10011601 | 3300014968 | Bacteria | 7696 |
| 221 | Ga0157379_10035693 | 3300014968 | Bacteria | 4433 |
| 222 | Ga0157376_10009371 | 3300014969 | Bacteria | 7110 |
| 223 | Ga0183363_1004 | 3300015690 | Bacteria | 416766 |
| 224 | Ga0213876_10000524 | 3300021384 | Bacteria | 29280 |
| 225 | Ga0213876_10008661 | 3300021384 | Bacteria | 5504 |
| 226 | Ga0209147_101474 | 3300025229 | Bacteria | 8427 |
| 227 | Ga0209563_100105 | 3300025230 | Bacteria | 147936 |
| 228 | Ga0207427_100561 | 3300025231 | Bacteria | 18798 |
| 229 | Ga0207425_1000025 | 3300025245 | Bacteria | 321872 |
| 230 | Ga0209026_1000689 | 3300025250 | Bacteria | 20330 |
| 231 | Ga0209026_1001031 | 3300025250 | Bacteria | 13697 |
| 232 | Ga0209148_1000011 | 3300025254 | Bacteria | 1196503 |
| 233 | Ga0209148_1001558 | 3300025254 | Bacteria | 11072 |
| 234 | Ga0209129_1001489 | 3300025258 | Bacteria | 13016 |
| 235 | Ga0209233_1000003 | 3300025261 | Bacteria | 1607366 |
| 236 | Ga0209233_1000015 | 3300025261 | Bacteria | 980563 |
| 237 | Ga0209565_1000209 | 3300025263 | Bacteria | 68237 |
| 238 | Ga0209455_1000006 | 3300025272 | Bacteria | 1196503 |
| 239 | Ga0209675_1001006 | 3300025291 | Bacteria | 17716 |
| 240 | Ga0209676_1000529 | 3300025292 | Bacteria | 59605 |
| 241 | Ga0209676_1000557 | 3300025292 | Bacteria | 56440 |
| 242 | Ga0209676_1013843 | 3300025292 | Bacteria | 3075 |
| 243 | Ga0209025_1000630 | 3300025294 | Bacteria | 62487 |
| 244 | Ga0209564_1002704 | 3300025295 | Bacteria | 13387 |
| 245 | Ga0209564_1011181 | 3300025295 | Bacteria | 4046 |
| 246 | Ga0209758_1000002 | 3300025297 | Bacteria | 1400310 |
| 247 | Ga0209758_1000108 | 3300025297 | Bacteria | 216541 |
| 248 | Ga0209758_1000404 | 3300025297 | Bacteria | 74016 |
| 249 | Ga0209758_1001130 | 3300025297 | Bacteria | 34283 |
| 250 | Ga0209050_1000001 | 3300025298 | Bacteria | 3563507 |
| 251 | Ga0209050_1001311 | 3300025298 | Bacteria | 27926 |
| 252 | Ga0209256_1002432 | 3300025299 | Bacteria | 15222 |
| 253 | Ga0209051_1000699 | 3300025303 | Bacteria | 36947 |
| 254 | Ga0209257_1000227 | 3300025304 | Bacteria | 133512 |
| 255 | Ga0209257_1000247 | 3300025304 | Bacteria | 125419 |
| 256 | Ga0209257_1000304 | 3300025304 | Bacteria | 107843 |
| 257 | Ga0209257_1000507 | 3300025304 | Bacteria | 68362 |
| 258 | Ga0207656_10006855 | 3300025321 | Bacteria | 4124 |
| 259 | Ga0207696_1001333 | 3300025711 | Bacteria | 13623 |
| 260 | Ga0207713_1017913 | 3300025735 | Bacteria | 3527 |
| 261 | Ga0207713_1018000 | 3300025735 | Bacteria | 3515 |
| 262 | Ga0207682_10000704 | 3300025893 | Bacteria | 15500 |
| 263 | Ga0207642_10006404 | 3300025899 | Bacteria | 3909 |
| 264 | Ga0207688_10033212 | 3300025901 | Bacteria | 2853 |
| 265 | Ga0207647_10000509 | 3300025904 | Bacteria | 31126 |
| 266 | Ga0207647_10001088 | 3300025904 | Bacteria | 20924 |
| 267 | Ga0207647_10005921 | 3300025904 | Bacteria | 8915 |
| 268 | Ga0207647_10008471 | 3300025904 | Bacteria | 7370 |
| 269 | Ga0207647_10013021 | 3300025904 | Bacteria | 5778 |
| 270 | Ga0207705_10000008 | 3300025909 | Bacteria | 589717 |
| 271 | Ga0207705_10001452 | 3300025909 | Bacteria | 18915 |
| 272 | Ga0207705_10008793 | 3300025909 | Bacteria | 7362 |
| 273 | Ga0207705_10022197 | 3300025909 | Bacteria | 4527 |
| 274 | Ga0207654_10001371 | 3300025911 | Bacteria | 12922 |
| 275 | Ga0207654_10007963 | 3300025911 | Bacteria | 5342 |
| 276 | Ga0207707_10036076 | 3300025912 | Bacteria | 4323 |
| 277 | Ga0207695_10007272 | 3300025913 | Bacteria | 14140 |
| 278 | Ga0207671_10006263 | 3300025914 | Bacteria | 10656 |
| 279 | Ga0207660_10002722 | 3300025917 | Bacteria | 11583 |
| 280 | Ga0207657_10000977 | 3300025919 | Bacteria | 30349 |
| 281 | Ga0207657_10001399 | 3300025919 | Bacteria | 25709 |
| 282 | Ga0207657_10001882 | 3300025919 | Bacteria | 22683 |
| 283 | Ga0207657_10003194 | 3300025919 | Bacteria | 17533 |
| 284 | Ga0207657_10017033 | 3300025919 | Bacteria | 6990 |
| 285 | Ga0207657_10059277 | 3300025919 | Bacteria | 3290 |
| 286 | Ga0207657_10060508 | 3300025919 | Bacteria | 3250 |
| 287 | Ga0207649_10022182 | 3300025920 | Bacteria | 3667 |
| 288 | Ga0207652_10005493 | 3300025921 | Bacteria | 10282 |
| 289 | Ga0207681_10000128 | 3300025923 | Bacteria | 61747 |
| 290 | Ga0207694_10005329 | 3300025924 | Bacteria | 9909 |
| 291 | Ga0207694_10016934 | 3300025924 | Bacteria | 5506 |
| 292 | Ga0207694_10030342 | 3300025924 | Bacteria | 4129 |
| 293 | Ga0207694_10035303 | 3300025924 | Bacteria | 3836 |
| 294 | Ga0207694_10047086 | 3300025924 | Bacteria | 3335 |
| 295 | Ga0207650_10002895 | 3300025925 | Bacteria | 11846 |
| 296 | Ga0207650_10004342 | 3300025925 | Bacteria | 9684 |
| 297 | Ga0207650_10009402 | 3300025925 | Bacteria | 6682 |
| 298 | Ga0207650_10029865 | 3300025925 | Bacteria | 3922 |
| 299 | Ga0207650_10030395 | 3300025925 | Bacteria | 3891 |
| 300 | Ga0207650_10055407 | 3300025925 | Bacteria | 2943 |
| 301 | Ga0207659_10024563 | 3300025926 | Bacteria | 4040 |
| 302 | Ga0207664_10045238 | 3300025929 | Bacteria | 3451 |
| 303 | Ga0207644_10000230 | 3300025931 | Bacteria | 38307 |
| 304 | Ga0207644_10003103 | 3300025931 | Bacteria | 10697 |
| 305 | Ga0207644_10010126 | 3300025931 | Bacteria | 6211 |
| 306 | Ga0207690_10000005 | 3300025932 | Bacteria | 581199 |
| 307 | Ga0207690_10001059 | 3300025932 | Bacteria | 17615 |
| 308 | Ga0207690_10004578 | 3300025932 | Bacteria | 8170 |
| 309 | Ga0207690_10010182 | 3300025932 | Bacteria | 5585 |
| 310 | Ga0207690_10013749 | 3300025932 | Bacteria | 4872 |
| 311 | Ga0207706_10002787 | 3300025933 | Bacteria | 16978 |
| 312 | Ga0207706_10005207 | 3300025933 | Bacteria | 12136 |
| 313 | Ga0207706_10017644 | 3300025933 | Bacteria | 6431 |
| 314 | Ga0207706_10024036 | 3300025933 | Bacteria | 5468 |
| 315 | Ga0207706_10036198 | 3300025933 | Bacteria | 4385 |
| 316 | Ga0207706_10038867 | 3300025933 | Bacteria | 4221 |
| 317 | Ga0207706_10057359 | 3300025933 | Bacteria | 3431 |
| 318 | Ga0207709_10000039 | 3300025935 | Bacteria | 260127 |
| 319 | Ga0207669_10000171 | 3300025937 | Bacteria | 30352 |
| 320 | Ga0207669_10001692 | 3300025937 | Bacteria | 9377 |
| 321 | Ga0207704_10012465 | 3300025938 | Bacteria | 4219 |
| 322 | Ga0207691_10000916 | 3300025940 | Bacteria | 29221 |
| 323 | Ga0207691_10001114 | 3300025940 | Bacteria | 26751 |
| 324 | Ga0207691_10002685 | 3300025940 | Bacteria | 17397 |
| 325 | Ga0207691_10020611 | 3300025940 | Bacteria | 6233 |
| 326 | Ga0207691_10048964 | 3300025940 | Bacteria | 3872 |
| 327 | Ga0207711_10001043 | 3300025941 | Bacteria | 26500 |
| 328 | Ga0207711_10001704 | 3300025941 | Bacteria | 20237 |
| 329 | Ga0207711_10002307 | 3300025941 | Bacteria | 17103 |
| 330 | Ga0207711_10004471 | 3300025941 | Bacteria | 11919 |
| 331 | Ga0207711_10030462 | 3300025941 | Bacteria | 4551 |
| 332 | Ga0207679_10001524 | 3300025945 | Bacteria | 14478 |
| 333 | Ga0207679_10007251 | 3300025945 | Bacteria | 7028 |
| 334 | Ga0207679_10010931 | 3300025945 | Bacteria | 5857 |
| 335 | Ga0207667_10008955 | 3300025949 | Bacteria | 11838 |
| 336 | Ga0207667_10072956 | 3300025949 | Bacteria | 3567 |
| 337 | Ga0207651_10003423 | 3300025960 | Bacteria | 7792 |
| 338 | Ga0207712_10000280 | 3300025961 | Bacteria | 48628 |
| 339 | Ga0207668_10001009 | 3300025972 | Bacteria | 16846 |
| 340 | Ga0207668_10011558 | 3300025972 | Bacteria | 5370 |
| 341 | Ga0207668_10039494 | 3300025972 | Bacteria | 3177 |
| 342 | Ga0207640_10010081 | 3300025981 | Bacteria | 5310 |
| 343 | Ga0207640_10030917 | 3300025981 | Bacteria | 3303 |
| 344 | Ga0207658_10000913 | 3300025986 | Bacteria | 24495 |
| 345 | Ga0207658_10003201 | 3300025986 | Bacteria | 11651 |
| 346 | Ga0207658_10005473 | 3300025986 | Bacteria | 8704 |
| 347 | Ga0207658_10010628 | 3300025986 | Bacteria | 6256 |
| 348 | Ga0207658_10016029 | 3300025986 | Bacteria | 5147 |
| 349 | Ga0207677_10000059 | 3300026023 | Bacteria | 94553 |
| 350 | Ga0207677_10009419 | 3300026023 | Bacteria | 5498 |
| 351 | Ga0207703_10000051 | 3300026035 | Bacteria | 145390 |
| 352 | Ga0207703_10001249 | 3300026035 | Bacteria | 23830 |
| 353 | Ga0207703_10001844 | 3300026035 | Bacteria | 18887 |
| 354 | Ga0207703_10008783 | 3300026035 | Bacteria | 7967 |
| 355 | Ga0207639_10029517 | 3300026041 | Bacteria | 4016 |
| 356 | Ga0207639_10035340 | 3300026041 | Bacteria | 3697 |
| 357 | Ga0207678_10008848 | 3300026067 | Bacteria | 8864 |
| 358 | Ga0207678_10027006 | 3300026067 | Bacteria | 5006 |
| 359 | Ga0207678_10050579 | 3300026067 | Bacteria | 3590 |
| 360 | Ga0207702_10004206 | 3300026078 | Bacteria | 12864 |
| 361 | Ga0207702_10008323 | 3300026078 | Bacteria | 8759 |
| 362 | Ga0207702_10010790 | 3300026078 | Bacteria | 7623 |
| 363 | Ga0207702_10028453 | 3300026078 | Bacteria | 4645 |
| 364 | Ga0207641_10012940 | 3300026088 | Bacteria | 6845 |
| 365 | Ga0207641_10018178 | 3300026088 | Bacteria | 5762 |
| 366 | Ga0207641_10028697 | 3300026088 | Bacteria | 4599 |
| 367 | Ga0207648_10003577 | 3300026089 | Bacteria | 16261 |
| 368 | Ga0207676_10001732 | 3300026095 | Bacteria | 16057 |
| 369 | Ga0207676_10026812 | 3300026095 | Bacteria | 4286 |
| 370 | Ga0207674_10000060 | 3300026116 | Bacteria | 112806 |
| 371 | Ga0207674_10000065 | 3300026116 | Bacteria | 109485 |
| 372 | Ga0207674_10010652 | 3300026116 | Bacteria | 10396 |
| 373 | Ga0207674_10062676 | 3300026116 | Bacteria | 3755 |
| 374 | Ga0207675_100029761 | 3300026118 | Bacteria | 5085 |
| 375 | Ga0207683_10000888 | 3300026121 | Bacteria | 27470 |
| 376 | Ga0207683_10000976 | 3300026121 | Bacteria | 26222 |
| 377 | Ga0207683_10003935 | 3300026121 | Bacteria | 12886 |
| 378 | Ga0207683_10004155 | 3300026121 | Bacteria | 12535 |
| 379 | Ga0207698_10019761 | 3300026142 | Bacteria | 4619 |
| 380 | Ga0207698_10021037 | 3300026142 | Bacteria | 4505 |
| 381 | Ga0209813_10000045 | 3300027866 | Bacteria | 50254 |
| 382 | Ga0268266_10000131 | 3300028379 | Bacteria | 146628 |
| 383 | Ga0268266_10002172 | 3300028379 | Bacteria | 21495 |
| 384 | Ga0268266_10008928 | 3300028379 | Bacteria | 8869 |
| 385 | Ga0268266_10036760 | 3300028379 | Bacteria | 4171 |
| 386 | Ga0268265_10001693 | 3300028380 | Bacteria | 17947 |
| 387 | Ga0268265_10019969 | 3300028380 | Bacteria | 4667 |
| 388 | Ga0268265_10034677 | 3300028380 | Bacteria | 3680 |
| 389 | Ga0268264_10000750 | 3300028381 | Bacteria | 36591 |
| 390 | Ga0268264_10012656 | 3300028381 | Bacteria | 6946 |
| 391 | Ga0268264_10014440 | 3300028381 | Bacteria | 6490 |
| 392 | Ga0268264_10021323 | 3300028381 | Bacteria | 5290 |
| 393 | Ga0268264_10052488 | 3300028381 | Bacteria | 3399 |
| 394 | Ga0307517_10024840 | 3300028786 | Bacteria | 7359 |
| 395 | Ga0307513_10010218 | 3300031456 | Bacteria | 11790 |
| 396 | Ga0307513_10011868 | 3300031456 | Bacteria | 10793 |
| 397 | Ga0307513_10015230 | 3300031456 | Bacteria | 9333 |
| 398 | Ga0307513_10023295 | 3300031456 | Bacteria | 7238 |
| 399 | Ga0307509_10068302 | 3300031507 | Bacteria | 3720 |
| 400 | Ga0307508_10003117 | 3300031616 | Bacteria | 16994 |
| 401 | Ga0307516_10022995 | 3300031730 | Bacteria | 6396 |
| 402 | Ga0307405_10008340 | 3300031731 | Bacteria | 5244 |
| 403 | Ga0307405_10013608 | 3300031731 | Bacteria | 4344 |
| 404 | Ga0307413_10025457 | 3300031824 | Bacteria | 3244 |
| 405 | Ga0307406_10038360 | 3300031901 | Bacteria | 2965 |
| 406 | Ga0307412_10030904 | 3300031911 | Bacteria | 3377 |
| 407 | Ga0307409_100004387 | 3300031995 | Bacteria | 7919 |
| 408 | Ga0307409_100038932 | 3300031995 | Bacteria | 3522 |
| 409 | Ga0307414_10037134 | 3300032004 | Bacteria | 3259 |
| 410 | Ga0307414_10048537 | 3300032004 | Bacteria | 2929 |
| 411 | Ga0307411_10010227 | 3300032005 | Bacteria | 4988 |
| 412 | Ga0307415_100006075 | 3300032126 | Bacteria | 6474 |
| 413 | Ga0307415_100018196 | 3300032126 | Bacteria | 4237 |
| 414 | Ga0307510_10005453 | 3300033180 | Bacteria | 15153 |
| 415 | Ga0373931_0007833 | 3300035691 | Bacteria | 5049 |
| 416 | Ga0395899_0000981 | 3300037312 | Bacteria | 26323 |
| 417 | Ga0395899_0021088 | 3300037312 | Bacteria | 4941 |
| 418 | Ga0395899_0051287 | 3300037312 | Bacteria | 3062 |
| 419 | Ga0395900_0032222 | 3300037418 | Bacteria | 5388 |
| 420 | Ga0395900_0039052 | 3300037418 | Bacteria | 4892 |
| 421 | Ga0395900_0043982 | 3300037418 | Bacteria | 4603 |
| 422 | Ga0395900_0047347 | 3300037418 | Bacteria | 4427 |
| 423 | Ga0395900_0117886 | 3300037418 | Bacteria | 2724 |
| 424 | Ga0395898_0019094 | 3300037466 | Bacteria | 6978 |
| 425 | Ga0395898_0044063 | 3300037466 | Bacteria | 4394 |
| 426 | Ga0395898_0057012 | 3300037466 | Bacteria | 3806 |
| 427 | Ga0395898_0090031 | 3300037466 | Bacteria | 2953 |
| 428 | Ga0395905_0000533 | 3300037471 | Bacteria | 52133 |
| 429 | Ga0395905_0009369 | 3300037471 | Bacteria | 9576 |
| 430 | Ga0395905_0025177 | 3300037471 | Bacteria | 5612 |
| 431 | Ga0395905_0034176 | 3300037471 | Bacteria | 4773 |
| 432 | Ga0395905_0035144 | 3300037471 | Bacteria | 4705 |
| 433 | Ga0395905_0044281 | 3300037471 | Bacteria | 4176 |
| 434 | Ga0395905_0046337 | 3300037471 | Bacteria | 4077 |
| 435 | Ga0395901_0011606 | 3300038443 | Bacteria | 8926 |
| 436 | Ga0395901_0018571 | 3300038443 | Bacteria | 7101 |
| 437 | Ga0395901_0018841 | 3300038443 | Bacteria | 7055 |
| 438 | Ga0395901_0028227 | 3300038443 | Bacteria | 5772 |
| 439 | Ga0395901_0076311 | 3300038443 | Bacteria | 3496 |
| 440 | Ga0436365_0712054 | 3300039437 | Bacteria | 12827 |
| 441 | Ga0436365_1754682 | 3300039437 | Bacteria | 25742 |
| 442 | Ga0439465_0001605 | 3300041413 | Bacteria | 7355 |
| 443 | Ga0451807_0362855 | 3300041486 | Bacteria | 7260 |
| 444 | Ga0439445_0004692 | 3300042004 | Bacteria | 3099 |
| 445 | Ga0439448_0010905 | 3300042005 | Bacteria | 2702 |
| 446 | Ga0439455_0000040 | 3300042012 | Bacteria | 11220 |
| 447 | Ga0439458_0000036 | 3300042157 | Bacteria | 21009 |
| 448 | Ga0466960_0009985 | 3300044901 | Bacteria | 3930 |
| 449 | Ga0466959_0028756 | 3300045049 | Bacteria | 4119 |
| 450 | Ga0466967_0036333 | 3300045976 | Bacteria | 4204 |
| 451 | Ga0495627_001098 | 3300046453 | Bacteria | 17664 |
| 452 | Ga0495638_0003589 | 3300046460 | Bacteria | 12149 |
| 453 | Ga0495638_0013710 | 3300046460 | Bacteria | 5507 |
| 454 | Ga0495650_0000024 | 3300046471 | Bacteria | 496674 |
| 455 | Ga0495650_0000290 | 3300046471 | Bacteria | 93004 |
| 456 | Ga0495650_0008893 | 3300046471 | Bacteria | 5787 |
| 457 | Ga0495584_0016999 | 3300046491 | Bacteria | 3707 |
| 458 | Ga0495585_0002673 | 3300046492 | Bacteria | 12490 |
| 459 | Ga0495596_0000135 | 3300046500 | Bacteria | 50784 |
| 460 | Ga0495596_0001630 | 3300046500 | Bacteria | 12748 |
| 461 | Ga0495596_0001690 | 3300046500 | Bacteria | 12483 |
| 462 | Ga0495607_0008063 | 3300046501 | Bacteria | 7231 |
| 463 | Ga0495607_0010945 | 3300046501 | Bacteria | 6067 |
| 464 | Ga0495583_0000373 | 3300046506 | Bacteria | 69685 |
| 465 | Ga0495583_0001065 | 3300046506 | Bacteria | 30658 |
| 466 | Ga0495583_0007137 | 3300046506 | Bacteria | 7114 |
| 467 | Ga0495606_0001200 | 3300046507 | Bacteria | 36440 |
| 468 | Ga0495610_0000061 | 3300046512 | Bacteria | 130986 |
| 469 | Ga0495610_0000095 | 3300046512 | Bacteria | 104629 |
| 470 | Ga0495610_0000107 | 3300046512 | Bacteria | 97076 |
| 471 | Ga0495610_0000154 | 3300046512 | Bacteria | 76596 |
| 472 | Ga0495610_0003085 | 3300046512 | Bacteria | 13304 |
| 473 | Ga0495616_0000099 | 3300046513 | Bacteria | 73607 |
| 474 | Ga0495620_0022603 | 3300046515 | Bacteria | 3025 |
| 475 | Ga0495632_0000925 | 3300046519 | Bacteria | 25723 |
| 476 | Ga0495637_0017962 | 3300046520 | Bacteria | 3286 |
| 477 | Ga0495643_0000321 | 3300046522 | Bacteria | 65956 |
| 478 | Ga0495643_0002608 | 3300046522 | Bacteria | 14038 |
| 479 | Ga0495643_0018139 | 3300046522 | Bacteria | 4098 |
| 480 | Ga0495648_0000189 | 3300046524 | Bacteria | 70824 |
| 481 | Ga0495648_0016022 | 3300046524 | Bacteria | 5414 |
| 482 | Ga0495663_0002958 | 3300046525 | Bacteria | 4997 |
| 483 | Ga0495654_0000153 | 3300046530 | Bacteria | 70297 |
| 484 | Ga0495609_0007491 | 3300046538 | Bacteria | 5443 |
| 485 | Ga0495621_0000694 | 3300046539 | Bacteria | 8497 |
| 486 | Ga0495622_0010263 | 3300046557 | Bacteria | 4331 |
| 487 | Ga0495633_0000178 | 3300046558 | Bacteria | 82451 |
| 488 | Ga0495668_0000181 | 3300046616 | Bacteria | 94147 |
| 489 | Ga0495668_0024450 | 3300046616 | Bacteria | 3435 |
| 490 | Ga0495625_0000107 | 3300046660 | Bacteria | 125777 |
| 491 | Ga0495625_0000915 | 3300046660 | Bacteria | 39689 |
| 492 | Ga0495625_0006851 | 3300046660 | Bacteria | 10063 |
| 493 | Ga0495625_0011108 | 3300046660 | Bacteria | 7374 |
| 494 | Ga0495625_0016101 | 3300046660 | Bacteria | 5892 |
| 495 | Ga0495625_0027441 | 3300046660 | Bacteria | 4287 |
| 496 | Ga0495625_0034633 | 3300046660 | Bacteria | 3725 |
| 497 | Ga0495625_0045175 | 3300046660 | Bacteria | 3186 |
| 498 | Ga0495669_0000848 | 3300046684 | Bacteria | 12962 |
| 499 | Ga0495669_0000967 | 3300046684 | Bacteria | 11988 |
| 500 | Ga0495670_0000029 | 3300046691 | Bacteria | 87662 |
| 501 | Ga0495671_0000125 | 3300046692 | Bacteria | 70115 |
| 502 | Ga0495649_0000351 | 3300046694 | Bacteria | 39624 |
| 503 | Ga0495649_0032293 | 3300046694 | Bacteria | 2884 |
| 504 | Ga0495660_0004837 | 3300046810 | Bacteria | 8124 |
| 505 | Ga0495672_0000723 | 3300047320 | Bacteria | 36353 |
| 506 | Ga0495683_0001719 | 3300047323 | Bacteria | 13885 |
| 507 | Ga0495683_0012193 | 3300047323 | Bacteria | 4518 |
| 508 | Ga0495687_000109 | 3300047443 | Bacteria | 125648 |
| 509 | Ga0495677_0008252 | 3300047445 | Bacteria | 3872 |
| 510 | Ga0495673_0000275 | 3300047469 | Bacteria | 70004 |
| 511 | Ga0495673_0009550 | 3300047469 | Bacteria | 5365 |
| 512 | Ga0495673_0011333 | 3300047469 | Bacteria | 4802 |
| 513 | Ga0495681_0000008 | 3300047470 | Bacteria | 215295 |
| 514 | Ga0495681_0001474 | 3300047470 | Bacteria | 17572 |
| 515 | Ga0495626_0001489 | 3300048091 | Bacteria | 18486 |
| 516 | Ga0496100_0005031 | 3300048903 | Bacteria | 7072 |
| 517 | Ga0496101_0004862 | 3300048904 | Bacteria | 8523 |
| 518 | Ga0496101_0006283 | 3300048904 | Bacteria | 7648 |
| 519 | Ga0496102_0000126 | 3300048905 | Bacteria | 105053 |
| 520 | Ga0496102_0001684 | 3300048905 | Bacteria | 19404 |
| 521 | Ga0496102_0003478 | 3300048905 | Bacteria | 13353 |
| 522 | Ga0496103_0000049 | 3300048906 | Bacteria | 154466 |
| 523 | Ga0496103_0000089 | 3300048906 | Bacteria | 104353 |
| 524 | Ga0496103_0005344 | 3300048906 | Bacteria | 7698 |
| 525 | Ga0496104_0000073 | 3300048907 | Bacteria | 104347 |
| 526 | Ga0496105_0000040 | 3300048908 | Bacteria | 117075 |
| 527 | Ga0496105_0000574 | 3300048908 | Bacteria | 24332 |
| 528 | Ga0496105_0017831 | 3300048908 | Bacteria | 5696 |
| 529 | Ga0496107_0004508 | 3300048910 | Bacteria | 9447 |
| 530 | Ga0496107_0004786 | 3300048910 | Bacteria | 9199 |
| 531 | Ga0496109_0007457 | 3300048912 | Bacteria | 9261 |
| 532 | Ga0496109_0014172 | 3300048912 | Bacteria | 6932 |
| 533 | Ga0496109_0022671 | 3300048912 | Bacteria | 5561 |
| 534 | Ga0496110_0010873 | 3300048913 | Bacteria | 7419 |
| 535 | Ga0496110_0050825 | 3300048913 | Bacteria | 3641 |
| 536 | Ga0496111_0003066 | 3300048914 | Bacteria | 10261 |
| 537 | Ga0496111_0003869 | 3300048914 | Bacteria | 9361 |
| 538 | Ga0496111_0007347 | 3300048914 | Bacteria | 7211 |
| 539 | Ga0496112_0002520 | 3300048915 | Bacteria | 14785 |
| 540 | Ga0496112_0042785 | 3300048915 | Bacteria | 4432 |
| 541 | Ga0496113_0001156 | 3300048916 | Bacteria | 14381 |
| 542 | Ga0496113_0006171 | 3300048916 | Bacteria | 7565 |
| 543 | Ga0496113_0007161 | 3300048916 | Bacteria | 7146 |
| 544 | Ga0496113_0018925 | 3300048916 | Bacteria | 4807 |
| 545 | Ga0496113_0052846 | 3300048916 | Bacteria | 3036 |
| 546 | Ga0496114_0013429 | 3300048917 | Bacteria | 6566 |
| 547 | Ga0496115_0000147 | 3300048918 | Bacteria | 64872 |
| 548 | Ga0496115_0000991 | 3300048918 | Bacteria | 20577 |
| 549 | Ga0496115_0015850 | 3300048918 | Bacteria | 5725 |
| 550 | Ga0496115_0023646 | 3300048918 | Bacteria | 4768 |
| 551 | Ga0496116_0000108 | 3300048919 | Bacteria | 187993 |
| 552 | Ga0496116_0011857 | 3300048919 | Bacteria | 7171 |
| 553 | Ga0496117_0000123 | 3300048920 | Bacteria | 169805 |
| 554 | Ga0496117_0000329 | 3300048920 | Bacteria | 83691 |
| 555 | Ga0496118_0000164 | 3300048921 | Bacteria | 119381 |
| 556 | Ga0496118_0000475 | 3300048921 | Bacteria | 66516 |
| 557 | Ga0496118_0004909 | 3300048921 | Bacteria | 15540 |
| 558 | Ga0496119_0000090 | 3300048922 | Bacteria | 134340 |
| 559 | Ga0496119_0013840 | 3300048922 | Bacteria | 6375 |
| 560 | Ga0496120_0000530 | 3300048923 | Bacteria | 58913 |
| 561 | Ga0496120_0018023 | 3300048923 | Bacteria | 4562 |
| 562 | Ga0496121_0000070 | 3300048924 | Bacteria | 249187 |
| 563 | Ga0496121_0000232 | 3300048924 | Bacteria | 119519 |
| 564 | Ga0496121_0000671 | 3300048924 | Bacteria | 63867 |
| 565 | Ga0496121_0018903 | 3300048924 | Bacteria | 6916 |
| 566 | Ga0496121_0059089 | 3300048924 | Bacteria | 3164 |
| 567 | Ga0496122_0002698 | 3300048925 | Bacteria | 24684 |
| 568 | Ga0496122_0011219 | 3300048925 | Bacteria | 9111 |
| 569 | Ga0496123_0001559 | 3300048926 | Bacteria | 31386 |
| 570 | Ga0496123_0001996 | 3300048926 | Bacteria | 26380 |
| 571 | Ga0496123_0007174 | 3300048926 | Bacteria | 10573 |
| 572 | Ga0496123_0036766 | 3300048926 | Bacteria | 3465 |
| 573 | Ga0496123_0042471 | 3300048926 | Bacteria | 3137 |
| 574 | Ga0496124_0000041 | 3300048927 | Bacteria | 303887 |
| 575 | Ga0496124_0002464 | 3300048927 | Bacteria | 24193 |
| 576 | Ga0496124_0002815 | 3300048927 | Bacteria | 22027 |
| 577 | Ga0496125_0000639 | 3300048928 | Bacteria | 58529 |
| 578 | Ga0496125_0008043 | 3300048928 | Bacteria | 11132 |
| 579 | Ga0496125_0011263 | 3300048928 | Bacteria | 8963 |
| 580 | Ga0496125_0078659 | 3300048928 | Bacteria | 2533 |
| 581 | Ga0496126_0000045 | 3300048929 | Bacteria | 331225 |
| 582 | Ga0496126_0000324 | 3300048929 | Bacteria | 101936 |
| 583 | Ga0496126_0001878 | 3300048929 | Bacteria | 30558 |
| 584 | Ga0496126_0002391 | 3300048929 | Bacteria | 25517 |
| 585 | Ga0496126_0046548 | 3300048929 | Bacteria | 3977 |
| 586 | Ga0501319_000171 | 3300049535 | Bacteria | 2601 |
| 587 | Ga0501033_0039098 | 3300049570 | Bacteria | 3544 |
| 588 | Ga0501068_0000454 | 3300049584 | Bacteria | 20768 |
| 589 | Ga0501069_0009786 | 3300049585 | Bacteria | 5068 |
| 590 | Ga0501070_0032046 | 3300049586 | Bacteria | 4400 |
| 591 | Ga0501071_0001958 | 3300049587 | Bacteria | 12284 |
| 592 | Ga0501072_0014476 | 3300049588 | Bacteria | 6045 |
| 593 | Ga0501073_0000546 | 3300049589 | Bacteria | 26539 |
| 594 | Ga0501074_0001739 | 3300049590 | Bacteria | 14886 |
| 595 | Ga0501079_0003895 | 3300049741 | Bacteria | 11015 |
| 596 | Ga0501080_0001294 | 3300049742 | Bacteria | 20808 |
| 597 | Ga0501267_000246 | 3300049764 | Bacteria | 3898 |
| 598 | nmdc:mga06z11_561_c1 | 3300050494 | Bacteria | 13600 |
| 599 | nmdc:mga04h51_75_c1 | 3300050495 | Bacteria | 31884 |
| 600 | nmdc:mga07m45_15451_c1 | 3300050496 | Bacteria | 3376 |
| 601 | nmdc:mga08y16_66807_c1 | 3300050511 | Bacteria | 3752 |
| 602 | nmdc:mga0a205_1958_c1 | 3300050515 | Bacteria | 17919 |
| 603 | Ga0500643_001050 | 3300053087 | Bacteria | 16751 |
| 604 | Ga0500643_001424 | 3300053087 | Bacteria | 13792 |
| 605 | Ga0500643_010993 | 3300053087 | Bacteria | 3332 |
| 606 | Ga0500644_0001000 | 3300053088 | Bacteria | 8751 |
| 607 | Ga0500583_0001396 | 3300053092 | Bacteria | 6914 |
| 608 | Ga0500651_0020740 | 3300053093 | Bacteria | 4092 |
| 609 | Ga0500556_0000014 | 3300053104 | Bacteria | 232989 |
| 610 | Ga0500556_0001644 | 3300053104 | Bacteria | 8735 |
| 611 | Ga0500562_000233 | 3300053108 | Bacteria | 14584 |
| 612 | Ga0500595_000943 | 3300053119 | Bacteria | 16406 |
| 613 | Ga0500595_001445 | 3300053119 | Bacteria | 12674 |
| 614 | Ga0500595_001579 | 3300053119 | Bacteria | 12024 |
| 615 | Ga0500595_004311 | 3300053119 | Bacteria | 6407 |
| 616 | Ga0500618_000369 | 3300053125 | Bacteria | 31202 |
| 617 | Ga0500642_0000001 | 3300053130 | Bacteria | 1468402 |
| 618 | Ga0500658_0002520 | 3300053134 | Bacteria | 7093 |
| 619 | Ga0500568_0011025 | 3300053139 | Bacteria | 4209 |
| 620 | Ga0500590_001811 | 3300053148 | Bacteria | 9044 |
| 621 | Ga0500604_0000053 | 3300053151 | Bacteria | 41228 |
| 622 | Ga0500616_0000193 | 3300053153 | Bacteria | 100119 |
| 623 | Ga0500616_0000411 | 3300053153 | Bacteria | 57962 |
| 624 | Ga0500622_0004577 | 3300053156 | Bacteria | 8615 |
| 625 | Ga0500627_0010970 | 3300053158 | Bacteria | 3324 |
| 626 | Ga0500570_000304 | 3300053724 | Bacteria | 17421 |
| 627 | Ga0500645_000001 | 3300053730 | Bacteria | 455558 |
| 628 | Ga0500645_000315 | 3300053730 | Bacteria | 34548 |
| 629 | Ga0500645_005420 | 3300053730 | Bacteria | 4701 |
| 630 | Ga0500609_000426 | 3300053731 | Bacteria | 6248 |
| 631 | Ga0500596_000599 | 3300053735 | Bacteria | 6930 |
| 632 | Ga0501084_0006006 | 3300054114 | Bacteria | 9986 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048914 | Ga0496111_0007347 | Ga0496111_0007347_11_2200 | 624 |
| 2 | 3300053119 | Ga0500595_000943 | Ga0500595_000943_7513_9846 | 681 |
| 3 | 3300048929 | Ga0496126_0046548 | Ga0496126_0046548_1666_3930 | 689 |
| 4 | 3300053092 | Ga0500583_0001396 | Ga0500583_0001396_995_3421 | 713 |
| 5 | 3300031456 | Ga0307513_10023295 | Ga0307513_100232952 | 714 |
| 6 | 3300053087 | Ga0500643_001050 | Ga0500643_001050_9289_11769 | 714 |
| 7 | 3300006237 | Ga0097621_100036492 | Ga0097621_1000364922 | 715 |
| 8 | 3300053104 | Ga0500556_0001644 | Ga0500556_0001644_2103_4559 | 717 |
| 9 | 3300053730 | Ga0500645_005420 | Ga0500645_005420_365_2821 | 717 |
| 10 | 3300025297 | Ga0209758_1001130 | Ga0209758_100113024 | 718 |
| 11 | 3300046460 | Ga0495638_0003589 | Ga0495638_0003589_9684_12101 | 718 |
| 12 | 3300046460 | Ga0495638_0013710 | Ga0495638_0013710_1914_4331 | 718 |
| 13 | 3300046513 | Ga0495616_0000099 | Ga0495616_0000099_55007_57424 | 718 |
| 14 | 3300046810 | Ga0495660_0004837 | Ga0495660_0004837_706_3123 | 718 |
| 15 | 3300053731 | Ga0500609_000426 | Ga0500609_000426_3265_5682 | 718 |
| 16 | 3300003781 | Ga0055536_1000512 | Ga0055536_100051218 | 719 |
| 17 | 3300003794 | Ga0055531_10000771 | Ga0055531_100007716 | 719 |
| 18 | 3300025292 | Ga0209676_1000529 | Ga0209676_100052918 | 719 |
| 19 | 3300025298 | Ga0209050_1001311 | Ga0209050_100131118 | 719 |
| 20 | 3300025304 | Ga0209257_1000304 | Ga0209257_100030448 | 719 |
| 21 | 3300047469 | Ga0495673_0011333 | Ga0495673_0011333_650_3067 | 719 |
| 22 | 3300046507 | Ga0495606_0001200 | Ga0495606_0001200_3495_5924 | 720 |
| 23 | 3300005331 | Ga0070670_100020117 | Ga0070670_1000201172 | 721 |
| 24 | 3300005347 | Ga0070668_100010941 | Ga0070668_1000109412 | 721 |
| 25 | 3300005367 | Ga0070667_100024786 | Ga0070667_1000247862 | 721 |
| 26 | 3300005618 | Ga0068864_100065816 | Ga0068864_1000658161 | 721 |
| 27 | 3300005719 | Ga0068861_100021361 | Ga0068861_1000213612 | 721 |
| 28 | 3300005841 | Ga0068863_100041114 | Ga0068863_1000411141 | 721 |
| 29 | 3300005843 | Ga0068860_100002090 | Ga0068860_10000209011 | 721 |
| 30 | 3300005844 | Ga0068862_100032419 | Ga0068862_1000324193 | 721 |
| 31 | 3300025972 | Ga0207668_10011558 | Ga0207668_100115583 | 721 |
| 32 | 3300025986 | Ga0207658_10005473 | Ga0207658_100054735 | 721 |
| 33 | 3300028380 | Ga0268265_10034677 | Ga0268265_100346772 | 721 |
| 34 | 3300028381 | Ga0268264_10012656 | Ga0268264_100126562 | 721 |
| 35 | 3300046616 | Ga0495668_0024450 | Ga0495668_0024450_60_2468 | 722 |
| 36 | 3300025250 | Ga0209026_1000689 | Ga0209026_100068911 | 723 |
| 37 | 3300005440 | Ga0070705_100004988 | Ga0070705_1000049883 | 724 |
| 38 | 3300005615 | Ga0070702_100000880 | Ga0070702_1000008803 | 724 |
| 39 | 3300005719 | Ga0068861_100010626 | Ga0068861_1000106264 | 724 |
| 40 | 3300006353 | Ga0075370_10024430 | Ga0075370_100244302 | 724 |
| 41 | 3300026118 | Ga0207675_100029761 | Ga0207675_1000297613 | 724 |
| 42 | 3300053156 | Ga0500622_0004577 | Ga0500622_0004577_1643_4075 | 724 |
| 43 | 3300031824 | Ga0307413_10025457 | Ga0307413_100254572 | 725 |
| 44 | 3300046471 | Ga0495650_0000024 | Ga0495650_0000024_22540_24969 | 725 |
| 45 | 3300005344 | Ga0070661_100046650 | Ga0070661_1000466501 | 726 |
| 46 | 3300013102 | Ga0157371_10035051 | Ga0157371_100350512 | 726 |
| 47 | 3300026067 | Ga0207678_10008848 | Ga0207678_100088487 | 726 |
| 48 | 3300005985 | Ga0081539_10000058 | Ga0081539_10000058152 | 728 |
| 49 | 3300049584 | Ga0501068_0000454 | Ga0501068_0000454_8042_10561 | 728 |
| 50 | iso_pu_bacteria | 2585428106 | 2587917148 | 728 |
| 51 | iso_pu_bacteria | 2643221640 | 2644223647 | 728 |
| 52 | iso_pu_bacteria | 2643221642 | 2644236265 | 728 |
| 53 | iso_pu_bacteria | 2928531327 | 2928531858 | 728 |
| 54 | 3300013104 | Ga0157370_10008766 | Ga0157370_100087663 | 729 |
| 55 | 3300031507 | Ga0307509_10068302 | Ga0307509_100683022 | 729 |
| 56 | 3300048925 | Ga0496122_0011219 | Ga0496122_0011219_3687_6197 | 729 |
| 57 | 3300048926 | Ga0496123_0001996 | Ga0496123_0001996_2759_5269 | 729 |
| 58 | 3300053153 | Ga0500616_0000193 | Ga0500616_0000193_94495_96936 | 729 |
| 59 | iso_pu_bacteria | 2582581293 | 2585194788 | 729 |
| 60 | iso_pu_bacteria | 2643221545 | 2643747416 | 729 |
| 61 | iso_pu_bacteria | 2643221583 | 2643922708 | 729 |
| 62 | iso_pu_bacteria | 2643221691 | 2644507386 | 729 |
| 63 | iso_pu_bacteria | 2818991435 | 2819538130 | 729 |
| 64 | iso_pu_bacteria | 2818991454 | 2819647300 | 729 |
| 65 | 3300005337 | Ga0070682_100011170 | Ga0070682_1000111704 | 730 |
| 66 | 3300046512 | Ga0495610_0000154 | Ga0495610_0000154_21508_23964 | 730 |
| 67 | 3300046522 | Ga0495643_0018139 | Ga0495643_0018139_1433_3889 | 730 |
| 68 | 3300047320 | Ga0495672_0000723 | Ga0495672_0000723_11056_13512 | 730 |
| 69 | 3300048918 | Ga0496115_0015850 | Ga0496115_0015850_1462_3918 | 730 |
| 70 | 3300053134 | Ga0500658_0002520 | Ga0500658_0002520_2080_4536 | 730 |
| 71 | 3300003322 | rootL2_10169340 | rootL2_101693402 | 731 |
| 72 | 3300006195 | Ga0075366_10004006 | Ga0075366_100040064 | 731 |
| 73 | 3300031456 | Ga0307513_10015230 | Ga0307513_100152308 | 731 |
| 74 | iso_pu_bacteria | 2849573788 | 2849577649 | 731 |
| 75 | iso_pu_bacteria | 2898329390 | 2898330456 | 731 |
| 76 | 3300003794 | Ga0055531_10003434 | Ga0055531_100034349 | 732 |
| 77 | 3300005262 | Ga0065165_1002251 | Ga0065165_10022515 | 732 |
| 78 | 3300025295 | Ga0209564_1002704 | Ga0209564_100270410 | 732 |
| 79 | 3300025299 | Ga0209256_1002432 | Ga0209256_10024329 | 732 |
| 80 | 3300025304 | Ga0209257_1000247 | Ga0209257_100024775 | 732 |
| 81 | 3300046530 | Ga0495654_0000153 | Ga0495654_0000153_41628_44057 | 732 |
| 82 | 3300048928 | Ga0496125_0008043 | Ga0496125_0008043_6670_9120 | 732 |
| 83 | 3300053119 | Ga0500595_001445 | Ga0500595_001445_5714_8389 | 732 |
| 84 | 3300053158 | Ga0500627_0010970 | Ga0500627_0010970_245_2674 | 732 |
| 85 | iso_pu_bacteria | 2643221598 | 2644001658 | 732 |
| 86 | 3300005548 | Ga0070665_100000924 | Ga0070665_10000092414 | 733 |
| 87 | 3300006881 | Ga0068865_100060355 | Ga0068865_1000603551 | 733 |
| 88 | 3300014325 | Ga0163163_10000015 | Ga0163163_10000015131 | 733 |
| 89 | 3300014326 | Ga0157380_10002463 | Ga0157380_100024634 | 733 |
| 90 | 3300014968 | Ga0157379_10011601 | Ga0157379_100116013 | 733 |
| 91 | 3300025940 | Ga0207691_10001114 | Ga0207691_1000111418 | 733 |
| 92 | 3300028379 | Ga0268266_10008928 | Ga0268266_100089284 | 733 |
| 93 | 3300049587 | Ga0501071_0001958 | Ga0501071_0001958_3604_6147 | 733 |
| 94 | 3300049588 | Ga0501072_0014476 | Ga0501072_0014476_3473_6016 | 733 |
| 95 | 3300049589 | Ga0501073_0000546 | Ga0501073_0000546_14920_17463 | 733 |
| 96 | 3300049590 | Ga0501074_0001739 | Ga0501074_0001739_6121_8664 | 733 |
| 97 | 3300049741 | Ga0501079_0003895 | Ga0501079_0003895_1245_3788 | 733 |
| 98 | 3300049742 | Ga0501080_0001294 | Ga0501080_0001294_565_3108 | 733 |
| 99 | 3300054114 | Ga0501084_0006006 | Ga0501084_0006006_6522_9065 | 733 |
| 100 | 3300005262 | Ga0065165_1002736 | Ga0065165_10027368 | 734 |
| 101 | 3300031901 | Ga0307406_10038360 | Ga0307406_100383601 | 734 |
| 102 | 3300031995 | Ga0307409_100004387 | Ga0307409_1000043872 | 734 |
| 103 | 3300041486 | Ga0451807_0362855 | Ga0451807_0362855_3380_5920 | 734 |
| 104 | 3300005327 | Ga0070658_10035423 | Ga0070658_100354232 | 735 |
| 105 | 3300005336 | Ga0070680_100010173 | Ga0070680_1000101737 | 735 |
| 106 | 3300005339 | Ga0070660_100024970 | Ga0070660_1000249701 | 735 |
| 107 | 3300005458 | Ga0070681_10011466 | Ga0070681_100114665 | 735 |
| 108 | 3300005530 | Ga0070679_100011514 | Ga0070679_1000115143 | 735 |
| 109 | 3300005563 | Ga0068855_100016050 | Ga0068855_1000160504 | 735 |
| 110 | 3300005937 | Ga0081455_10004270 | Ga0081455_100042704 | 735 |
| 111 | 3300009174 | Ga0105241_10024226 | Ga0105241_100242262 | 735 |
| 112 | 3300009551 | Ga0105238_10042358 | Ga0105238_100423583 | 735 |
| 113 | 3300011119 | Ga0105246_10022644 | Ga0105246_100226442 | 735 |
| 114 | 3300025909 | Ga0207705_10001452 | Ga0207705_1000145212 | 735 |
| 115 | 3300025911 | Ga0207654_10007963 | Ga0207654_100079632 | 735 |
| 116 | 3300025912 | Ga0207707_10036076 | Ga0207707_100360762 | 735 |
| 117 | 3300025917 | Ga0207660_10002722 | Ga0207660_100027224 | 735 |
| 118 | 3300025919 | Ga0207657_10000977 | Ga0207657_100009773 | 735 |
| 119 | 3300025921 | Ga0207652_10005493 | Ga0207652_100054934 | 735 |
| 120 | 3300025924 | Ga0207694_10030342 | Ga0207694_100303421 | 735 |
| 121 | 3300025932 | Ga0207690_10004578 | Ga0207690_100045781 | 735 |
| 122 | 3300025949 | Ga0207667_10008955 | Ga0207667_100089554 | 735 |
| 123 | 3300026121 | Ga0207683_10000888 | Ga0207683_100008883 | 735 |
| 124 | 3300005842 | Ga0068858_100000079 | Ga0068858_10000007991 | 736 |
| 125 | 3300026035 | Ga0207703_10000051 | Ga0207703_1000005126 | 736 |
| 126 | 3300005295 | Ga0065707_10082051 | Ga0065707_100820519 | 737 |
| 127 | 3300025925 | Ga0207650_10030395 | Ga0207650_100303952 | 737 |
| 128 | 3300048924 | Ga0496121_0059089 | Ga0496121_0059089_42_2633 | 737 |
| 129 | iso_pu_bacteria | 2643221663 | 2644351723 | 737 |
| 130 | 3300005331 | Ga0070670_100046132 | Ga0070670_1000461322 | 738 |
| 131 | 3300009177 | Ga0105248_10008338 | Ga0105248_100083389 | 738 |
| 132 | 3300025925 | Ga0207650_10029865 | Ga0207650_100298652 | 738 |
| 133 | 3300025941 | Ga0207711_10030462 | Ga0207711_100304622 | 738 |
| 134 | 3300049570 | Ga0501033_0039098 | Ga0501033_0039098_892_3381 | 738 |
| 135 | 3300028786 | Ga0307517_10024840 | Ga0307517_100248402 | 739 |
| 136 | 3300031456 | Ga0307513_10010218 | Ga0307513_1001021813 | 739 |
| 137 | 3300049535 | Ga0501319_000171 | Ga0501319_000171_47_2587 | 739 |
| 138 | 3300053108 | Ga0500562_000233 | Ga0500562_000233_7033_9510 | 739 |
| 139 | 3300003215 | JGI25153J46596_10013772 | JGI25153J46596_100137722 | 740 |
| 140 | 3300003791 | Ga0055530_10000640 | Ga0055530_100006406 | 740 |
| 141 | 3300025297 | Ga0209758_1000404 | Ga0209758_100040446 | 740 |
| 142 | 3300025304 | Ga0209257_1000227 | Ga0209257_100022765 | 740 |
| 143 | 3300025304 | Ga0209257_1000507 | Ga0209257_10005077 | 740 |
| 144 | iso_pu_bacteria | 2643221699 | 2644549876 | 740 |
| 145 | 3300046694 | Ga0495649_0000351 | Ga0495649_0000351_11662_14190 | 741 |
| 146 | 3300053088 | Ga0500644_0001000 | Ga0500644_0001000_2132_4774 | 741 |
| 147 | 3300053093 | Ga0500651_0020740 | Ga0500651_0020740_86_2728 | 741 |
| 148 | 3300037471 | Ga0395905_0009369 | Ga0395905_0009369_2820_5321 | 742 |
| 149 | 3300037471 | Ga0395905_0034176 | Ga0395905_0034176_1417_3921 | 742 |
| 150 | iso_pu_bacteria | 2643221574 | 2643883387 | 742 |
| 151 | iso_pu_bacteria | 2643221699 | 2644552739 | 742 |
| 152 | 3300003214 | JGI25165J46597_1000036 | JGI25165J46597_1000036161 | 743 |
| 153 | 3300025261 | Ga0209233_1000015 | Ga0209233_1000015939 | 743 |
| 154 | 3300031730 | Ga0307516_10022995 | Ga0307516_100229953 | 743 |
| 155 | 3300005466 | Ga0070685_10001187 | Ga0070685_100011879 | 744 |
| 156 | 3300038443 | Ga0395901_0018841 | Ga0395901_0018841_26_2554 | 744 |
| 157 | 3300053119 | Ga0500595_004311 | Ga0500595_004311_3186_5870 | 747 |
| 158 | 3300006237 | Ga0097621_100000498 | Ga0097621_10000049816 | 748 |
| 159 | 3300006358 | Ga0068871_100000406 | Ga0068871_10000040617 | 748 |
| 160 | 3300009553 | Ga0105249_10048566 | Ga0105249_100485662 | 749 |
| 161 | 3300015690 | Ga0183363_1004 | Ga0183363_1004257 | 749 |
| 162 | 3300013306 | Ga0163162_10006458 | Ga0163162_100064583 | 751 |
| 163 | 3300005331 | Ga0070670_100001616 | Ga0070670_10000161616 | 753 |
| 164 | 3300005543 | Ga0070672_100015151 | Ga0070672_1000151513 | 753 |
| 165 | 3300005564 | Ga0070664_100000675 | Ga0070664_10000067514 | 753 |
| 166 | 3300025901 | Ga0207688_10033212 | Ga0207688_100332121 | 753 |
| 167 | 3300025920 | Ga0207649_10022182 | Ga0207649_100221821 | 753 |
| 168 | 3300025925 | Ga0207650_10004342 | Ga0207650_100043428 | 753 |
| 169 | 3300025945 | Ga0207679_10001524 | Ga0207679_1000152412 | 753 |
| 170 | iso_pu_bacteria | 2928027323 | 2928028141 | 755 |
| 171 | iso_pu_bacteria | 2984555340 | 2984558471 | 755 |
| 172 | iso_pu_bacteria | 2984564862 | 2984567122 | 755 |
| 173 | iso_pu_bacteria | 2993356040 | 2993358213 | 755 |
| 174 | 3300001989 | JGI24739J22299_10011254 | JGI24739J22299_100112541 | 757 |
| 175 | 3300005327 | Ga0070658_10007123 | Ga0070658_100071237 | 757 |
| 176 | 3300005331 | Ga0070670_100034580 | Ga0070670_1000345802 | 757 |
| 177 | 3300005335 | Ga0070666_10012793 | Ga0070666_100127932 | 757 |
| 178 | 3300005339 | Ga0070660_100057743 | Ga0070660_1000577431 | 757 |
| 179 | 3300005344 | Ga0070661_100004811 | Ga0070661_1000048118 | 757 |
| 180 | 3300005355 | Ga0070671_100010596 | Ga0070671_1000105965 | 757 |
| 181 | 3300005364 | Ga0070673_100008675 | Ga0070673_1000086755 | 757 |
| 182 | 3300005456 | Ga0070678_100014896 | Ga0070678_1000148964 | 757 |
| 183 | 3300005457 | Ga0070662_100004268 | Ga0070662_1000042688 | 757 |
| 184 | 3300005459 | Ga0068867_100013928 | Ga0068867_1000139282 | 757 |
| 185 | 3300005718 | Ga0068866_10009864 | Ga0068866_100098642 | 757 |
| 186 | 3300005834 | Ga0068851_10008698 | Ga0068851_100086983 | 757 |
| 187 | 3300006881 | Ga0068865_100011844 | Ga0068865_1000118443 | 757 |
| 188 | 3300025899 | Ga0207642_10006404 | Ga0207642_100064042 | 757 |
| 189 | 3300025909 | Ga0207705_10022197 | Ga0207705_100221973 | 757 |
| 190 | 3300025924 | Ga0207694_10035303 | Ga0207694_100353032 | 757 |
| 191 | 3300025925 | Ga0207650_10055407 | Ga0207650_100554071 | 757 |
| 192 | 3300025938 | Ga0207704_10012465 | Ga0207704_100124652 | 757 |
| 193 | 3300026023 | Ga0207677_10009419 | Ga0207677_100094192 | 757 |
| 194 | 3300026088 | Ga0207641_10028697 | Ga0207641_100286972 | 757 |
| 195 | 3300026095 | Ga0207676_10026812 | Ga0207676_100268122 | 757 |
| 196 | 3300026142 | Ga0207698_10021037 | Ga0207698_100210373 | 757 |
| 197 | 3300028381 | Ga0268264_10021323 | Ga0268264_100213233 | 757 |
| 198 | 3300005367 | Ga0070667_100019910 | Ga0070667_1000199102 | 758 |
| 199 | 3300025986 | Ga0207658_10000913 | Ga0207658_1000091317 | 758 |
| 200 | 3300006042 | Ga0075368_10000008 | Ga0075368_1000000840 | 759 |
| 201 | 3300006353 | Ga0075370_10021303 | Ga0075370_100213032 | 759 |
| 202 | 3300027866 | Ga0209813_10000045 | Ga0209813_1000004531 | 759 |
| 203 | 3300050494 | nmdc:mga06z11_561_c1 | nmdc:mga06z11_561_c1_4459_6915 | 759 |
| 204 | 3300050495 | nmdc:mga04h51_75_c1 | nmdc:mga04h51_75_c1_2188_4644 | 759 |
| 205 | 3300050496 | nmdc:mga07m45_15451_c1 | nmdc:mga07m45_15451_c1_292_2748 | 759 |
| 206 | iso_pu_bacteria | 2990265787 | 2990269146 | 759 |
| 207 | iso_pu_bacteria | 2993693658 | 2993694849 | 759 |
| 208 | 3300013307 | Ga0157372_10089604 | Ga0157372_100896043 | 760 |
| 209 | 3300037471 | Ga0395905_0000533 | Ga0395905_0000533_35516_38143 | 760 |
| 210 | 3300046525 | Ga0495663_0002958 | Ga0495663_0002958_1552_4179 | 760 |
| 211 | 3300046684 | Ga0495669_0000967 | Ga0495669_0000967_4612_7239 | 760 |
| 212 | 3300032004 | Ga0307414_10037134 | Ga0307414_100371342 | 766 |
| 213 | 3300046558 | Ga0495633_0000178 | Ga0495633_0000178_3529_6033 | 766 |
| 214 | 3300005338 | Ga0068868_100010680 | Ga0068868_1000106803 | 767 |
| 215 | 3300005356 | Ga0070674_100004870 | Ga0070674_1000048706 | 767 |
| 216 | 3300005543 | Ga0070672_100002560 | Ga0070672_1000025604 | 767 |
| 217 | 3300005617 | Ga0068859_100023222 | Ga0068859_1000232222 | 767 |
| 218 | 3300005618 | Ga0068864_100006953 | Ga0068864_1000069538 | 767 |
| 219 | 3300005841 | Ga0068863_100007922 | Ga0068863_1000079223 | 767 |
| 220 | 3300006931 | Ga0097620_100023225 | Ga0097620_1000232252 | 767 |
| 221 | 3300009093 | Ga0105240_10045363 | Ga0105240_100453633 | 767 |
| 222 | 3300009098 | Ga0105245_10014978 | Ga0105245_100149782 | 767 |
| 223 | 3300009176 | Ga0105242_10013827 | Ga0105242_100138272 | 767 |
| 224 | 3300009177 | Ga0105248_10070297 | Ga0105248_100702972 | 767 |
| 225 | 3300013296 | Ga0157374_10015708 | Ga0157374_100157082 | 767 |
| 226 | 3300013297 | Ga0157378_10064221 | Ga0157378_100642212 | 767 |
| 227 | 3300013306 | Ga0163162_10003408 | Ga0163162_100034081 | 767 |
| 228 | 3300013306 | Ga0163162_10009765 | Ga0163162_100097652 | 767 |
| 229 | 3300013308 | Ga0157375_10040091 | Ga0157375_100400912 | 767 |
| 230 | 3300014968 | Ga0157379_10035693 | Ga0157379_100356933 | 767 |
| 231 | 3300014969 | Ga0157376_10009371 | Ga0157376_100093716 | 767 |
| 232 | 3300025904 | Ga0207647_10005921 | Ga0207647_100059216 | 767 |
| 233 | 3300025904 | Ga0207647_10013021 | Ga0207647_100130214 | 767 |
| 234 | 3300025919 | Ga0207657_10017033 | Ga0207657_100170334 | 767 |
| 235 | 3300025931 | Ga0207644_10000230 | Ga0207644_1000023035 | 767 |
| 236 | 3300025940 | Ga0207691_10002685 | Ga0207691_100026855 | 767 |
| 237 | 3300025941 | Ga0207711_10001704 | Ga0207711_100017044 | 767 |
| 238 | 3300025960 | Ga0207651_10003423 | Ga0207651_100034236 | 767 |
| 239 | 3300026089 | Ga0207648_10003577 | Ga0207648_1000357712 | 767 |
| 240 | 3300026121 | Ga0207683_10003935 | Ga0207683_1000393510 | 767 |
| 241 | 3300028379 | Ga0268266_10036760 | Ga0268266_100367602 | 767 |
| 242 | 3300035691 | Ga0373931_0007833 | Ga0373931_0007833_1923_4676 | 767 |
| 243 | 3300048903 | Ga0496100_0005031 | Ga0496100_0005031_2591_5344 | 767 |
| 244 | 3300048904 | Ga0496101_0006283 | Ga0496101_0006283_3418_6171 | 767 |
| 245 | 3300048906 | Ga0496103_0005344 | Ga0496103_0005344_3236_5989 | 767 |
| 246 | 3300048908 | Ga0496105_0017831 | Ga0496105_0017831_2771_5524 | 767 |
| 247 | 3300048910 | Ga0496107_0004508 | Ga0496107_0004508_1367_4120 | 767 |
| 248 | 3300048912 | Ga0496109_0014172 | Ga0496109_0014172_2578_5331 | 767 |
| 249 | 3300048913 | Ga0496110_0010873 | Ga0496110_0010873_3230_5983 | 767 |
| 250 | 3300048914 | Ga0496111_0003066 | Ga0496111_0003066_3569_6322 | 767 |
| 251 | 3300048916 | Ga0496113_0007161 | Ga0496113_0007161_2208_4961 | 767 |
| 252 | 3300026067 | Ga0207678_10027006 | Ga0207678_100270062 | 769 |
| 253 | 3300046500 | Ga0495596_0001690 | Ga0495596_0001690_3945_6524 | 769 |
| 254 | 3300001990 | JGI24737J22298_10007492 | JGI24737J22298_100074922 | 771 |
| 255 | 3300053125 | Ga0500618_000369 | Ga0500618_000369_6767_9295 | 771 |
| 256 | 3300025229 | Ga0209147_101474 | Ga0209147_1014744 | 772 |
| 257 | 3300046522 | Ga0495643_0000321 | Ga0495643_0000321_41807_44392 | 772 |
| 258 | 3300046538 | Ga0495609_0007491 | Ga0495609_0007491_1359_3824 | 772 |
| 259 | iso_pu_bacteria | 3000865235 | 3000866677 | 773 |
| 260 | 3300041413 | Ga0439465_0001605 | Ga0439465_0001605_3858_6362 | 774 |
| 261 | iso_pu_bacteria | 2946787523 | 2946790849 | 774 |
| 262 | 3300009093 | Ga0105240_10006078 | Ga0105240_100060789 | 775 |
| 263 | 3300010375 | Ga0105239_10000025 | Ga0105239_1000002545 | 775 |
| 264 | 3300025913 | Ga0207695_10007272 | Ga0207695_100072722 | 775 |
| 265 | 3300037471 | Ga0395905_0044281 | Ga0395905_0044281_292_2844 | 775 |
| 266 | 3300046501 | Ga0495607_0008063 | Ga0495607_0008063_3455_5953 | 775 |
| 267 | 3300047469 | Ga0495673_0009550 | Ga0495673_0009550_579_3158 | 775 |
| 268 | 3300048924 | Ga0496121_0000671 | Ga0496121_0000671_45007_47505 | 775 |
| 269 | 3300048929 | Ga0496126_0001878 | Ga0496126_0001878_16380_18878 | 775 |
| 270 | 3300032004 | Ga0307414_10048537 | Ga0307414_100485372 | 778 |
| 271 | 3300046512 | Ga0495610_0000107 | Ga0495610_0000107_40467_43058 | 778 |
| 272 | 3300046519 | Ga0495632_0000925 | Ga0495632_0000925_20497_23088 | 778 |
| 273 | 3300009093 | Ga0105240_10006078 | Ga0105240_1000607810 | 780 |
| 274 | 3300010375 | Ga0105239_10000025 | Ga0105239_1000002544 | 780 |
| 275 | 3300032126 | Ga0307415_100018196 | Ga0307415_1000181963 | 780 |
| 276 | 3300048925 | Ga0496122_0002698 | Ga0496122_0002698_3306_5924 | 781 |
| 277 | 3300048926 | Ga0496123_0001559 | Ga0496123_0001559_10274_12892 | 781 |
| 278 | 3300046524 | Ga0495648_0000189 | Ga0495648_0000189_5233_7827 | 782 |
| 279 | 3300046524 | Ga0495648_0016022 | Ga0495648_0016022_1569_4160 | 782 |
| 280 | iso_pu_bacteria | 2852653556 | 2852653951 | 782 |
| 281 | 3300031911 | Ga0307412_10030904 | Ga0307412_100309043 | 783 |
| 282 | 3300037418 | Ga0395900_0117886 | Ga0395900_0117886_105_2690 | 785 |
| 283 | 3300009148 | Ga0105243_10000278 | Ga0105243_1000027823 | 786 |
| 284 | 3300025935 | Ga0207709_10000039 | Ga0207709_1000003945 | 786 |
| 285 | 3300037312 | Ga0395899_0021088 | Ga0395899_0021088_1945_4548 | 786 |
| 286 | 3300045976 | Ga0466967_0036333 | Ga0466967_0036333_1570_4134 | 787 |
| 287 | iso_pu_bacteria | 2919138771 | 2919142162 | 787 |
| 288 | 3300048919 | Ga0496116_0000108 | Ga0496116_0000108_179566_182025 | 788 |
| 289 | 3300048926 | Ga0496123_0007174 | Ga0496123_0007174_2146_4605 | 788 |
| 290 | 3300048927 | Ga0496124_0002464 | Ga0496124_0002464_15678_18137 | 788 |
| 291 | 3300048928 | Ga0496125_0078659 | Ga0496125_0078659_22_2481 | 788 |
| 292 | 3300048929 | Ga0496126_0002391 | Ga0496126_0002391_6757_9216 | 788 |
| 293 | 3300013104 | Ga0157370_10016460 | Ga0157370_100164605 | 789 |
| 294 | 3300025263 | Ga0209565_1000209 | Ga0209565_100020913 | 789 |
| 295 | 3300025295 | Ga0209564_1011181 | Ga0209564_10111812 | 789 |
| 296 | 3300031616 | Ga0307508_10003117 | Ga0307508_100031173 | 789 |
| 297 | 3300045049 | Ga0466959_0028756 | Ga0466959_0028756_305_2920 | 789 |
| 298 | 3300046500 | Ga0495596_0000135 | Ga0495596_0000135_3644_6106 | 789 |
| 299 | 3300046512 | Ga0495610_0003085 | Ga0495610_0003085_10694_13156 | 789 |
| 300 | 3300048091 | Ga0495626_0001489 | Ga0495626_0001489_5691_8153 | 789 |
| 301 | 3300037466 | Ga0395898_0044063 | Ga0395898_0044063_13_2559 | 790 |
| 302 | 3300038443 | Ga0395901_0028227 | Ga0395901_0028227_1216_3768 | 790 |
| 303 | 3300013104 | Ga0157370_10013844 | Ga0157370_100138445 | 791 |
| 304 | 3300048924 | Ga0496121_0000671 | Ga0496121_0000671_42010_44499 | 791 |
| 305 | 3300048929 | Ga0496126_0001878 | Ga0496126_0001878_19386_21875 | 791 |
| 306 | 3300005617 | Ga0068859_100032226 | Ga0068859_1000322263 | 792 |
| 307 | 3300005841 | Ga0068863_100060635 | Ga0068863_1000606352 | 792 |
| 308 | 3300006931 | Ga0097620_100032226 | Ga0097620_1000322263 | 792 |
| 309 | 3300025941 | Ga0207711_10002307 | Ga0207711_1000230710 | 792 |
| 310 | 3300025986 | Ga0207658_10016029 | Ga0207658_100160293 | 792 |
| 311 | 3300026088 | Ga0207641_10012940 | Ga0207641_100129403 | 792 |
| 312 | 3300048905 | Ga0496102_0000126 | Ga0496102_0000126_50367_53216 | 792 |
| 313 | 3300048906 | Ga0496103_0000089 | Ga0496103_0000089_51041_53890 | 792 |
| 314 | 3300048908 | Ga0496105_0000574 | Ga0496105_0000574_1464_4313 | 792 |
| 315 | 3300048918 | Ga0496115_0000147 | Ga0496115_0000147_50367_53216 | 792 |
| 316 | 3300048919 | Ga0496116_0011857 | Ga0496116_0011857_965_3814 | 792 |
| 317 | 3300048920 | Ga0496117_0000329 | Ga0496117_0000329_48857_51706 | 792 |
| 318 | 3300048921 | Ga0496118_0000164 | Ga0496118_0000164_86043_88892 | 792 |
| 319 | 3300048922 | Ga0496119_0013840 | Ga0496119_0013840_2687_5536 | 792 |
| 320 | 3300048923 | Ga0496120_0018023 | Ga0496120_0018023_679_3528 | 792 |
| 321 | 3300048924 | Ga0496121_0000232 | Ga0496121_0000232_30517_33366 | 792 |
| 322 | 3300048927 | Ga0496124_0000041 | Ga0496124_0000041_252414_255263 | 792 |
| 323 | 3300048929 | Ga0496126_0000324 | Ga0496126_0000324_48707_51556 | 792 |
| 324 | 3300046506 | Ga0495583_0007137 | Ga0495583_0007137_493_3270 | 793 |
| 325 | iso_pu_bacteria | 2896429255 | 2896430020 | 793 |
| 326 | 3300031731 | Ga0307405_10008340 | Ga0307405_100083405 | 794 |
| 327 | 3300031995 | Ga0307409_100038932 | Ga0307409_1000389323 | 794 |
| 328 | 3300032126 | Ga0307415_100006075 | Ga0307415_1000060755 | 794 |
| 329 | 3300049585 | Ga0501069_0009786 | Ga0501069_0009786_786_3314 | 794 |
| 330 | 3300049586 | Ga0501070_0032046 | Ga0501070_0032046_448_2976 | 794 |
| 331 | 3300005543 | Ga0070672_100030997 | Ga0070672_1000309972 | 796 |
| 332 | 3300005547 | Ga0070693_100011018 | Ga0070693_1000110183 | 796 |
| 333 | 3300005844 | Ga0068862_100034412 | Ga0068862_1000344123 | 796 |
| 334 | 3300006852 | Ga0075433_10046828 | Ga0075433_100468282 | 796 |
| 335 | 3300021384 | Ga0213876_10000524 | Ga0213876_100005243 | 796 |
| 336 | 3300025940 | Ga0207691_10048964 | Ga0207691_100489643 | 796 |
| 337 | 3300025981 | Ga0207640_10030917 | Ga0207640_100309172 | 796 |
| 338 | 3300026035 | Ga0207703_10001844 | Ga0207703_100018442 | 796 |
| 339 | 3300026116 | Ga0207674_10010652 | Ga0207674_100106527 | 796 |
| 340 | 3300028380 | Ga0268265_10019969 | Ga0268265_100199693 | 796 |
| 341 | 3300039437 | Ga0436365_0712054 | Ga0436365_0712054_1727_4438 | 796 |
| 342 | 3300048924 | Ga0496121_0000070 | Ga0496121_0000070_102593_105196 | 796 |
| 343 | 3300050515 | nmdc:mga0a205_1958_c1 | nmdc:mga0a205_1958_c1_2722_5469 | 796 |
| 344 | 3300005356 | Ga0070674_100001269 | Ga0070674_1000012692 | 797 |
| 345 | 3300005456 | Ga0070678_100000152 | Ga0070678_1000001525 | 797 |
| 346 | 3300025937 | Ga0207669_10000171 | Ga0207669_1000017120 | 797 |
| 347 | 3300026121 | Ga0207683_10004155 | Ga0207683_100041556 | 797 |
| 348 | 3300005345 | Ga0070692_10000336 | Ga0070692_100003365 | 798 |
| 349 | 3300046500 | Ga0495596_0001630 | Ga0495596_0001630_4095_6638 | 798 |
| 350 | 3300046660 | Ga0495625_0045175 | Ga0495625_0045175_572_3115 | 798 |
| 351 | 3300005327 | Ga0070658_10040746 | Ga0070658_100407462 | 799 |
| 352 | 3300005339 | Ga0070660_100020181 | Ga0070660_1000201813 | 799 |
| 353 | 3300005347 | Ga0070668_100028146 | Ga0070668_1000281461 | 799 |
| 354 | 3300005435 | Ga0070714_100038998 | Ga0070714_1000389983 | 799 |
| 355 | 3300005457 | Ga0070662_100004016 | Ga0070662_1000040162 | 799 |
| 356 | 3300013102 | Ga0157371_10019625 | Ga0157371_100196253 | 799 |
| 357 | 3300013105 | Ga0157369_10027670 | Ga0157369_100276703 | 799 |
| 358 | 3300025929 | Ga0207664_10045238 | Ga0207664_100452382 | 799 |
| 359 | 3300025933 | Ga0207706_10002787 | Ga0207706_100027876 | 799 |
| 360 | 3300025972 | Ga0207668_10039494 | Ga0207668_100394941 | 799 |
| 361 | 3300026078 | Ga0207702_10028453 | Ga0207702_100284531 | 799 |
| 362 | 3300037418 | Ga0395900_0032222 | Ga0395900_0032222_194_2803 | 799 |
| 363 | 3300037466 | Ga0395898_0057012 | Ga0395898_0057012_114_2732 | 799 |
| 364 | 3300037471 | Ga0395905_0035144 | Ga0395905_0035144_1284_3902 | 799 |
| 365 | 3300011119 | Ga0105246_10000491 | Ga0105246_100004919 | 800 |
| 366 | 3300021384 | Ga0213876_10008661 | Ga0213876_100086613 | 800 |
| 367 | 3300039437 | Ga0436365_1754682 | Ga0436365_1754682_20440_23127 | 800 |
| 368 | 3300005331 | Ga0070670_100006019 | Ga0070670_1000060199 | 801 |
| 369 | 3300005335 | Ga0070666_10003370 | Ga0070666_100033701 | 801 |
| 370 | 3300005338 | Ga0068868_100000269 | Ga0068868_10000026929 | 801 |
| 371 | 3300005339 | Ga0070660_100011146 | Ga0070660_1000111463 | 801 |
| 372 | 3300005366 | Ga0070659_100000025 | Ga0070659_10000002568 | 801 |
| 373 | 3300005844 | Ga0068862_100016228 | Ga0068862_1000162284 | 801 |
| 374 | 3300025919 | Ga0207657_10003194 | Ga0207657_1000319414 | 801 |
| 375 | 3300025932 | Ga0207690_10000005 | Ga0207690_10000005408 | 801 |
| 376 | 3300026023 | Ga0207677_10000059 | Ga0207677_1000005974 | 801 |
| 377 | 3300028380 | Ga0268265_10001693 | Ga0268265_1000169313 | 801 |
| 378 | 3300053087 | Ga0500643_001424 | Ga0500643_001424_4932_7559 | 801 |
| 379 | 3300053724 | Ga0500570_000304 | Ga0500570_000304_7456_10086 | 801 |
| 380 | 3300005344 | Ga0070661_100006733 | Ga0070661_1000067334 | 802 |
| 381 | 3300005578 | Ga0068854_100015038 | Ga0068854_1000150383 | 802 |
| 382 | 3300025981 | Ga0207640_10010081 | Ga0207640_100100813 | 802 |
| 383 | 3300037312 | Ga0395899_0000981 | Ga0395899_0000981_21127_23832 | 802 |
| 384 | 3300002774 | JGI25150J39212_1000195 | JGI25150J39212_100019517 | 803 |
| 385 | 3300003215 | JGI25153J46596_10000208 | JGI25153J46596_1000020829 | 803 |
| 386 | 3300003792 | Ga0055540_1001676 | Ga0055540_10016762 | 803 |
| 387 | 3300005355 | Ga0070671_100004621 | Ga0070671_1000046218 | 803 |
| 388 | 3300005367 | Ga0070667_100010417 | Ga0070667_1000104174 | 803 |
| 389 | 3300005564 | Ga0070664_100013905 | Ga0070664_1000139052 | 803 |
| 390 | 3300005577 | Ga0068857_100013092 | Ga0068857_1000130925 | 803 |
| 391 | 3300005614 | Ga0068856_100013973 | Ga0068856_1000139732 | 803 |
| 392 | 3300005618 | Ga0068864_100001220 | Ga0068864_10000122011 | 803 |
| 393 | 3300005841 | Ga0068863_100020341 | Ga0068863_1000203412 | 803 |
| 394 | 3300005842 | Ga0068858_100013557 | Ga0068858_1000135571 | 803 |
| 395 | 3300009011 | Ga0105251_10006302 | Ga0105251_100063025 | 803 |
| 396 | 3300009177 | Ga0105248_10021987 | Ga0105248_100219875 | 803 |
| 397 | 3300013100 | Ga0157373_10012355 | Ga0157373_100123553 | 803 |
| 398 | 3300013307 | Ga0157372_10025212 | Ga0157372_100252124 | 803 |
| 399 | 3300014497 | Ga0182008_10015332 | Ga0182008_100153323 | 803 |
| 400 | 3300014968 | Ga0157379_10000931 | Ga0157379_1000093112 | 803 |
| 401 | 3300025245 | Ga0207425_1000025 | Ga0207425_100002526 | 803 |
| 402 | 3300025258 | Ga0209129_1001489 | Ga0209129_10014897 | 803 |
| 403 | 3300025294 | Ga0209025_1000630 | Ga0209025_100063051 | 803 |
| 404 | 3300025297 | Ga0209758_1000002 | Ga0209758_1000002110 | 803 |
| 405 | 3300025297 | Ga0209758_1000108 | Ga0209758_1000108107 | 803 |
| 406 | 3300025298 | Ga0209050_1000001 | Ga0209050_100000118 | 803 |
| 407 | 3300025303 | Ga0209051_1000699 | Ga0209051_100069918 | 803 |
| 408 | 3300025933 | Ga0207706_10024036 | Ga0207706_100240363 | 803 |
| 409 | 3300025945 | Ga0207679_10007251 | Ga0207679_100072514 | 803 |
| 410 | 3300025986 | Ga0207658_10010628 | Ga0207658_100106282 | 803 |
| 411 | 3300026035 | Ga0207703_10008783 | Ga0207703_100087837 | 803 |
| 412 | 3300026078 | Ga0207702_10004206 | Ga0207702_100042065 | 803 |
| 413 | 3300026116 | Ga0207674_10000060 | Ga0207674_1000006032 | 803 |
| 414 | 3300028381 | Ga0268264_10014440 | Ga0268264_100144404 | 803 |
| 415 | 3300032005 | Ga0307411_10010227 | Ga0307411_100102272 | 803 |
| 416 | 3300037471 | Ga0395905_0046337 | Ga0395905_0046337_1068_3800 | 803 |
| 417 | 3300048905 | Ga0496102_0003478 | Ga0496102_0003478_8227_10959 | 803 |
| 418 | 3300048912 | Ga0496109_0022671 | Ga0496109_0022671_893_3625 | 803 |
| 419 | 3300048915 | Ga0496112_0042785 | Ga0496112_0042785_419_3124 | 803 |
| 420 | 3300048916 | Ga0496113_0006171 | Ga0496113_0006171_2157_4889 | 803 |
| 421 | 3300005364 | Ga0070673_100025134 | Ga0070673_1000251343 | 804 |
| 422 | 3300005367 | Ga0070667_100014231 | Ga0070667_1000142315 | 804 |
| 423 | 3300006871 | Ga0075434_100038812 | Ga0075434_1000388122 | 804 |
| 424 | 3300013308 | Ga0157375_10046829 | Ga0157375_100468293 | 804 |
| 425 | 3300025904 | Ga0207647_10001088 | Ga0207647_100010885 | 804 |
| 426 | 3300025933 | Ga0207706_10005207 | Ga0207706_1000520710 | 804 |
| 427 | 3300037312 | Ga0395899_0051287 | Ga0395899_0051287_203_2848 | 804 |
| 428 | 3300037418 | Ga0395900_0039052 | Ga0395900_0039052_1042_3687 | 804 |
| 429 | 3300037466 | Ga0395898_0019094 | Ga0395898_0019094_491_3136 | 804 |
| 430 | 3300037471 | Ga0395905_0025177 | Ga0395905_0025177_1183_3828 | 804 |
| 431 | 3300038443 | Ga0395901_0018571 | Ga0395901_0018571_4180_6825 | 804 |
| 432 | 3300042005 | Ga0439448_0010905 | Ga0439448_0010905_81_2678 | 804 |
| 433 | 3300042012 | Ga0439455_0000040 | Ga0439455_0000040_1658_4255 | 804 |
| 434 | 3300046471 | Ga0495650_0000290 | Ga0495650_0000290_23881_26454 | 804 |
| 435 | 3300046492 | Ga0495585_0002673 | Ga0495585_0002673_6280_8853 | 804 |
| 436 | 3300046512 | Ga0495610_0000061 | Ga0495610_0000061_73866_76484 | 804 |
| 437 | 3300046515 | Ga0495620_0022603 | Ga0495620_0022603_18_2636 | 804 |
| 438 | 3300046660 | Ga0495625_0000915 | Ga0495625_0000915_6987_9560 | 804 |
| 439 | 3300053119 | Ga0500595_001579 | Ga0500595_001579_4018_6591 | 804 |
| 440 | 3300001979 | JGI24740J21852_10006563 | JGI24740J21852_100065633 | 805 |
| 441 | 3300005339 | Ga0070660_100000517 | Ga0070660_10000051715 | 805 |
| 442 | 3300005339 | Ga0070660_100003837 | Ga0070660_1000038373 | 805 |
| 443 | 3300005345 | Ga0070692_10002274 | Ga0070692_100022743 | 805 |
| 444 | 3300005366 | Ga0070659_100007854 | Ga0070659_1000078542 | 805 |
| 445 | 3300005444 | Ga0070694_100001237 | Ga0070694_1000012376 | 805 |
| 446 | 3300005457 | Ga0070662_100000794 | Ga0070662_1000007946 | 805 |
| 447 | 3300005577 | Ga0068857_100055120 | Ga0068857_1000551202 | 805 |
| 448 | 3300005843 | Ga0068860_100004969 | Ga0068860_1000049693 | 805 |
| 449 | 3300009553 | Ga0105249_10001260 | Ga0105249_1000126015 | 805 |
| 450 | 3300010375 | Ga0105239_10016097 | Ga0105239_100160975 | 805 |
| 451 | 3300013306 | Ga0163162_10096226 | Ga0163162_100962262 | 805 |
| 452 | 3300025904 | Ga0207647_10000509 | Ga0207647_1000050922 | 805 |
| 453 | 3300025919 | Ga0207657_10001399 | Ga0207657_1000139915 | 805 |
| 454 | 3300025919 | Ga0207657_10001882 | Ga0207657_1000188210 | 805 |
| 455 | 3300025919 | Ga0207657_10059277 | Ga0207657_100592771 | 805 |
| 456 | 3300025932 | Ga0207690_10001059 | Ga0207690_100010599 | 805 |
| 457 | 3300025933 | Ga0207706_10017644 | Ga0207706_100176442 | 805 |
| 458 | 3300025940 | Ga0207691_10020611 | Ga0207691_100206114 | 805 |
| 459 | 3300025961 | Ga0207712_10000280 | Ga0207712_1000028034 | 805 |
| 460 | 3300026041 | Ga0207639_10029517 | Ga0207639_100295172 | 805 |
| 461 | 3300026116 | Ga0207674_10062676 | Ga0207674_100626762 | 805 |
| 462 | 3300028381 | Ga0268264_10000750 | Ga0268264_100007504 | 805 |
| 463 | 3300046501 | Ga0495607_0010945 | Ga0495607_0010945_438_3023 | 805 |
| 464 | 3300046539 | Ga0495621_0000694 | Ga0495621_0000694_224_3025 | 805 |
| 465 | 3300046694 | Ga0495649_0032293 | Ga0495649_0032293_10_2712 | 805 |
| 466 | 3300049764 | Ga0501267_000246 | Ga0501267_000246_844_3519 | 805 |
| 467 | 3300053130 | Ga0500642_0000001 | Ga0500642_0000001_698624_701296 | 805 |
| 468 | 3300046691 | Ga0495670_0000029 | Ga0495670_0000029_27688_30366 | 806 |
| 469 | 3300005327 | Ga0070658_10013616 | Ga0070658_100136165 | 807 |
| 470 | 3300005577 | Ga0068857_100011184 | Ga0068857_1000111845 | 807 |
| 471 | 3300005618 | Ga0068864_100046691 | Ga0068864_1000466912 | 807 |
| 472 | 3300005841 | Ga0068863_100003094 | Ga0068863_1000030945 | 807 |
| 473 | 3300025254 | Ga0209148_1001558 | Ga0209148_100155810 | 807 |
| 474 | 3300025909 | Ga0207705_10008793 | Ga0207705_100087932 | 807 |
| 475 | 3300026116 | Ga0207674_10000065 | Ga0207674_1000006597 | 807 |
| 476 | 3300037418 | Ga0395900_0047347 | Ga0395900_0047347_625_3282 | 807 |
| 477 | 3300038443 | Ga0395901_0076311 | Ga0395901_0076311_705_3362 | 807 |
| 478 | 3300042157 | Ga0439458_0000036 | Ga0439458_0000036_3439_6096 | 807 |
| 479 | 3300046453 | Ga0495627_001098 | Ga0495627_001098_188_2818 | 807 |
| 480 | 3300046471 | Ga0495650_0008893 | Ga0495650_0008893_169_2799 | 807 |
| 481 | 3300047470 | Ga0495681_0001474 | Ga0495681_0001474_14764_17394 | 807 |
| 482 | 3300048918 | Ga0496115_0000991 | Ga0496115_0000991_6571_9387 | 807 |
| 483 | 3300053087 | Ga0500643_010993 | Ga0500643_010993_421_3291 | 807 |
| 484 | 3300005331 | Ga0070670_100036835 | Ga0070670_1000368352 | 808 |
| 485 | 3300009177 | Ga0105248_10002150 | Ga0105248_1000215010 | 808 |
| 486 | 3300009551 | Ga0105238_10026317 | Ga0105238_100263171 | 808 |
| 487 | 3300025924 | Ga0207694_10005329 | Ga0207694_100053295 | 808 |
| 488 | 3300025925 | Ga0207650_10009402 | Ga0207650_100094023 | 808 |
| 489 | 3300046491 | Ga0495584_0016999 | Ga0495584_0016999_655_3432 | 808 |
| 490 | 3300046506 | Ga0495583_0000373 | Ga0495583_0000373_955_3555 | 808 |
| 491 | 3300046520 | Ga0495637_0017962 | Ga0495637_0017962_723_3272 | 808 |
| 492 | 3300046660 | Ga0495625_0006851 | Ga0495625_0006851_5008_7785 | 808 |
| 493 | 3300046684 | Ga0495669_0000848 | Ga0495669_0000848_6942_9719 | 808 |
| 494 | 3300046692 | Ga0495671_0000125 | Ga0495671_0000125_1063_3663 | 808 |
| 495 | 3300047443 | Ga0495687_000109 | Ga0495687_000109_73739_76516 | 808 |
| 496 | 3300047469 | Ga0495673_0000275 | Ga0495673_0000275_66399_68999 | 808 |
| 497 | 3300048916 | Ga0496113_0052846 | Ga0496113_0052846_221_2998 | 808 |
| 498 | 3300048926 | Ga0496123_0036766 | Ga0496123_0036766_511_3288 | 808 |
| 499 | 3300048928 | Ga0496125_0000639 | Ga0496125_0000639_53994_56771 | 808 |
| 500 | 3300053730 | Ga0500645_000001 | Ga0500645_000001_376668_379445 | 808 |
| 501 | 3300003214 | JGI25165J46597_1000094 | JGI25165J46597_100009450 | 809 |
| 502 | 3300005614 | Ga0068856_100014424 | Ga0068856_1000144245 | 809 |
| 503 | 3300025231 | Ga0207427_100561 | Ga0207427_1005616 | 809 |
| 504 | 3300025250 | Ga0209026_1001031 | Ga0209026_10010314 | 809 |
| 505 | 3300025261 | Ga0209233_1000003 | Ga0209233_10000031329 | 809 |
| 506 | 3300025919 | Ga0207657_10060508 | Ga0207657_100605082 | 809 |
| 507 | 3300025972 | Ga0207668_10001009 | Ga0207668_1000100920 | 809 |
| 508 | 3300026078 | Ga0207702_10008323 | Ga0207702_100083236 | 809 |
| 509 | 3300037418 | Ga0395900_0043982 | Ga0395900_0043982_517_3198 | 809 |
| 510 | 3300037466 | Ga0395898_0090031 | Ga0395898_0090031_185_2866 | 809 |
| 511 | 3300038443 | Ga0395901_0011606 | Ga0395901_0011606_3520_6201 | 809 |
| 512 | 3300046522 | Ga0495643_0002608 | Ga0495643_0002608_6253_8973 | 809 |
| 513 | iso_pu_bacteria | 2510917021 | 2511127624 | 809 |
| 514 | 3300046512 | Ga0495610_0000095 | Ga0495610_0000095_9773_12337 | 810 |
| 515 | 3300047470 | Ga0495681_0000008 | Ga0495681_0000008_182155_184719 | 810 |
| 516 | iso_pu_bacteria | 2512564014 | 2512641958 | 810 |
| 517 | 3300001990 | JGI24737J22298_10004687 | JGI24737J22298_100046873 | 811 |
| 518 | 3300003759 | Ga0055525_1000037 | Ga0055525_100003781 | 811 |
| 519 | 3300005339 | Ga0070660_100010005 | Ga0070660_1000100052 | 811 |
| 520 | 3300005353 | Ga0070669_100017384 | Ga0070669_1000173842 | 811 |
| 521 | 3300005367 | Ga0070667_100029798 | Ga0070667_1000297982 | 811 |
| 522 | 3300005457 | Ga0070662_100008146 | Ga0070662_1000081463 | 811 |
| 523 | 3300005539 | Ga0068853_100046429 | Ga0068853_1000464292 | 811 |
| 524 | 3300005543 | Ga0070672_100003962 | Ga0070672_1000039625 | 811 |
| 525 | 3300005563 | Ga0068855_100082566 | Ga0068855_1000825662 | 811 |
| 526 | 3300005577 | Ga0068857_100055649 | Ga0068857_1000556492 | 811 |
| 527 | 3300005834 | Ga0068851_10014299 | Ga0068851_100142992 | 811 |
| 528 | 3300005841 | Ga0068863_100001606 | Ga0068863_10000160616 | 811 |
| 529 | 3300005842 | Ga0068858_100001226 | Ga0068858_10000122610 | 811 |
| 530 | 3300009177 | Ga0105248_10027068 | Ga0105248_100270682 | 811 |
| 531 | 3300013296 | Ga0157374_10001212 | Ga0157374_1000121219 | 811 |
| 532 | 3300014325 | Ga0163163_10002967 | Ga0163163_1000296710 | 811 |
| 533 | 3300025230 | Ga0209563_100105 | Ga0209563_10010555 | 811 |
| 534 | 3300025321 | Ga0207656_10006855 | Ga0207656_100068552 | 811 |
| 535 | 3300025914 | Ga0207671_10006263 | Ga0207671_100062635 | 811 |
| 536 | 3300025925 | Ga0207650_10002895 | Ga0207650_1000289510 | 811 |
| 537 | 3300025931 | Ga0207644_10010126 | Ga0207644_100101262 | 811 |
| 538 | 3300025932 | Ga0207690_10010182 | Ga0207690_100101822 | 811 |
| 539 | 3300025933 | Ga0207706_10038867 | Ga0207706_100388672 | 811 |
| 540 | 3300025940 | Ga0207691_10000916 | Ga0207691_1000091620 | 811 |
| 541 | 3300025941 | Ga0207711_10001043 | Ga0207711_100010434 | 811 |
| 542 | 3300025941 | Ga0207711_10004471 | Ga0207711_1000447110 | 811 |
| 543 | 3300025945 | Ga0207679_10010931 | Ga0207679_100109312 | 811 |
| 544 | 3300026041 | Ga0207639_10035340 | Ga0207639_100353402 | 811 |
| 545 | 3300026088 | Ga0207641_10018178 | Ga0207641_100181782 | 811 |
| 546 | 3300026095 | Ga0207676_10001732 | Ga0207676_100017327 | 811 |
| 547 | 3300026121 | Ga0207683_10000976 | Ga0207683_1000097623 | 811 |
| 548 | 3300044901 | Ga0466960_0009985 | Ga0466960_0009985_823_3615 | 811 |
| 549 | 3300046660 | Ga0495625_0016101 | Ga0495625_0016101_2009_4654 | 811 |
| 550 | 3300048904 | Ga0496101_0004862 | Ga0496101_0004862_4685_7426 | 811 |
| 551 | 3300048910 | Ga0496107_0004786 | Ga0496107_0004786_6112_8853 | 811 |
| 552 | 3300048912 | Ga0496109_0007457 | Ga0496109_0007457_5713_8454 | 811 |
| 553 | 3300048914 | Ga0496111_0003869 | Ga0496111_0003869_2301_5042 | 811 |
| 554 | 3300048915 | Ga0496112_0002520 | Ga0496112_0002520_2476_5217 | 811 |
| 555 | 3300048916 | Ga0496113_0001156 | Ga0496113_0001156_831_3572 | 811 |
| 556 | 3300048917 | Ga0496114_0013429 | Ga0496114_0013429_3416_6157 | 811 |
| 557 | 3300048918 | Ga0496115_0023646 | Ga0496115_0023646_1990_4731 | 811 |
| 558 | 3300048921 | Ga0496118_0000475 | Ga0496118_0000475_8967_11480 | 811 |
| 559 | 3300053104 | Ga0500556_0000014 | Ga0500556_0000014_72384_75029 | 811 |
| 560 | 3300053148 | Ga0500590_001811 | Ga0500590_001811_4231_6933 | 811 |
| 561 | 3300003781 | Ga0055536_1002435 | Ga0055536_100243513 | 812 |
| 562 | 3300005327 | Ga0070658_10000037 | Ga0070658_1000003736 | 812 |
| 563 | 3300005339 | Ga0070660_100002339 | Ga0070660_1000023399 | 812 |
| 564 | 3300005366 | Ga0070659_100010876 | Ga0070659_1000108763 | 812 |
| 565 | 3300005842 | Ga0068858_100001536 | Ga0068858_1000015364 | 812 |
| 566 | 3300025292 | Ga0209676_1000557 | Ga0209676_100055725 | 812 |
| 567 | 3300025909 | Ga0207705_10000008 | Ga0207705_10000008120 | 812 |
| 568 | 3300025932 | Ga0207690_10013749 | Ga0207690_100137491 | 812 |
| 569 | 3300026035 | Ga0207703_10001249 | Ga0207703_100012492 | 812 |
| 570 | 3300053139 | Ga0500568_0011025 | Ga0500568_0011025_404_3094 | 812 |
| 571 | 3300053153 | Ga0500616_0000411 | Ga0500616_0000411_29416_32106 | 812 |
| 572 | 3300013297 | Ga0157378_10032569 | Ga0157378_100325692 | 813 |
| 573 | 3300042004 | Ga0439445_0004692 | Ga0439445_0004692_260_3013 | 813 |
| 574 | 3300046660 | Ga0495625_0000107 | Ga0495625_0000107_54738_57392 | 813 |
| 575 | 3300053151 | Ga0500604_0000053 | Ga0500604_0000053_32206_34995 | 813 |
| 576 | 3300053730 | Ga0500645_000315 | Ga0500645_000315_6693_9338 | 813 |
| 577 | iso_pu_bacteria | 2738541275 | 2738712446 | 813 |
| 578 | iso_pu_bacteria | 2738541301 | 2738850860 | 813 |
| 579 | iso_pu_bacteria | 2738541304 | 2738866600 | 813 |
| 580 | iso_pu_bacteria | 2738543022 | 2739299107 | 813 |
| 581 | iso_pu_bacteria | 2738543033 | 2739360796 | 813 |
| 582 | iso_pu_bacteria | 2928959182 | 2928962809 | 813 |
| 583 | 3300003762 | Ga0055542_1000286 | Ga0055542_100028646 | 814 |
| 584 | 3300003763 | Ga0055529_1000207 | Ga0055529_100020746 | 814 |
| 585 | 3300005333 | Ga0070677_10000384 | Ga0070677_100003849 | 814 |
| 586 | 3300005548 | Ga0070665_100000444 | Ga0070665_10000044440 | 814 |
| 587 | 3300025254 | Ga0209148_1000011 | Ga0209148_10000111146 | 814 |
| 588 | 3300025272 | Ga0209455_1000006 | Ga0209455_100000646 | 814 |
| 589 | 3300025893 | Ga0207682_10000704 | Ga0207682_100007049 | 814 |
| 590 | 3300028379 | Ga0268266_10000131 | Ga0268266_1000013117 | 814 |
| 591 | 3300033180 | Ga0307510_10005453 | Ga0307510_100054538 | 814 |
| 592 | 3300046660 | Ga0495625_0011108 | Ga0495625_0011108_1689_4415 | 814 |
| 593 | 3300053735 | Ga0500596_000599 | Ga0500596_000599_4051_6681 | 815 |
| 594 | 3300001915 | JGI24741J21665_1002154 | JGI24741J21665_10021543 | 816 |
| 595 | 3300001979 | JGI24740J21852_10010664 | JGI24740J21852_100106642 | 816 |
| 596 | 3300005354 | Ga0070675_100032470 | Ga0070675_1000324702 | 816 |
| 597 | 3300005356 | Ga0070674_100002821 | Ga0070674_1000028217 | 816 |
| 598 | 3300005564 | Ga0070664_100067024 | Ga0070664_1000670241 | 816 |
| 599 | 3300005578 | Ga0068854_100027206 | Ga0068854_1000272062 | 816 |
| 600 | 3300005614 | Ga0068856_100067422 | Ga0068856_1000674222 | 816 |
| 601 | 3300005616 | Ga0068852_100049090 | Ga0068852_1000490902 | 816 |
| 602 | 3300009094 | Ga0111539_10080121 | Ga0111539_100801212 | 816 |
| 603 | 3300009174 | Ga0105241_10023208 | Ga0105241_100232083 | 816 |
| 604 | 3300010375 | Ga0105239_10094196 | Ga0105239_100941962 | 816 |
| 605 | 3300013100 | Ga0157373_10031816 | Ga0157373_100318162 | 816 |
| 606 | 3300013102 | Ga0157371_10000285 | Ga0157371_1000028515 | 816 |
| 607 | 3300013105 | Ga0157369_10083649 | Ga0157369_100836491 | 816 |
| 608 | 3300025904 | Ga0207647_10008471 | Ga0207647_100084715 | 816 |
| 609 | 3300025911 | Ga0207654_10001371 | Ga0207654_100013711 | 816 |
| 610 | 3300025924 | Ga0207694_10016934 | Ga0207694_100169342 | 816 |
| 611 | 3300025926 | Ga0207659_10024563 | Ga0207659_100245632 | 816 |
| 612 | 3300025933 | Ga0207706_10036198 | Ga0207706_100361982 | 816 |
| 613 | 3300025937 | Ga0207669_10001692 | Ga0207669_100016926 | 816 |
| 614 | 3300026067 | Ga0207678_10050579 | Ga0207678_100505792 | 816 |
| 615 | 3300026078 | Ga0207702_10010790 | Ga0207702_100107904 | 816 |
| 616 | 3300026142 | Ga0207698_10019761 | Ga0207698_100197612 | 816 |
| 617 | 3300031456 | Ga0307513_10011868 | Ga0307513_100118682 | 816 |
| 618 | 3300046506 | Ga0495583_0001065 | Ga0495583_0001065_5627_8263 | 816 |
| 619 | 3300046616 | Ga0495668_0000181 | Ga0495668_0000181_9863_12607 | 816 |
| 620 | 3300046660 | Ga0495625_0034633 | Ga0495625_0034633_726_3470 | 816 |
| 621 | 3300047323 | Ga0495683_0001719 | Ga0495683_0001719_8315_11083 | 816 |
| 622 | 3300047323 | Ga0495683_0012193 | Ga0495683_0012193_1246_3990 | 816 |
| 623 | 3300047445 | Ga0495677_0008252 | Ga0495677_0008252_647_3391 | 816 |
| 624 | 3300050511 | nmdc:mga08y16_66807_c1 | nmdc:mga08y16_66807_c1_329_3040 | 816 |
| 625 | 3300005843 | Ga0068860_100032161 | Ga0068860_1000321614 | 817 |
| 626 | 3300009551 | Ga0105238_10047069 | Ga0105238_100470693 | 817 |
| 627 | 3300025291 | Ga0209675_1001006 | Ga0209675_100100612 | 817 |
| 628 | 3300025292 | Ga0209676_1013843 | Ga0209676_10138431 | 817 |
| 629 | 3300028381 | Ga0268264_10052488 | Ga0268264_100524881 | 817 |
| 630 | 3300005289 | Ga0065704_10000479 | Ga0065704_100004791 | 819 |
| 631 | 3300005347 | Ga0070668_100000426 | Ga0070668_1000004267 | 819 |
| 632 | 3300025735 | Ga0207713_1018000 | Ga0207713_10180002 | 819 |
| 633 | iso_pu_bacteria | 2928100450 | 2928103498 | 819 |
| 634 | 3300046557 | Ga0495622_0010263 | Ga0495622_0010263_864_3515 | 820 |
| 635 | 3300046660 | Ga0495625_0027441 | Ga0495625_0027441_39_2645 | 820 |
| 636 | 3300002239 | JGI24034J26672_10000853 | JGI24034J26672_100008533 | 823 |
| 637 | 3300005353 | Ga0070669_100000160 | Ga0070669_10000016044 | 823 |
| 638 | 3300005355 | Ga0070671_100038781 | Ga0070671_1000387812 | 823 |
| 639 | 3300005548 | Ga0070665_100001375 | Ga0070665_1000013754 | 823 |
| 640 | 3300025711 | Ga0207696_1001333 | Ga0207696_10013334 | 823 |
| 641 | 3300025735 | Ga0207713_1017913 | Ga0207713_10179131 | 823 |
| 642 | 3300025923 | Ga0207681_10000128 | Ga0207681_1000012851 | 823 |
| 643 | 3300025931 | Ga0207644_10003103 | Ga0207644_100031036 | 823 |
| 644 | 3300025986 | Ga0207658_10003201 | Ga0207658_100032012 | 823 |
| 645 | 3300028379 | Ga0268266_10002172 | Ga0268266_100021723 | 823 |
| 646 | 3300048905 | Ga0496102_0001684 | Ga0496102_0001684_10532_13195 | 823 |
| 647 | 3300048906 | Ga0496103_0000049 | Ga0496103_0000049_51783_54446 | 823 |
| 648 | 3300048907 | Ga0496104_0000073 | Ga0496104_0000073_62267_64951 | 823 |
| 649 | 3300048908 | Ga0496105_0000040 | Ga0496105_0000040_52001_54685 | 823 |
| 650 | 3300048916 | Ga0496113_0018925 | Ga0496113_0018925_386_3049 | 823 |
| 651 | 3300048920 | Ga0496117_0000123 | Ga0496117_0000123_48238_50901 | 823 |
| 652 | 3300048921 | Ga0496118_0004909 | Ga0496118_0004909_181_2844 | 823 |
| 653 | 3300048922 | Ga0496119_0000090 | Ga0496119_0000090_79671_82355 | 823 |
| 654 | 3300048923 | Ga0496120_0000530 | Ga0496120_0000530_25584_28268 | 823 |
| 655 | 3300048924 | Ga0496121_0018903 | Ga0496121_0018903_162_2825 | 823 |
| 656 | 3300048927 | Ga0496124_0002815 | Ga0496124_0002815_3590_6247 | 823 |
| 657 | 3300048929 | Ga0496126_0000045 | Ga0496126_0000045_276585_279269 | 823 |
| 658 | 3300048913 | Ga0496110_0050825 | Ga0496110_0050825_430_2910 | 824 |
| 659 | 3300048926 | Ga0496123_0042471 | Ga0496123_0042471_473_2953 | 824 |
| 660 | 3300048928 | Ga0496125_0011263 | Ga0496125_0011263_5349_7829 | 824 |
| 661 | iso_pu_bacteria | 2808606401 | 2809061867 | 825 |
| 662 | iso_pu_bacteria | 2808606404 | 2809077831 | 825 |
| 663 | iso_pu_bacteria | 2808606405 | 2809082461 | 825 |
| 664 | iso_pu_bacteria | 2880518877 | 2880519950 | 825 |
| 665 | 3300001989 | JGI24739J22299_10012243 | JGI24739J22299_100122432 | 829 |
| 666 | 3300005457 | Ga0070662_100035798 | Ga0070662_1000357982 | 829 |
| 667 | 3300005616 | Ga0068852_100056353 | Ga0068852_1000563532 | 829 |
| 668 | 3300009551 | Ga0105238_10033510 | Ga0105238_100335102 | 829 |
| 669 | 3300025924 | Ga0207694_10047086 | Ga0207694_100470862 | 829 |
| 670 | 3300025933 | Ga0207706_10057359 | Ga0207706_100573592 | 829 |
| 671 | 3300025949 | Ga0207667_10072956 | Ga0207667_100729562 | 829 |
| 672 | 3300031731 | Ga0307405_10013608 | Ga0307405_100136082 | 829 |
| 673 | 3300001904 | JGI24736J21556_1002799 | JGI24736J21556_10027992 | 835 |
| 674 | 3300002075 | JGI24738J21930_10000692 | JGI24738J21930_100006928 | 835 |
| 675 | 3300005339 | Ga0070660_100055360 | Ga0070660_1000553601 | 835 |
| 676 | 3300010375 | Ga0105239_10122728 | Ga0105239_101227282 | 835 |
| 677 | 3300013307 | Ga0157372_10087211 | Ga0157372_100872112 | 835 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1nqf-assembly1.cif.gz_A | outer membrane cobalamin transporter (btub) from e. coli, methionine substiution construct for se-met sad phasing | 0.8538 | 53 | 830 |
| 1kmp-assembly1.cif.gz_A | crystal structure of the outer membrane transporter feca complexed with ferric citrate | 0.8506 | 54 | 830 |
| 1kmp-assembly1.cif.gz_A | crystal structure of the outer membrane transporter feca complexed with ferric citrate | 0.8424 | 54 | 830 |
| 6v81-assembly1.cif.gz_A | the crystal structure of the outer-membrane transporter yncd | 0.8382 | 50 | 830 |
| 3rgn-assembly1.cif.gz_A | crystal structure of spin-labeled btub w371r1 | 0.8345 | 55 | 830 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1kmpA02 | Mainly Beta;Beta Barrel;Maltoporin; Chain A;TonB-dependent receptor, beta-barrel domain | 0.816 | 172 | 830 | 2.40.170.20 |
| 1kmpA02 | Mainly Beta;Beta Barrel;Maltoporin; Chain A;TonB-dependent receptor, beta-barrel domain | 0.8116 | 172 | 830 | 2.40.170.20 |
| af_P76115_176_696_2.40.170.20 | Mainly Beta;Beta Barrel;Maltoporin; Chain A;TonB-dependent receptor, beta-barrel domain | 0.8065 | 185 | 828 | 2.40.170.20 |
| 4epaA00 | Mainly Beta;Beta Barrel;Maltoporin; Chain A;TonB-dependent receptor, beta-barrel domain | 0.8062 | 43 | 830 | 2.40.170.20 |
| 3rgnA02 | Mainly Beta;Beta Barrel;Maltoporin; Chain A;TonB-dependent receptor, beta-barrel domain | 0.8054 | 167 | 830 | 2.40.170.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2M7HFE1-F1-model_v4 | deleted | 0.913 | 449 | 830 |
|
| AF-A0A0S7XYG3-F1-model_v4 | TonB-dependent receptor plug domain-containing protein | 0.8796 | 53 | 830 |
GO:0009279
GO:0015344 |
| AF-A0A4Q2XVS8-F1-model_v4 | deleted | 0.8756 | 20 | 257 |
|
| AF-A0A6S6PJ28-F1-model_v4 | TonB-dependent receptor | 0.8729 | 49 | 830 |
GO:0009279
GO:0015344 |
| AF-A0A7Z9GL55-F1-model_v4 | TonB-dependent receptor | 0.8716 | 606 | 830 |
GO:0009279
GO:0015344 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar