F474566

General Info

Members Datasets Scaffolds Average Seq Length
677 347 632 870

Family's Representative Sequence

Representative Sequence 3300001915|JGI24741J21665_1002154|JGI24741J21665_10021543
Length 940
Sequence MRTQFLIGVAAAAIMLPGAAYAQSAGTADFEGDIVITATKASKGVGGVEIPDTTKARGVLNQEFISRQTPGNSILDTINALPGVSFQNNDPFGSAGGTLTIRGFDSSRISLTFDGVPLNDTGNYALYSNQQLDPELIEQVNVSYGSTDVDSPTAAASGSTVNYRTIMPTDQFGARLQGSIGDYNFFRVFGLINTGEFTKFGTKAWLSMSHAENNVVFNNFGKIRKAQYNGRVYQPIGSNGDFISIAANYNVNRNNFFGSAPLRYDTHNLSQITAPRSGAPIPGTPTDPTISRTNPFLIDNGLRTAGTGSGNRFPFDRDELPYSIARCQTAAARAGLVDAPAIVNNPXXSNNGQACGASFDERYNPSNTGNIRISSRFTLAPHLVLTVEPSFQYVKANGGGTVTGRESAAGYTQTANATRGAITTPIFGFIGGQYYFGRDLNGDGDKLDTVTLLAPSQTVTHRYGLISSLRYDINDNNTIRIAYSHDYGRHRQTGEVGLLQANGQPFDVFPINNGLTATNGRIVEKRDRLSFAILDQVSGEYRGEFGGLTVNLGVRAPFFKRNLNNFCFTTAANGNVDCLGRGNTADNATYATANPLAAAPQRRVFTYNRVLPNVGATYKFGGGFTAYVNYSKGLQVPGTDNLYQSFFYPLSNPAAHPTPETSDNFDTGVRYTTSKIQATISPWYTRFTNRLASAYDVVTDQTIYRNLGRVDKYGIDGSIAYRPMRELLIYAWGSYLKSDIKNNVEIGKCVGAKNSNDPTVAGNVAVTANCPTVGAPILAQTAGKRESGSPVYTYGLRLQGDIGPLSLGIQGKVTGPRYLNDQNLPNLGCTAALVNQICANASNTLAAFAAPTTSSTFAYGTSYQVYQAKTPAYGTVDVDARLKLGFLGLNDQTFFQVNVQNIFNKYYVGGFTGGSTVQYSAPFVQIGSPRAFIGTLNFQF

Samples

Sample ID Description Type Environment
1 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
2 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
3 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
4 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
5 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
6 2643221574 Brevundimonas sp. Root608 Isolate Unclassified
7 2643221583 Caulobacter sp. Root655 Isolate Unclassified
8 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
9 2643221640 Caulobacter sp. Root342 Isolate Unclassified
10 2643221642 Caulobacter sp. Root343 Isolate Unclassified
11 2643221663 Brevundimonas sp. Root1279 Isolate Unclassified
12 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
13 2643221699 Brevundimonas sp. Root1423 Isolate Unclassified
14 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
15 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
16 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
17 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
18 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
19 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
20 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
21 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
22 2818991435 Caulobacter henricii 536 Isolate Unclassified
23 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
24 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
25 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
26 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
27 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere
28 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
29 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
30 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
31 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
32 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
33 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
34 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
35 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
36 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
37 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
38 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
39 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
40 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
41 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
42 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
43 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
44 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
45 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
46 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
47 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
48 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
49 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
50 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
51 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
52 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
53 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
54 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
55 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
56 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
57 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
58 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
59 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
60 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
61 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
62 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
63 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
64 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
65 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
66 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
67 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
68 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
69 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
70 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
71 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
72 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
73 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
74 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
75 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
76 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
77 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
78 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
79 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
80 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
81 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
82 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
83 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
84 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
85 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
86 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
87 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
88 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
89 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
90 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
91 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
92 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
93 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
94 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
95 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
96 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
97 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
98 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
99 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
100 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
101 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
102 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
103 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
104 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
105 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
106 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
107 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
108 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
109 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
110 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
111 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
112 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
113 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
114 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
115 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
116 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
117 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
118 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
119 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
120 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
121 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
122 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
123 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
124 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
125 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
126 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
127 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
128 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
129 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
130 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
131 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
132 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
133 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
134 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
135 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
136 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
137 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
138 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
139 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
140 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
141 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
142 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
143 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
144 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
145 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
146 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
147 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
148 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
151 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
152 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
153 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
155 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
156 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
157 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
159 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
161 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
162 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
163 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
165 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
216 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
220 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
221 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
222 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
223 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
224 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
225 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
226 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
227 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
228 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
229 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
230 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
231 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
232 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
233 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
234 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
235 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
236 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
237 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
238 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
239 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
240 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
241 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
242 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
243 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
244 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
245 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
246 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
247 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
248 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
249 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
250 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
251 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
252 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
253 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
254 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
255 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
256 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
257 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
258 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
259 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
260 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
261 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
262 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
263 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
264 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
265 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
266 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
267 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
268 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
269 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
270 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
271 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
272 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
273 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
274 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
275 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
276 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
277 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
278 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
279 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
280 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
281 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
282 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
283 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
284 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
285 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
286 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
287 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
288 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
289 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
290 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
291 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
292 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
293 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
294 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
295 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
296 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
297 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
298 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
299 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
300 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
301 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
302 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
303 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
304 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
305 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
306 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
307 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
308 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
309 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
310 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
311 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
312 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
313 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
314 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
315 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
316 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
317 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
318 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
319 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
320 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
321 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
322 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
323 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
324 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
325 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
326 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
327 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
328 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
329 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
330 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
331 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
332 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
333 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
334 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
335 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
336 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
337 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
338 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
339 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
340 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
341 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
342 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
343 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
344 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
345 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
346 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
347 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.8
Metatranscriptomes 0.15
Isolates 6.06

Biome Distribution

Category Percentage (%)
Aerial Root 0.74
Bulb 0
Endosphere 12.26
Nodule 0
Rhizoplane 5.32
Rhizosphere 71.05
Stem 0
Stem Tuber 0
Unclassified 10.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1002799 3300001904 Bacteria 3055
2 JGI24741J21665_1002154 3300001915 Bacteria 5239
3 JGI24740J21852_10006563 3300001979 Bacteria 4804
4 JGI24740J21852_10010664 3300001979 Bacteria 3527
5 JGI24739J22299_10011254 3300001989 Bacteria 3305
6 JGI24739J22299_10012243 3300001989 Bacteria 3150
7 JGI24737J22298_10004687 3300001990 Bacteria 4757
8 JGI24737J22298_10007492 3300001990 Bacteria 3682
9 JGI24738J21930_10000692 3300002075 Bacteria 9709
10 JGI24034J26672_10000853 3300002239 Bacteria 3961
11 JGI25150J39212_1000195 3300002774 Bacteria 33776
12 JGI25165J46597_1000036 3300003214 Bacteria 286380
13 JGI25165J46597_1000094 3300003214 Bacteria 164674
14 JGI25153J46596_10000208 3300003215 Bacteria 53467
15 JGI25153J46596_10013772 3300003215 Bacteria 3400
16 rootL2_10169340 3300003322 Bacteria 5103
17 Ga0055525_1000037 3300003759 Bacteria 297990
18 Ga0055542_1000286 3300003762 Bacteria 56470
19 Ga0055529_1000207 3300003763 Bacteria 78124
20 Ga0055536_1000512 3300003781 Bacteria 26760
21 Ga0055536_1002435 3300003781 Bacteria 10457
22 Ga0055530_10000640 3300003791 Bacteria 30110
23 Ga0055540_1001676 3300003792 Bacteria 12815
24 Ga0055531_10000771 3300003794 Bacteria 26726
25 Ga0055531_10003434 3300003794 Bacteria 10107
26 Ga0065165_1002251 3300005262 Bacteria 17089
27 Ga0065165_1002736 3300005262 Bacteria 14081
28 Ga0065704_10000479 3300005289 Bacteria 19901
29 Ga0065707_10082051 3300005295 Bacteria 23464
30 Ga0070658_10000037 3300005327 Bacteria 141493
31 Ga0070658_10007123 3300005327 Bacteria 9026
32 Ga0070658_10013616 3300005327 Bacteria 6525
33 Ga0070658_10035423 3300005327 Bacteria 4020
34 Ga0070658_10040746 3300005327 Bacteria 3747
35 Ga0070670_100001616 3300005331 Bacteria 18214
36 Ga0070670_100006019 3300005331 Bacteria 10255
37 Ga0070670_100020117 3300005331 Bacteria 5734
38 Ga0070670_100034580 3300005331 Bacteria 4349
39 Ga0070670_100036835 3300005331 Bacteria 4208
40 Ga0070670_100046132 3300005331 Bacteria 3747
41 Ga0070677_10000384 3300005333 Bacteria 15496
42 Ga0070666_10003370 3300005335 Bacteria 9689
43 Ga0070666_10012793 3300005335 Bacteria 5304
44 Ga0070680_100010173 3300005336 Bacteria 7254
45 Ga0070682_100011170 3300005337 Bacteria 5124
46 Ga0068868_100000269 3300005338 Bacteria 35173
47 Ga0068868_100010680 3300005338 Bacteria 6654
48 Ga0070660_100000517 3300005339 Bacteria 25756
49 Ga0070660_100002339 3300005339 Bacteria 13020
50 Ga0070660_100003837 3300005339 Bacteria 10378
51 Ga0070660_100010005 3300005339 Bacteria 6687
52 Ga0070660_100011146 3300005339 Bacteria 6377
53 Ga0070660_100020181 3300005339 Bacteria 4893
54 Ga0070660_100024970 3300005339 Bacteria 4438
55 Ga0070660_100055360 3300005339 Bacteria 3065
56 Ga0070660_100057743 3300005339 Bacteria 3007
57 Ga0070661_100004811 3300005344 Bacteria 9295
58 Ga0070661_100006733 3300005344 Bacteria 7922
59 Ga0070661_100046650 3300005344 Bacteria 3170
60 Ga0070692_10000336 3300005345 Bacteria 13607
61 Ga0070692_10002274 3300005345 Bacteria 7377
62 Ga0070668_100000426 3300005347 Bacteria 27786
63 Ga0070668_100010941 3300005347 Bacteria 6750
64 Ga0070668_100028146 3300005347 Bacteria 4267
65 Ga0070669_100000160 3300005353 Bacteria 60712
66 Ga0070669_100017384 3300005353 Bacteria 5130
67 Ga0070675_100032470 3300005354 Bacteria 4226
68 Ga0070671_100004621 3300005355 Bacteria 10917
69 Ga0070671_100010596 3300005355 Bacteria 7401
70 Ga0070671_100038781 3300005355 Bacteria 3954
71 Ga0070674_100001269 3300005356 Bacteria 13284
72 Ga0070674_100002821 3300005356 Bacteria 9609
73 Ga0070674_100004870 3300005356 Bacteria 7695
74 Ga0070673_100008675 3300005364 Bacteria 6775
75 Ga0070673_100025134 3300005364 Bacteria 4378
76 Ga0070659_100000025 3300005366 Bacteria 144955
77 Ga0070659_100007854 3300005366 Bacteria 7768
78 Ga0070659_100010876 3300005366 Bacteria 6710
79 Ga0070667_100010417 3300005367 Bacteria 7674
80 Ga0070667_100014231 3300005367 Bacteria 6572
81 Ga0070667_100019910 3300005367 Bacteria 5568
82 Ga0070667_100024786 3300005367 Bacteria 4984
83 Ga0070667_100029798 3300005367 Bacteria 4550
84 Ga0070714_100038998 3300005435 Bacteria 3998
85 Ga0070705_100004988 3300005440 Bacteria 6466
86 Ga0070694_100001237 3300005444 Bacteria 14786
87 Ga0070678_100000152 3300005456 Bacteria 28847
88 Ga0070678_100014896 3300005456 Bacteria 4922
89 Ga0070662_100000794 3300005457 Bacteria 19386
90 Ga0070662_100004016 3300005457 Bacteria 9228
91 Ga0070662_100004268 3300005457 Bacteria 9017
92 Ga0070662_100008146 3300005457 Bacteria 6828
93 Ga0070662_100035798 3300005457 Bacteria 3508
94 Ga0070681_10011466 3300005458 Bacteria 8775
95 Ga0068867_100013928 3300005459 Bacteria 5692
96 Ga0070685_10001187 3300005466 Bacteria 13922
97 Ga0070679_100011514 3300005530 Bacteria 8432
98 Ga0068853_100046429 3300005539 Bacteria 3724
99 Ga0070672_100002560 3300005543 Bacteria 11596
100 Ga0070672_100003962 3300005543 Bacteria 9657
101 Ga0070672_100015151 3300005543 Bacteria 5481
102 Ga0070672_100030997 3300005543 Bacteria 4022
103 Ga0070693_100011018 3300005547 Bacteria 4545
104 Ga0070665_100000444 3300005548 Bacteria 60379
105 Ga0070665_100000924 3300005548 Bacteria 37601
106 Ga0070665_100001375 3300005548 Bacteria 28649
107 Ga0068855_100016050 3300005563 Bacteria 9009
108 Ga0068855_100082566 3300005563 Bacteria 3724
109 Ga0070664_100000675 3300005564 Bacteria 26078
110 Ga0070664_100013905 3300005564 Bacteria 6561
111 Ga0070664_100067024 3300005564 Bacteria 3067
112 Ga0068857_100011184 3300005577 Bacteria 7805
113 Ga0068857_100013092 3300005577 Bacteria 7228
114 Ga0068857_100055120 3300005577 Bacteria 3528
115 Ga0068857_100055649 3300005577 Bacteria 3510
116 Ga0068854_100015038 3300005578 Bacteria 5116
117 Ga0068854_100027206 3300005578 Bacteria 3939
118 Ga0068856_100013973 3300005614 Bacteria 7764
119 Ga0068856_100014424 3300005614 Bacteria 7635
120 Ga0068856_100067422 3300005614 Bacteria 3536
121 Ga0070702_100000880 3300005615 Bacteria 11673
122 Ga0068852_100049090 3300005616 Bacteria 3609
123 Ga0068852_100056353 3300005616 Bacteria 3396
124 Ga0068859_100023222 3300005617 Bacteria 6223
125 Ga0068859_100032226 3300005617 Bacteria 5264
126 Ga0068864_100001220 3300005618 Bacteria 21354
127 Ga0068864_100006953 3300005618 Bacteria 9280
128 Ga0068864_100046691 3300005618 Bacteria 3717
129 Ga0068864_100065816 3300005618 Bacteria 3144
130 Ga0068866_10009864 3300005718 Bacteria 4073
131 Ga0068861_100010626 3300005719 Bacteria 6391
132 Ga0068861_100021361 3300005719 Bacteria 4652
133 Ga0068851_10008698 3300005834 Bacteria 4702
134 Ga0068851_10014299 3300005834 Bacteria 3767
135 Ga0068863_100001606 3300005841 Bacteria 22340
136 Ga0068863_100003094 3300005841 Bacteria 16438
137 Ga0068863_100007922 3300005841 Bacteria 10386
138 Ga0068863_100020341 3300005841 Bacteria 6346
139 Ga0068863_100041114 3300005841 Bacteria 4395
140 Ga0068863_100060635 3300005841 Bacteria 3577
141 Ga0068858_100000079 3300005842 Bacteria 100753
142 Ga0068858_100001226 3300005842 Bacteria 26511
143 Ga0068858_100001536 3300005842 Bacteria 23689
144 Ga0068858_100013557 3300005842 Bacteria 7691
145 Ga0068860_100002090 3300005843 Bacteria 21029
146 Ga0068860_100004969 3300005843 Bacteria 13552
147 Ga0068860_100032161 3300005843 Bacteria 5043
148 Ga0068862_100016228 3300005844 Bacteria 6197
149 Ga0068862_100032419 3300005844 Bacteria 4415
150 Ga0068862_100034412 3300005844 Bacteria 4286
151 Ga0081455_10004270 3300005937 Bacteria 16097
152 Ga0081539_10000058 3300005985 Bacteria 256212
153 Ga0075368_10000008 3300006042 Bacteria 49008
154 Ga0075366_10004006 3300006195 Bacteria 7873
155 Ga0097621_100000498 3300006237 Bacteria 27559
156 Ga0097621_100036492 3300006237 Bacteria 3933
157 Ga0075370_10021303 3300006353 Bacteria 3552
158 Ga0075370_10024430 3300006353 Bacteria 3338
159 Ga0068871_100000406 3300006358 Bacteria 29738
160 Ga0075433_10046828 3300006852 Bacteria 3761
161 Ga0075434_100038812 3300006871 Bacteria 4718
162 Ga0068865_100011844 3300006881 Bacteria 5470
163 Ga0068865_100060355 3300006881 Unclassified 2655
164 Ga0097620_100023225 3300006931 Bacteria 6223
165 Ga0097620_100032226 3300006931 Bacteria 5264
166 Ga0105251_10006302 3300009011 Bacteria 7590
167 Ga0105240_10006078 3300009093 Bacteria 17832
168 Ga0105240_10045363 3300009093 Bacteria 5577
169 Ga0111539_10080121 3300009094 Bacteria 3841
170 Ga0105245_10014978 3300009098 Bacteria 6755
171 Ga0105243_10000278 3300009148 Bacteria 57245
172 Ga0105241_10023208 3300009174 Bacteria 4599
173 Ga0105241_10024226 3300009174 Bacteria 4507
174 Ga0105242_10013827 3300009176 Bacteria 6247
175 Ga0105248_10002150 3300009177 Bacteria 21793
176 Ga0105248_10008338 3300009177 Bacteria 11388
177 Ga0105248_10021987 3300009177 Bacteria 7068
178 Ga0105248_10027068 3300009177 Bacteria 6379
179 Ga0105248_10070297 3300009177 Bacteria 3931
180 Ga0105238_10026317 3300009551 Bacteria 5929
181 Ga0105238_10033510 3300009551 Bacteria 5227
182 Ga0105238_10042358 3300009551 Bacteria 4611
183 Ga0105238_10047069 3300009551 Bacteria 4350
184 Ga0105249_10001260 3300009553 Bacteria 22219
185 Ga0105249_10048566 3300009553 Bacteria 3869
186 Ga0105239_10000025 3300010375 Bacteria 254049
187 Ga0105239_10016097 3300010375 Bacteria 8273
188 Ga0105239_10094196 3300010375 Bacteria 3307
189 Ga0105239_10122728 3300010375 Bacteria 2886
190 Ga0105246_10000491 3300011119 Bacteria 21441
191 Ga0105246_10022644 3300011119 Bacteria 4056
192 Ga0157373_10012355 3300013100 Bacteria 6278
193 Ga0157373_10031816 3300013100 Bacteria 3798
194 Ga0157371_10000285 3300013102 Bacteria 68525
195 Ga0157371_10019625 3300013102 Bacteria 4980
196 Ga0157371_10035051 3300013102 Bacteria 3598
197 Ga0157370_10008766 3300013104 Bacteria 10871
198 Ga0157370_10013844 3300013104 Bacteria 8284
199 Ga0157370_10016460 3300013104 Bacteria 7485
200 Ga0157369_10027670 3300013105 Bacteria 6282
201 Ga0157369_10083649 3300013105 Bacteria 3412
202 Ga0157374_10001212 3300013296 Bacteria 22054
203 Ga0157374_10015708 3300013296 Bacteria 6647
204 Ga0157378_10032569 3300013297 Bacteria 4606
205 Ga0157378_10064221 3300013297 Bacteria 3283
206 Ga0163162_10003408 3300013306 Bacteria 15175
207 Ga0163162_10006458 3300013306 Bacteria 11358
208 Ga0163162_10009765 3300013306 Bacteria 9344
209 Ga0163162_10096226 3300013306 Bacteria 3049
210 Ga0157372_10025212 3300013307 Bacteria 6463
211 Ga0157372_10087211 3300013307 Bacteria 3540
212 Ga0157372_10089604 3300013307 Bacteria 3495
213 Ga0157375_10040091 3300013308 Bacteria 4513
214 Ga0157375_10046829 3300013308 Bacteria 4219
215 Ga0163163_10000015 3300014325 Bacteria 214881
216 Ga0163163_10002967 3300014325 Bacteria 14354
217 Ga0157380_10002463 3300014326 Bacteria 12468
218 Ga0182008_10015332 3300014497 Bacteria 4000
219 Ga0157379_10000931 3300014968 Bacteria 23657
220 Ga0157379_10011601 3300014968 Bacteria 7696
221 Ga0157379_10035693 3300014968 Bacteria 4433
222 Ga0157376_10009371 3300014969 Bacteria 7110
223 Ga0183363_1004 3300015690 Bacteria 416766
224 Ga0213876_10000524 3300021384 Bacteria 29280
225 Ga0213876_10008661 3300021384 Bacteria 5504
226 Ga0209147_101474 3300025229 Bacteria 8427
227 Ga0209563_100105 3300025230 Bacteria 147936
228 Ga0207427_100561 3300025231 Bacteria 18798
229 Ga0207425_1000025 3300025245 Bacteria 321872
230 Ga0209026_1000689 3300025250 Bacteria 20330
231 Ga0209026_1001031 3300025250 Bacteria 13697
232 Ga0209148_1000011 3300025254 Bacteria 1196503
233 Ga0209148_1001558 3300025254 Bacteria 11072
234 Ga0209129_1001489 3300025258 Bacteria 13016
235 Ga0209233_1000003 3300025261 Bacteria 1607366
236 Ga0209233_1000015 3300025261 Bacteria 980563
237 Ga0209565_1000209 3300025263 Bacteria 68237
238 Ga0209455_1000006 3300025272 Bacteria 1196503
239 Ga0209675_1001006 3300025291 Bacteria 17716
240 Ga0209676_1000529 3300025292 Bacteria 59605
241 Ga0209676_1000557 3300025292 Bacteria 56440
242 Ga0209676_1013843 3300025292 Bacteria 3075
243 Ga0209025_1000630 3300025294 Bacteria 62487
244 Ga0209564_1002704 3300025295 Bacteria 13387
245 Ga0209564_1011181 3300025295 Bacteria 4046
246 Ga0209758_1000002 3300025297 Bacteria 1400310
247 Ga0209758_1000108 3300025297 Bacteria 216541
248 Ga0209758_1000404 3300025297 Bacteria 74016
249 Ga0209758_1001130 3300025297 Bacteria 34283
250 Ga0209050_1000001 3300025298 Bacteria 3563507
251 Ga0209050_1001311 3300025298 Bacteria 27926
252 Ga0209256_1002432 3300025299 Bacteria 15222
253 Ga0209051_1000699 3300025303 Bacteria 36947
254 Ga0209257_1000227 3300025304 Bacteria 133512
255 Ga0209257_1000247 3300025304 Bacteria 125419
256 Ga0209257_1000304 3300025304 Bacteria 107843
257 Ga0209257_1000507 3300025304 Bacteria 68362
258 Ga0207656_10006855 3300025321 Bacteria 4124
259 Ga0207696_1001333 3300025711 Bacteria 13623
260 Ga0207713_1017913 3300025735 Bacteria 3527
261 Ga0207713_1018000 3300025735 Bacteria 3515
262 Ga0207682_10000704 3300025893 Bacteria 15500
263 Ga0207642_10006404 3300025899 Bacteria 3909
264 Ga0207688_10033212 3300025901 Bacteria 2853
265 Ga0207647_10000509 3300025904 Bacteria 31126
266 Ga0207647_10001088 3300025904 Bacteria 20924
267 Ga0207647_10005921 3300025904 Bacteria 8915
268 Ga0207647_10008471 3300025904 Bacteria 7370
269 Ga0207647_10013021 3300025904 Bacteria 5778
270 Ga0207705_10000008 3300025909 Bacteria 589717
271 Ga0207705_10001452 3300025909 Bacteria 18915
272 Ga0207705_10008793 3300025909 Bacteria 7362
273 Ga0207705_10022197 3300025909 Bacteria 4527
274 Ga0207654_10001371 3300025911 Bacteria 12922
275 Ga0207654_10007963 3300025911 Bacteria 5342
276 Ga0207707_10036076 3300025912 Bacteria 4323
277 Ga0207695_10007272 3300025913 Bacteria 14140
278 Ga0207671_10006263 3300025914 Bacteria 10656
279 Ga0207660_10002722 3300025917 Bacteria 11583
280 Ga0207657_10000977 3300025919 Bacteria 30349
281 Ga0207657_10001399 3300025919 Bacteria 25709
282 Ga0207657_10001882 3300025919 Bacteria 22683
283 Ga0207657_10003194 3300025919 Bacteria 17533
284 Ga0207657_10017033 3300025919 Bacteria 6990
285 Ga0207657_10059277 3300025919 Bacteria 3290
286 Ga0207657_10060508 3300025919 Bacteria 3250
287 Ga0207649_10022182 3300025920 Bacteria 3667
288 Ga0207652_10005493 3300025921 Bacteria 10282
289 Ga0207681_10000128 3300025923 Bacteria 61747
290 Ga0207694_10005329 3300025924 Bacteria 9909
291 Ga0207694_10016934 3300025924 Bacteria 5506
292 Ga0207694_10030342 3300025924 Bacteria 4129
293 Ga0207694_10035303 3300025924 Bacteria 3836
294 Ga0207694_10047086 3300025924 Bacteria 3335
295 Ga0207650_10002895 3300025925 Bacteria 11846
296 Ga0207650_10004342 3300025925 Bacteria 9684
297 Ga0207650_10009402 3300025925 Bacteria 6682
298 Ga0207650_10029865 3300025925 Bacteria 3922
299 Ga0207650_10030395 3300025925 Bacteria 3891
300 Ga0207650_10055407 3300025925 Bacteria 2943
301 Ga0207659_10024563 3300025926 Bacteria 4040
302 Ga0207664_10045238 3300025929 Bacteria 3451
303 Ga0207644_10000230 3300025931 Bacteria 38307
304 Ga0207644_10003103 3300025931 Bacteria 10697
305 Ga0207644_10010126 3300025931 Bacteria 6211
306 Ga0207690_10000005 3300025932 Bacteria 581199
307 Ga0207690_10001059 3300025932 Bacteria 17615
308 Ga0207690_10004578 3300025932 Bacteria 8170
309 Ga0207690_10010182 3300025932 Bacteria 5585
310 Ga0207690_10013749 3300025932 Bacteria 4872
311 Ga0207706_10002787 3300025933 Bacteria 16978
312 Ga0207706_10005207 3300025933 Bacteria 12136
313 Ga0207706_10017644 3300025933 Bacteria 6431
314 Ga0207706_10024036 3300025933 Bacteria 5468
315 Ga0207706_10036198 3300025933 Bacteria 4385
316 Ga0207706_10038867 3300025933 Bacteria 4221
317 Ga0207706_10057359 3300025933 Bacteria 3431
318 Ga0207709_10000039 3300025935 Bacteria 260127
319 Ga0207669_10000171 3300025937 Bacteria 30352
320 Ga0207669_10001692 3300025937 Bacteria 9377
321 Ga0207704_10012465 3300025938 Bacteria 4219
322 Ga0207691_10000916 3300025940 Bacteria 29221
323 Ga0207691_10001114 3300025940 Bacteria 26751
324 Ga0207691_10002685 3300025940 Bacteria 17397
325 Ga0207691_10020611 3300025940 Bacteria 6233
326 Ga0207691_10048964 3300025940 Bacteria 3872
327 Ga0207711_10001043 3300025941 Bacteria 26500
328 Ga0207711_10001704 3300025941 Bacteria 20237
329 Ga0207711_10002307 3300025941 Bacteria 17103
330 Ga0207711_10004471 3300025941 Bacteria 11919
331 Ga0207711_10030462 3300025941 Bacteria 4551
332 Ga0207679_10001524 3300025945 Bacteria 14478
333 Ga0207679_10007251 3300025945 Bacteria 7028
334 Ga0207679_10010931 3300025945 Bacteria 5857
335 Ga0207667_10008955 3300025949 Bacteria 11838
336 Ga0207667_10072956 3300025949 Bacteria 3567
337 Ga0207651_10003423 3300025960 Bacteria 7792
338 Ga0207712_10000280 3300025961 Bacteria 48628
339 Ga0207668_10001009 3300025972 Bacteria 16846
340 Ga0207668_10011558 3300025972 Bacteria 5370
341 Ga0207668_10039494 3300025972 Bacteria 3177
342 Ga0207640_10010081 3300025981 Bacteria 5310
343 Ga0207640_10030917 3300025981 Bacteria 3303
344 Ga0207658_10000913 3300025986 Bacteria 24495
345 Ga0207658_10003201 3300025986 Bacteria 11651
346 Ga0207658_10005473 3300025986 Bacteria 8704
347 Ga0207658_10010628 3300025986 Bacteria 6256
348 Ga0207658_10016029 3300025986 Bacteria 5147
349 Ga0207677_10000059 3300026023 Bacteria 94553
350 Ga0207677_10009419 3300026023 Bacteria 5498
351 Ga0207703_10000051 3300026035 Bacteria 145390
352 Ga0207703_10001249 3300026035 Bacteria 23830
353 Ga0207703_10001844 3300026035 Bacteria 18887
354 Ga0207703_10008783 3300026035 Bacteria 7967
355 Ga0207639_10029517 3300026041 Bacteria 4016
356 Ga0207639_10035340 3300026041 Bacteria 3697
357 Ga0207678_10008848 3300026067 Bacteria 8864
358 Ga0207678_10027006 3300026067 Bacteria 5006
359 Ga0207678_10050579 3300026067 Bacteria 3590
360 Ga0207702_10004206 3300026078 Bacteria 12864
361 Ga0207702_10008323 3300026078 Bacteria 8759
362 Ga0207702_10010790 3300026078 Bacteria 7623
363 Ga0207702_10028453 3300026078 Bacteria 4645
364 Ga0207641_10012940 3300026088 Bacteria 6845
365 Ga0207641_10018178 3300026088 Bacteria 5762
366 Ga0207641_10028697 3300026088 Bacteria 4599
367 Ga0207648_10003577 3300026089 Bacteria 16261
368 Ga0207676_10001732 3300026095 Bacteria 16057
369 Ga0207676_10026812 3300026095 Bacteria 4286
370 Ga0207674_10000060 3300026116 Bacteria 112806
371 Ga0207674_10000065 3300026116 Bacteria 109485
372 Ga0207674_10010652 3300026116 Bacteria 10396
373 Ga0207674_10062676 3300026116 Bacteria 3755
374 Ga0207675_100029761 3300026118 Bacteria 5085
375 Ga0207683_10000888 3300026121 Bacteria 27470
376 Ga0207683_10000976 3300026121 Bacteria 26222
377 Ga0207683_10003935 3300026121 Bacteria 12886
378 Ga0207683_10004155 3300026121 Bacteria 12535
379 Ga0207698_10019761 3300026142 Bacteria 4619
380 Ga0207698_10021037 3300026142 Bacteria 4505
381 Ga0209813_10000045 3300027866 Bacteria 50254
382 Ga0268266_10000131 3300028379 Bacteria 146628
383 Ga0268266_10002172 3300028379 Bacteria 21495
384 Ga0268266_10008928 3300028379 Bacteria 8869
385 Ga0268266_10036760 3300028379 Bacteria 4171
386 Ga0268265_10001693 3300028380 Bacteria 17947
387 Ga0268265_10019969 3300028380 Bacteria 4667
388 Ga0268265_10034677 3300028380 Bacteria 3680
389 Ga0268264_10000750 3300028381 Bacteria 36591
390 Ga0268264_10012656 3300028381 Bacteria 6946
391 Ga0268264_10014440 3300028381 Bacteria 6490
392 Ga0268264_10021323 3300028381 Bacteria 5290
393 Ga0268264_10052488 3300028381 Bacteria 3399
394 Ga0307517_10024840 3300028786 Bacteria 7359
395 Ga0307513_10010218 3300031456 Bacteria 11790
396 Ga0307513_10011868 3300031456 Bacteria 10793
397 Ga0307513_10015230 3300031456 Bacteria 9333
398 Ga0307513_10023295 3300031456 Bacteria 7238
399 Ga0307509_10068302 3300031507 Bacteria 3720
400 Ga0307508_10003117 3300031616 Bacteria 16994
401 Ga0307516_10022995 3300031730 Bacteria 6396
402 Ga0307405_10008340 3300031731 Bacteria 5244
403 Ga0307405_10013608 3300031731 Bacteria 4344
404 Ga0307413_10025457 3300031824 Bacteria 3244
405 Ga0307406_10038360 3300031901 Bacteria 2965
406 Ga0307412_10030904 3300031911 Bacteria 3377
407 Ga0307409_100004387 3300031995 Bacteria 7919
408 Ga0307409_100038932 3300031995 Bacteria 3522
409 Ga0307414_10037134 3300032004 Bacteria 3259
410 Ga0307414_10048537 3300032004 Bacteria 2929
411 Ga0307411_10010227 3300032005 Bacteria 4988
412 Ga0307415_100006075 3300032126 Bacteria 6474
413 Ga0307415_100018196 3300032126 Bacteria 4237
414 Ga0307510_10005453 3300033180 Bacteria 15153
415 Ga0373931_0007833 3300035691 Bacteria 5049
416 Ga0395899_0000981 3300037312 Bacteria 26323
417 Ga0395899_0021088 3300037312 Bacteria 4941
418 Ga0395899_0051287 3300037312 Bacteria 3062
419 Ga0395900_0032222 3300037418 Bacteria 5388
420 Ga0395900_0039052 3300037418 Bacteria 4892
421 Ga0395900_0043982 3300037418 Bacteria 4603
422 Ga0395900_0047347 3300037418 Bacteria 4427
423 Ga0395900_0117886 3300037418 Bacteria 2724
424 Ga0395898_0019094 3300037466 Bacteria 6978
425 Ga0395898_0044063 3300037466 Bacteria 4394
426 Ga0395898_0057012 3300037466 Bacteria 3806
427 Ga0395898_0090031 3300037466 Bacteria 2953
428 Ga0395905_0000533 3300037471 Bacteria 52133
429 Ga0395905_0009369 3300037471 Bacteria 9576
430 Ga0395905_0025177 3300037471 Bacteria 5612
431 Ga0395905_0034176 3300037471 Bacteria 4773
432 Ga0395905_0035144 3300037471 Bacteria 4705
433 Ga0395905_0044281 3300037471 Bacteria 4176
434 Ga0395905_0046337 3300037471 Bacteria 4077
435 Ga0395901_0011606 3300038443 Bacteria 8926
436 Ga0395901_0018571 3300038443 Bacteria 7101
437 Ga0395901_0018841 3300038443 Bacteria 7055
438 Ga0395901_0028227 3300038443 Bacteria 5772
439 Ga0395901_0076311 3300038443 Bacteria 3496
440 Ga0436365_0712054 3300039437 Bacteria 12827
441 Ga0436365_1754682 3300039437 Bacteria 25742
442 Ga0439465_0001605 3300041413 Bacteria 7355
443 Ga0451807_0362855 3300041486 Bacteria 7260
444 Ga0439445_0004692 3300042004 Bacteria 3099
445 Ga0439448_0010905 3300042005 Bacteria 2702
446 Ga0439455_0000040 3300042012 Bacteria 11220
447 Ga0439458_0000036 3300042157 Bacteria 21009
448 Ga0466960_0009985 3300044901 Bacteria 3930
449 Ga0466959_0028756 3300045049 Bacteria 4119
450 Ga0466967_0036333 3300045976 Bacteria 4204
451 Ga0495627_001098 3300046453 Bacteria 17664
452 Ga0495638_0003589 3300046460 Bacteria 12149
453 Ga0495638_0013710 3300046460 Bacteria 5507
454 Ga0495650_0000024 3300046471 Bacteria 496674
455 Ga0495650_0000290 3300046471 Bacteria 93004
456 Ga0495650_0008893 3300046471 Bacteria 5787
457 Ga0495584_0016999 3300046491 Bacteria 3707
458 Ga0495585_0002673 3300046492 Bacteria 12490
459 Ga0495596_0000135 3300046500 Bacteria 50784
460 Ga0495596_0001630 3300046500 Bacteria 12748
461 Ga0495596_0001690 3300046500 Bacteria 12483
462 Ga0495607_0008063 3300046501 Bacteria 7231
463 Ga0495607_0010945 3300046501 Bacteria 6067
464 Ga0495583_0000373 3300046506 Bacteria 69685
465 Ga0495583_0001065 3300046506 Bacteria 30658
466 Ga0495583_0007137 3300046506 Bacteria 7114
467 Ga0495606_0001200 3300046507 Bacteria 36440
468 Ga0495610_0000061 3300046512 Bacteria 130986
469 Ga0495610_0000095 3300046512 Bacteria 104629
470 Ga0495610_0000107 3300046512 Bacteria 97076
471 Ga0495610_0000154 3300046512 Bacteria 76596
472 Ga0495610_0003085 3300046512 Bacteria 13304
473 Ga0495616_0000099 3300046513 Bacteria 73607
474 Ga0495620_0022603 3300046515 Bacteria 3025
475 Ga0495632_0000925 3300046519 Bacteria 25723
476 Ga0495637_0017962 3300046520 Bacteria 3286
477 Ga0495643_0000321 3300046522 Bacteria 65956
478 Ga0495643_0002608 3300046522 Bacteria 14038
479 Ga0495643_0018139 3300046522 Bacteria 4098
480 Ga0495648_0000189 3300046524 Bacteria 70824
481 Ga0495648_0016022 3300046524 Bacteria 5414
482 Ga0495663_0002958 3300046525 Bacteria 4997
483 Ga0495654_0000153 3300046530 Bacteria 70297
484 Ga0495609_0007491 3300046538 Bacteria 5443
485 Ga0495621_0000694 3300046539 Bacteria 8497
486 Ga0495622_0010263 3300046557 Bacteria 4331
487 Ga0495633_0000178 3300046558 Bacteria 82451
488 Ga0495668_0000181 3300046616 Bacteria 94147
489 Ga0495668_0024450 3300046616 Bacteria 3435
490 Ga0495625_0000107 3300046660 Bacteria 125777
491 Ga0495625_0000915 3300046660 Bacteria 39689
492 Ga0495625_0006851 3300046660 Bacteria 10063
493 Ga0495625_0011108 3300046660 Bacteria 7374
494 Ga0495625_0016101 3300046660 Bacteria 5892
495 Ga0495625_0027441 3300046660 Bacteria 4287
496 Ga0495625_0034633 3300046660 Bacteria 3725
497 Ga0495625_0045175 3300046660 Bacteria 3186
498 Ga0495669_0000848 3300046684 Bacteria 12962
499 Ga0495669_0000967 3300046684 Bacteria 11988
500 Ga0495670_0000029 3300046691 Bacteria 87662
501 Ga0495671_0000125 3300046692 Bacteria 70115
502 Ga0495649_0000351 3300046694 Bacteria 39624
503 Ga0495649_0032293 3300046694 Bacteria 2884
504 Ga0495660_0004837 3300046810 Bacteria 8124
505 Ga0495672_0000723 3300047320 Bacteria 36353
506 Ga0495683_0001719 3300047323 Bacteria 13885
507 Ga0495683_0012193 3300047323 Bacteria 4518
508 Ga0495687_000109 3300047443 Bacteria 125648
509 Ga0495677_0008252 3300047445 Bacteria 3872
510 Ga0495673_0000275 3300047469 Bacteria 70004
511 Ga0495673_0009550 3300047469 Bacteria 5365
512 Ga0495673_0011333 3300047469 Bacteria 4802
513 Ga0495681_0000008 3300047470 Bacteria 215295
514 Ga0495681_0001474 3300047470 Bacteria 17572
515 Ga0495626_0001489 3300048091 Bacteria 18486
516 Ga0496100_0005031 3300048903 Bacteria 7072
517 Ga0496101_0004862 3300048904 Bacteria 8523
518 Ga0496101_0006283 3300048904 Bacteria 7648
519 Ga0496102_0000126 3300048905 Bacteria 105053
520 Ga0496102_0001684 3300048905 Bacteria 19404
521 Ga0496102_0003478 3300048905 Bacteria 13353
522 Ga0496103_0000049 3300048906 Bacteria 154466
523 Ga0496103_0000089 3300048906 Bacteria 104353
524 Ga0496103_0005344 3300048906 Bacteria 7698
525 Ga0496104_0000073 3300048907 Bacteria 104347
526 Ga0496105_0000040 3300048908 Bacteria 117075
527 Ga0496105_0000574 3300048908 Bacteria 24332
528 Ga0496105_0017831 3300048908 Bacteria 5696
529 Ga0496107_0004508 3300048910 Bacteria 9447
530 Ga0496107_0004786 3300048910 Bacteria 9199
531 Ga0496109_0007457 3300048912 Bacteria 9261
532 Ga0496109_0014172 3300048912 Bacteria 6932
533 Ga0496109_0022671 3300048912 Bacteria 5561
534 Ga0496110_0010873 3300048913 Bacteria 7419
535 Ga0496110_0050825 3300048913 Bacteria 3641
536 Ga0496111_0003066 3300048914 Bacteria 10261
537 Ga0496111_0003869 3300048914 Bacteria 9361
538 Ga0496111_0007347 3300048914 Bacteria 7211
539 Ga0496112_0002520 3300048915 Bacteria 14785
540 Ga0496112_0042785 3300048915 Bacteria 4432
541 Ga0496113_0001156 3300048916 Bacteria 14381
542 Ga0496113_0006171 3300048916 Bacteria 7565
543 Ga0496113_0007161 3300048916 Bacteria 7146
544 Ga0496113_0018925 3300048916 Bacteria 4807
545 Ga0496113_0052846 3300048916 Bacteria 3036
546 Ga0496114_0013429 3300048917 Bacteria 6566
547 Ga0496115_0000147 3300048918 Bacteria 64872
548 Ga0496115_0000991 3300048918 Bacteria 20577
549 Ga0496115_0015850 3300048918 Bacteria 5725
550 Ga0496115_0023646 3300048918 Bacteria 4768
551 Ga0496116_0000108 3300048919 Bacteria 187993
552 Ga0496116_0011857 3300048919 Bacteria 7171
553 Ga0496117_0000123 3300048920 Bacteria 169805
554 Ga0496117_0000329 3300048920 Bacteria 83691
555 Ga0496118_0000164 3300048921 Bacteria 119381
556 Ga0496118_0000475 3300048921 Bacteria 66516
557 Ga0496118_0004909 3300048921 Bacteria 15540
558 Ga0496119_0000090 3300048922 Bacteria 134340
559 Ga0496119_0013840 3300048922 Bacteria 6375
560 Ga0496120_0000530 3300048923 Bacteria 58913
561 Ga0496120_0018023 3300048923 Bacteria 4562
562 Ga0496121_0000070 3300048924 Bacteria 249187
563 Ga0496121_0000232 3300048924 Bacteria 119519
564 Ga0496121_0000671 3300048924 Bacteria 63867
565 Ga0496121_0018903 3300048924 Bacteria 6916
566 Ga0496121_0059089 3300048924 Bacteria 3164
567 Ga0496122_0002698 3300048925 Bacteria 24684
568 Ga0496122_0011219 3300048925 Bacteria 9111
569 Ga0496123_0001559 3300048926 Bacteria 31386
570 Ga0496123_0001996 3300048926 Bacteria 26380
571 Ga0496123_0007174 3300048926 Bacteria 10573
572 Ga0496123_0036766 3300048926 Bacteria 3465
573 Ga0496123_0042471 3300048926 Bacteria 3137
574 Ga0496124_0000041 3300048927 Bacteria 303887
575 Ga0496124_0002464 3300048927 Bacteria 24193
576 Ga0496124_0002815 3300048927 Bacteria 22027
577 Ga0496125_0000639 3300048928 Bacteria 58529
578 Ga0496125_0008043 3300048928 Bacteria 11132
579 Ga0496125_0011263 3300048928 Bacteria 8963
580 Ga0496125_0078659 3300048928 Bacteria 2533
581 Ga0496126_0000045 3300048929 Bacteria 331225
582 Ga0496126_0000324 3300048929 Bacteria 101936
583 Ga0496126_0001878 3300048929 Bacteria 30558
584 Ga0496126_0002391 3300048929 Bacteria 25517
585 Ga0496126_0046548 3300048929 Bacteria 3977
586 Ga0501319_000171 3300049535 Bacteria 2601
587 Ga0501033_0039098 3300049570 Bacteria 3544
588 Ga0501068_0000454 3300049584 Bacteria 20768
589 Ga0501069_0009786 3300049585 Bacteria 5068
590 Ga0501070_0032046 3300049586 Bacteria 4400
591 Ga0501071_0001958 3300049587 Bacteria 12284
592 Ga0501072_0014476 3300049588 Bacteria 6045
593 Ga0501073_0000546 3300049589 Bacteria 26539
594 Ga0501074_0001739 3300049590 Bacteria 14886
595 Ga0501079_0003895 3300049741 Bacteria 11015
596 Ga0501080_0001294 3300049742 Bacteria 20808
597 Ga0501267_000246 3300049764 Bacteria 3898
598 nmdc:mga06z11_561_c1 3300050494 Bacteria 13600
599 nmdc:mga04h51_75_c1 3300050495 Bacteria 31884
600 nmdc:mga07m45_15451_c1 3300050496 Bacteria 3376
601 nmdc:mga08y16_66807_c1 3300050511 Bacteria 3752
602 nmdc:mga0a205_1958_c1 3300050515 Bacteria 17919
603 Ga0500643_001050 3300053087 Bacteria 16751
604 Ga0500643_001424 3300053087 Bacteria 13792
605 Ga0500643_010993 3300053087 Bacteria 3332
606 Ga0500644_0001000 3300053088 Bacteria 8751
607 Ga0500583_0001396 3300053092 Bacteria 6914
608 Ga0500651_0020740 3300053093 Bacteria 4092
609 Ga0500556_0000014 3300053104 Bacteria 232989
610 Ga0500556_0001644 3300053104 Bacteria 8735
611 Ga0500562_000233 3300053108 Bacteria 14584
612 Ga0500595_000943 3300053119 Bacteria 16406
613 Ga0500595_001445 3300053119 Bacteria 12674
614 Ga0500595_001579 3300053119 Bacteria 12024
615 Ga0500595_004311 3300053119 Bacteria 6407
616 Ga0500618_000369 3300053125 Bacteria 31202
617 Ga0500642_0000001 3300053130 Bacteria 1468402
618 Ga0500658_0002520 3300053134 Bacteria 7093
619 Ga0500568_0011025 3300053139 Bacteria 4209
620 Ga0500590_001811 3300053148 Bacteria 9044
621 Ga0500604_0000053 3300053151 Bacteria 41228
622 Ga0500616_0000193 3300053153 Bacteria 100119
623 Ga0500616_0000411 3300053153 Bacteria 57962
624 Ga0500622_0004577 3300053156 Bacteria 8615
625 Ga0500627_0010970 3300053158 Bacteria 3324
626 Ga0500570_000304 3300053724 Bacteria 17421
627 Ga0500645_000001 3300053730 Bacteria 455558
628 Ga0500645_000315 3300053730 Bacteria 34548
629 Ga0500645_005420 3300053730 Bacteria 4701
630 Ga0500609_000426 3300053731 Bacteria 6248
631 Ga0500596_000599 3300053735 Bacteria 6930
632 Ga0501084_0006006 3300054114 Bacteria 9986

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048914 Ga0496111_0007347 Ga0496111_0007347_11_2200 624
2 3300053119 Ga0500595_000943 Ga0500595_000943_7513_9846 681
3 3300048929 Ga0496126_0046548 Ga0496126_0046548_1666_3930 689
4 3300053092 Ga0500583_0001396 Ga0500583_0001396_995_3421 713
5 3300031456 Ga0307513_10023295 Ga0307513_100232952 714
6 3300053087 Ga0500643_001050 Ga0500643_001050_9289_11769 714
7 3300006237 Ga0097621_100036492 Ga0097621_1000364922 715
8 3300053104 Ga0500556_0001644 Ga0500556_0001644_2103_4559 717
9 3300053730 Ga0500645_005420 Ga0500645_005420_365_2821 717
10 3300025297 Ga0209758_1001130 Ga0209758_100113024 718
11 3300046460 Ga0495638_0003589 Ga0495638_0003589_9684_12101 718
12 3300046460 Ga0495638_0013710 Ga0495638_0013710_1914_4331 718
13 3300046513 Ga0495616_0000099 Ga0495616_0000099_55007_57424 718
14 3300046810 Ga0495660_0004837 Ga0495660_0004837_706_3123 718
15 3300053731 Ga0500609_000426 Ga0500609_000426_3265_5682 718
16 3300003781 Ga0055536_1000512 Ga0055536_100051218 719
17 3300003794 Ga0055531_10000771 Ga0055531_100007716 719
18 3300025292 Ga0209676_1000529 Ga0209676_100052918 719
19 3300025298 Ga0209050_1001311 Ga0209050_100131118 719
20 3300025304 Ga0209257_1000304 Ga0209257_100030448 719
21 3300047469 Ga0495673_0011333 Ga0495673_0011333_650_3067 719
22 3300046507 Ga0495606_0001200 Ga0495606_0001200_3495_5924 720
23 3300005331 Ga0070670_100020117 Ga0070670_1000201172 721
24 3300005347 Ga0070668_100010941 Ga0070668_1000109412 721
25 3300005367 Ga0070667_100024786 Ga0070667_1000247862 721
26 3300005618 Ga0068864_100065816 Ga0068864_1000658161 721
27 3300005719 Ga0068861_100021361 Ga0068861_1000213612 721
28 3300005841 Ga0068863_100041114 Ga0068863_1000411141 721
29 3300005843 Ga0068860_100002090 Ga0068860_10000209011 721
30 3300005844 Ga0068862_100032419 Ga0068862_1000324193 721
31 3300025972 Ga0207668_10011558 Ga0207668_100115583 721
32 3300025986 Ga0207658_10005473 Ga0207658_100054735 721
33 3300028380 Ga0268265_10034677 Ga0268265_100346772 721
34 3300028381 Ga0268264_10012656 Ga0268264_100126562 721
35 3300046616 Ga0495668_0024450 Ga0495668_0024450_60_2468 722
36 3300025250 Ga0209026_1000689 Ga0209026_100068911 723
37 3300005440 Ga0070705_100004988 Ga0070705_1000049883 724
38 3300005615 Ga0070702_100000880 Ga0070702_1000008803 724
39 3300005719 Ga0068861_100010626 Ga0068861_1000106264 724
40 3300006353 Ga0075370_10024430 Ga0075370_100244302 724
41 3300026118 Ga0207675_100029761 Ga0207675_1000297613 724
42 3300053156 Ga0500622_0004577 Ga0500622_0004577_1643_4075 724
43 3300031824 Ga0307413_10025457 Ga0307413_100254572 725
44 3300046471 Ga0495650_0000024 Ga0495650_0000024_22540_24969 725
45 3300005344 Ga0070661_100046650 Ga0070661_1000466501 726
46 3300013102 Ga0157371_10035051 Ga0157371_100350512 726
47 3300026067 Ga0207678_10008848 Ga0207678_100088487 726
48 3300005985 Ga0081539_10000058 Ga0081539_10000058152 728
49 3300049584 Ga0501068_0000454 Ga0501068_0000454_8042_10561 728
50 iso_pu_bacteria 2585428106 2587917148 728
51 iso_pu_bacteria 2643221640 2644223647 728
52 iso_pu_bacteria 2643221642 2644236265 728
53 iso_pu_bacteria 2928531327 2928531858 728
54 3300013104 Ga0157370_10008766 Ga0157370_100087663 729
55 3300031507 Ga0307509_10068302 Ga0307509_100683022 729
56 3300048925 Ga0496122_0011219 Ga0496122_0011219_3687_6197 729
57 3300048926 Ga0496123_0001996 Ga0496123_0001996_2759_5269 729
58 3300053153 Ga0500616_0000193 Ga0500616_0000193_94495_96936 729
59 iso_pu_bacteria 2582581293 2585194788 729
60 iso_pu_bacteria 2643221545 2643747416 729
61 iso_pu_bacteria 2643221583 2643922708 729
62 iso_pu_bacteria 2643221691 2644507386 729
63 iso_pu_bacteria 2818991435 2819538130 729
64 iso_pu_bacteria 2818991454 2819647300 729
65 3300005337 Ga0070682_100011170 Ga0070682_1000111704 730
66 3300046512 Ga0495610_0000154 Ga0495610_0000154_21508_23964 730
67 3300046522 Ga0495643_0018139 Ga0495643_0018139_1433_3889 730
68 3300047320 Ga0495672_0000723 Ga0495672_0000723_11056_13512 730
69 3300048918 Ga0496115_0015850 Ga0496115_0015850_1462_3918 730
70 3300053134 Ga0500658_0002520 Ga0500658_0002520_2080_4536 730
71 3300003322 rootL2_10169340 rootL2_101693402 731
72 3300006195 Ga0075366_10004006 Ga0075366_100040064 731
73 3300031456 Ga0307513_10015230 Ga0307513_100152308 731
74 iso_pu_bacteria 2849573788 2849577649 731
75 iso_pu_bacteria 2898329390 2898330456 731
76 3300003794 Ga0055531_10003434 Ga0055531_100034349 732
77 3300005262 Ga0065165_1002251 Ga0065165_10022515 732
78 3300025295 Ga0209564_1002704 Ga0209564_100270410 732
79 3300025299 Ga0209256_1002432 Ga0209256_10024329 732
80 3300025304 Ga0209257_1000247 Ga0209257_100024775 732
81 3300046530 Ga0495654_0000153 Ga0495654_0000153_41628_44057 732
82 3300048928 Ga0496125_0008043 Ga0496125_0008043_6670_9120 732
83 3300053119 Ga0500595_001445 Ga0500595_001445_5714_8389 732
84 3300053158 Ga0500627_0010970 Ga0500627_0010970_245_2674 732
85 iso_pu_bacteria 2643221598 2644001658 732
86 3300005548 Ga0070665_100000924 Ga0070665_10000092414 733
87 3300006881 Ga0068865_100060355 Ga0068865_1000603551 733
88 3300014325 Ga0163163_10000015 Ga0163163_10000015131 733
89 3300014326 Ga0157380_10002463 Ga0157380_100024634 733
90 3300014968 Ga0157379_10011601 Ga0157379_100116013 733
91 3300025940 Ga0207691_10001114 Ga0207691_1000111418 733
92 3300028379 Ga0268266_10008928 Ga0268266_100089284 733
93 3300049587 Ga0501071_0001958 Ga0501071_0001958_3604_6147 733
94 3300049588 Ga0501072_0014476 Ga0501072_0014476_3473_6016 733
95 3300049589 Ga0501073_0000546 Ga0501073_0000546_14920_17463 733
96 3300049590 Ga0501074_0001739 Ga0501074_0001739_6121_8664 733
97 3300049741 Ga0501079_0003895 Ga0501079_0003895_1245_3788 733
98 3300049742 Ga0501080_0001294 Ga0501080_0001294_565_3108 733
99 3300054114 Ga0501084_0006006 Ga0501084_0006006_6522_9065 733
100 3300005262 Ga0065165_1002736 Ga0065165_10027368 734
101 3300031901 Ga0307406_10038360 Ga0307406_100383601 734
102 3300031995 Ga0307409_100004387 Ga0307409_1000043872 734
103 3300041486 Ga0451807_0362855 Ga0451807_0362855_3380_5920 734
104 3300005327 Ga0070658_10035423 Ga0070658_100354232 735
105 3300005336 Ga0070680_100010173 Ga0070680_1000101737 735
106 3300005339 Ga0070660_100024970 Ga0070660_1000249701 735
107 3300005458 Ga0070681_10011466 Ga0070681_100114665 735
108 3300005530 Ga0070679_100011514 Ga0070679_1000115143 735
109 3300005563 Ga0068855_100016050 Ga0068855_1000160504 735
110 3300005937 Ga0081455_10004270 Ga0081455_100042704 735
111 3300009174 Ga0105241_10024226 Ga0105241_100242262 735
112 3300009551 Ga0105238_10042358 Ga0105238_100423583 735
113 3300011119 Ga0105246_10022644 Ga0105246_100226442 735
114 3300025909 Ga0207705_10001452 Ga0207705_1000145212 735
115 3300025911 Ga0207654_10007963 Ga0207654_100079632 735
116 3300025912 Ga0207707_10036076 Ga0207707_100360762 735
117 3300025917 Ga0207660_10002722 Ga0207660_100027224 735
118 3300025919 Ga0207657_10000977 Ga0207657_100009773 735
119 3300025921 Ga0207652_10005493 Ga0207652_100054934 735
120 3300025924 Ga0207694_10030342 Ga0207694_100303421 735
121 3300025932 Ga0207690_10004578 Ga0207690_100045781 735
122 3300025949 Ga0207667_10008955 Ga0207667_100089554 735
123 3300026121 Ga0207683_10000888 Ga0207683_100008883 735
124 3300005842 Ga0068858_100000079 Ga0068858_10000007991 736
125 3300026035 Ga0207703_10000051 Ga0207703_1000005126 736
126 3300005295 Ga0065707_10082051 Ga0065707_100820519 737
127 3300025925 Ga0207650_10030395 Ga0207650_100303952 737
128 3300048924 Ga0496121_0059089 Ga0496121_0059089_42_2633 737
129 iso_pu_bacteria 2643221663 2644351723 737
130 3300005331 Ga0070670_100046132 Ga0070670_1000461322 738
131 3300009177 Ga0105248_10008338 Ga0105248_100083389 738
132 3300025925 Ga0207650_10029865 Ga0207650_100298652 738
133 3300025941 Ga0207711_10030462 Ga0207711_100304622 738
134 3300049570 Ga0501033_0039098 Ga0501033_0039098_892_3381 738
135 3300028786 Ga0307517_10024840 Ga0307517_100248402 739
136 3300031456 Ga0307513_10010218 Ga0307513_1001021813 739
137 3300049535 Ga0501319_000171 Ga0501319_000171_47_2587 739
138 3300053108 Ga0500562_000233 Ga0500562_000233_7033_9510 739
139 3300003215 JGI25153J46596_10013772 JGI25153J46596_100137722 740
140 3300003791 Ga0055530_10000640 Ga0055530_100006406 740
141 3300025297 Ga0209758_1000404 Ga0209758_100040446 740
142 3300025304 Ga0209257_1000227 Ga0209257_100022765 740
143 3300025304 Ga0209257_1000507 Ga0209257_10005077 740
144 iso_pu_bacteria 2643221699 2644549876 740
145 3300046694 Ga0495649_0000351 Ga0495649_0000351_11662_14190 741
146 3300053088 Ga0500644_0001000 Ga0500644_0001000_2132_4774 741
147 3300053093 Ga0500651_0020740 Ga0500651_0020740_86_2728 741
148 3300037471 Ga0395905_0009369 Ga0395905_0009369_2820_5321 742
149 3300037471 Ga0395905_0034176 Ga0395905_0034176_1417_3921 742
150 iso_pu_bacteria 2643221574 2643883387 742
151 iso_pu_bacteria 2643221699 2644552739 742
152 3300003214 JGI25165J46597_1000036 JGI25165J46597_1000036161 743
153 3300025261 Ga0209233_1000015 Ga0209233_1000015939 743
154 3300031730 Ga0307516_10022995 Ga0307516_100229953 743
155 3300005466 Ga0070685_10001187 Ga0070685_100011879 744
156 3300038443 Ga0395901_0018841 Ga0395901_0018841_26_2554 744
157 3300053119 Ga0500595_004311 Ga0500595_004311_3186_5870 747
158 3300006237 Ga0097621_100000498 Ga0097621_10000049816 748
159 3300006358 Ga0068871_100000406 Ga0068871_10000040617 748
160 3300009553 Ga0105249_10048566 Ga0105249_100485662 749
161 3300015690 Ga0183363_1004 Ga0183363_1004257 749
162 3300013306 Ga0163162_10006458 Ga0163162_100064583 751
163 3300005331 Ga0070670_100001616 Ga0070670_10000161616 753
164 3300005543 Ga0070672_100015151 Ga0070672_1000151513 753
165 3300005564 Ga0070664_100000675 Ga0070664_10000067514 753
166 3300025901 Ga0207688_10033212 Ga0207688_100332121 753
167 3300025920 Ga0207649_10022182 Ga0207649_100221821 753
168 3300025925 Ga0207650_10004342 Ga0207650_100043428 753
169 3300025945 Ga0207679_10001524 Ga0207679_1000152412 753
170 iso_pu_bacteria 2928027323 2928028141 755
171 iso_pu_bacteria 2984555340 2984558471 755
172 iso_pu_bacteria 2984564862 2984567122 755
173 iso_pu_bacteria 2993356040 2993358213 755
174 3300001989 JGI24739J22299_10011254 JGI24739J22299_100112541 757
175 3300005327 Ga0070658_10007123 Ga0070658_100071237 757
176 3300005331 Ga0070670_100034580 Ga0070670_1000345802 757
177 3300005335 Ga0070666_10012793 Ga0070666_100127932 757
178 3300005339 Ga0070660_100057743 Ga0070660_1000577431 757
179 3300005344 Ga0070661_100004811 Ga0070661_1000048118 757
180 3300005355 Ga0070671_100010596 Ga0070671_1000105965 757
181 3300005364 Ga0070673_100008675 Ga0070673_1000086755 757
182 3300005456 Ga0070678_100014896 Ga0070678_1000148964 757
183 3300005457 Ga0070662_100004268 Ga0070662_1000042688 757
184 3300005459 Ga0068867_100013928 Ga0068867_1000139282 757
185 3300005718 Ga0068866_10009864 Ga0068866_100098642 757
186 3300005834 Ga0068851_10008698 Ga0068851_100086983 757
187 3300006881 Ga0068865_100011844 Ga0068865_1000118443 757
188 3300025899 Ga0207642_10006404 Ga0207642_100064042 757
189 3300025909 Ga0207705_10022197 Ga0207705_100221973 757
190 3300025924 Ga0207694_10035303 Ga0207694_100353032 757
191 3300025925 Ga0207650_10055407 Ga0207650_100554071 757
192 3300025938 Ga0207704_10012465 Ga0207704_100124652 757
193 3300026023 Ga0207677_10009419 Ga0207677_100094192 757
194 3300026088 Ga0207641_10028697 Ga0207641_100286972 757
195 3300026095 Ga0207676_10026812 Ga0207676_100268122 757
196 3300026142 Ga0207698_10021037 Ga0207698_100210373 757
197 3300028381 Ga0268264_10021323 Ga0268264_100213233 757
198 3300005367 Ga0070667_100019910 Ga0070667_1000199102 758
199 3300025986 Ga0207658_10000913 Ga0207658_1000091317 758
200 3300006042 Ga0075368_10000008 Ga0075368_1000000840 759
201 3300006353 Ga0075370_10021303 Ga0075370_100213032 759
202 3300027866 Ga0209813_10000045 Ga0209813_1000004531 759
203 3300050494 nmdc:mga06z11_561_c1 nmdc:mga06z11_561_c1_4459_6915 759
204 3300050495 nmdc:mga04h51_75_c1 nmdc:mga04h51_75_c1_2188_4644 759
205 3300050496 nmdc:mga07m45_15451_c1 nmdc:mga07m45_15451_c1_292_2748 759
206 iso_pu_bacteria 2990265787 2990269146 759
207 iso_pu_bacteria 2993693658 2993694849 759
208 3300013307 Ga0157372_10089604 Ga0157372_100896043 760
209 3300037471 Ga0395905_0000533 Ga0395905_0000533_35516_38143 760
210 3300046525 Ga0495663_0002958 Ga0495663_0002958_1552_4179 760
211 3300046684 Ga0495669_0000967 Ga0495669_0000967_4612_7239 760
212 3300032004 Ga0307414_10037134 Ga0307414_100371342 766
213 3300046558 Ga0495633_0000178 Ga0495633_0000178_3529_6033 766
214 3300005338 Ga0068868_100010680 Ga0068868_1000106803 767
215 3300005356 Ga0070674_100004870 Ga0070674_1000048706 767
216 3300005543 Ga0070672_100002560 Ga0070672_1000025604 767
217 3300005617 Ga0068859_100023222 Ga0068859_1000232222 767
218 3300005618 Ga0068864_100006953 Ga0068864_1000069538 767
219 3300005841 Ga0068863_100007922 Ga0068863_1000079223 767
220 3300006931 Ga0097620_100023225 Ga0097620_1000232252 767
221 3300009093 Ga0105240_10045363 Ga0105240_100453633 767
222 3300009098 Ga0105245_10014978 Ga0105245_100149782 767
223 3300009176 Ga0105242_10013827 Ga0105242_100138272 767
224 3300009177 Ga0105248_10070297 Ga0105248_100702972 767
225 3300013296 Ga0157374_10015708 Ga0157374_100157082 767
226 3300013297 Ga0157378_10064221 Ga0157378_100642212 767
227 3300013306 Ga0163162_10003408 Ga0163162_100034081 767
228 3300013306 Ga0163162_10009765 Ga0163162_100097652 767
229 3300013308 Ga0157375_10040091 Ga0157375_100400912 767
230 3300014968 Ga0157379_10035693 Ga0157379_100356933 767
231 3300014969 Ga0157376_10009371 Ga0157376_100093716 767
232 3300025904 Ga0207647_10005921 Ga0207647_100059216 767
233 3300025904 Ga0207647_10013021 Ga0207647_100130214 767
234 3300025919 Ga0207657_10017033 Ga0207657_100170334 767
235 3300025931 Ga0207644_10000230 Ga0207644_1000023035 767
236 3300025940 Ga0207691_10002685 Ga0207691_100026855 767
237 3300025941 Ga0207711_10001704 Ga0207711_100017044 767
238 3300025960 Ga0207651_10003423 Ga0207651_100034236 767
239 3300026089 Ga0207648_10003577 Ga0207648_1000357712 767
240 3300026121 Ga0207683_10003935 Ga0207683_1000393510 767
241 3300028379 Ga0268266_10036760 Ga0268266_100367602 767
242 3300035691 Ga0373931_0007833 Ga0373931_0007833_1923_4676 767
243 3300048903 Ga0496100_0005031 Ga0496100_0005031_2591_5344 767
244 3300048904 Ga0496101_0006283 Ga0496101_0006283_3418_6171 767
245 3300048906 Ga0496103_0005344 Ga0496103_0005344_3236_5989 767
246 3300048908 Ga0496105_0017831 Ga0496105_0017831_2771_5524 767
247 3300048910 Ga0496107_0004508 Ga0496107_0004508_1367_4120 767
248 3300048912 Ga0496109_0014172 Ga0496109_0014172_2578_5331 767
249 3300048913 Ga0496110_0010873 Ga0496110_0010873_3230_5983 767
250 3300048914 Ga0496111_0003066 Ga0496111_0003066_3569_6322 767
251 3300048916 Ga0496113_0007161 Ga0496113_0007161_2208_4961 767
252 3300026067 Ga0207678_10027006 Ga0207678_100270062 769
253 3300046500 Ga0495596_0001690 Ga0495596_0001690_3945_6524 769
254 3300001990 JGI24737J22298_10007492 JGI24737J22298_100074922 771
255 3300053125 Ga0500618_000369 Ga0500618_000369_6767_9295 771
256 3300025229 Ga0209147_101474 Ga0209147_1014744 772
257 3300046522 Ga0495643_0000321 Ga0495643_0000321_41807_44392 772
258 3300046538 Ga0495609_0007491 Ga0495609_0007491_1359_3824 772
259 iso_pu_bacteria 3000865235 3000866677 773
260 3300041413 Ga0439465_0001605 Ga0439465_0001605_3858_6362 774
261 iso_pu_bacteria 2946787523 2946790849 774
262 3300009093 Ga0105240_10006078 Ga0105240_100060789 775
263 3300010375 Ga0105239_10000025 Ga0105239_1000002545 775
264 3300025913 Ga0207695_10007272 Ga0207695_100072722 775
265 3300037471 Ga0395905_0044281 Ga0395905_0044281_292_2844 775
266 3300046501 Ga0495607_0008063 Ga0495607_0008063_3455_5953 775
267 3300047469 Ga0495673_0009550 Ga0495673_0009550_579_3158 775
268 3300048924 Ga0496121_0000671 Ga0496121_0000671_45007_47505 775
269 3300048929 Ga0496126_0001878 Ga0496126_0001878_16380_18878 775
270 3300032004 Ga0307414_10048537 Ga0307414_100485372 778
271 3300046512 Ga0495610_0000107 Ga0495610_0000107_40467_43058 778
272 3300046519 Ga0495632_0000925 Ga0495632_0000925_20497_23088 778
273 3300009093 Ga0105240_10006078 Ga0105240_1000607810 780
274 3300010375 Ga0105239_10000025 Ga0105239_1000002544 780
275 3300032126 Ga0307415_100018196 Ga0307415_1000181963 780
276 3300048925 Ga0496122_0002698 Ga0496122_0002698_3306_5924 781
277 3300048926 Ga0496123_0001559 Ga0496123_0001559_10274_12892 781
278 3300046524 Ga0495648_0000189 Ga0495648_0000189_5233_7827 782
279 3300046524 Ga0495648_0016022 Ga0495648_0016022_1569_4160 782
280 iso_pu_bacteria 2852653556 2852653951 782
281 3300031911 Ga0307412_10030904 Ga0307412_100309043 783
282 3300037418 Ga0395900_0117886 Ga0395900_0117886_105_2690 785
283 3300009148 Ga0105243_10000278 Ga0105243_1000027823 786
284 3300025935 Ga0207709_10000039 Ga0207709_1000003945 786
285 3300037312 Ga0395899_0021088 Ga0395899_0021088_1945_4548 786
286 3300045976 Ga0466967_0036333 Ga0466967_0036333_1570_4134 787
287 iso_pu_bacteria 2919138771 2919142162 787
288 3300048919 Ga0496116_0000108 Ga0496116_0000108_179566_182025 788
289 3300048926 Ga0496123_0007174 Ga0496123_0007174_2146_4605 788
290 3300048927 Ga0496124_0002464 Ga0496124_0002464_15678_18137 788
291 3300048928 Ga0496125_0078659 Ga0496125_0078659_22_2481 788
292 3300048929 Ga0496126_0002391 Ga0496126_0002391_6757_9216 788
293 3300013104 Ga0157370_10016460 Ga0157370_100164605 789
294 3300025263 Ga0209565_1000209 Ga0209565_100020913 789
295 3300025295 Ga0209564_1011181 Ga0209564_10111812 789
296 3300031616 Ga0307508_10003117 Ga0307508_100031173 789
297 3300045049 Ga0466959_0028756 Ga0466959_0028756_305_2920 789
298 3300046500 Ga0495596_0000135 Ga0495596_0000135_3644_6106 789
299 3300046512 Ga0495610_0003085 Ga0495610_0003085_10694_13156 789
300 3300048091 Ga0495626_0001489 Ga0495626_0001489_5691_8153 789
301 3300037466 Ga0395898_0044063 Ga0395898_0044063_13_2559 790
302 3300038443 Ga0395901_0028227 Ga0395901_0028227_1216_3768 790
303 3300013104 Ga0157370_10013844 Ga0157370_100138445 791
304 3300048924 Ga0496121_0000671 Ga0496121_0000671_42010_44499 791
305 3300048929 Ga0496126_0001878 Ga0496126_0001878_19386_21875 791
306 3300005617 Ga0068859_100032226 Ga0068859_1000322263 792
307 3300005841 Ga0068863_100060635 Ga0068863_1000606352 792
308 3300006931 Ga0097620_100032226 Ga0097620_1000322263 792
309 3300025941 Ga0207711_10002307 Ga0207711_1000230710 792
310 3300025986 Ga0207658_10016029 Ga0207658_100160293 792
311 3300026088 Ga0207641_10012940 Ga0207641_100129403 792
312 3300048905 Ga0496102_0000126 Ga0496102_0000126_50367_53216 792
313 3300048906 Ga0496103_0000089 Ga0496103_0000089_51041_53890 792
314 3300048908 Ga0496105_0000574 Ga0496105_0000574_1464_4313 792
315 3300048918 Ga0496115_0000147 Ga0496115_0000147_50367_53216 792
316 3300048919 Ga0496116_0011857 Ga0496116_0011857_965_3814 792
317 3300048920 Ga0496117_0000329 Ga0496117_0000329_48857_51706 792
318 3300048921 Ga0496118_0000164 Ga0496118_0000164_86043_88892 792
319 3300048922 Ga0496119_0013840 Ga0496119_0013840_2687_5536 792
320 3300048923 Ga0496120_0018023 Ga0496120_0018023_679_3528 792
321 3300048924 Ga0496121_0000232 Ga0496121_0000232_30517_33366 792
322 3300048927 Ga0496124_0000041 Ga0496124_0000041_252414_255263 792
323 3300048929 Ga0496126_0000324 Ga0496126_0000324_48707_51556 792
324 3300046506 Ga0495583_0007137 Ga0495583_0007137_493_3270 793
325 iso_pu_bacteria 2896429255 2896430020 793
326 3300031731 Ga0307405_10008340 Ga0307405_100083405 794
327 3300031995 Ga0307409_100038932 Ga0307409_1000389323 794
328 3300032126 Ga0307415_100006075 Ga0307415_1000060755 794
329 3300049585 Ga0501069_0009786 Ga0501069_0009786_786_3314 794
330 3300049586 Ga0501070_0032046 Ga0501070_0032046_448_2976 794
331 3300005543 Ga0070672_100030997 Ga0070672_1000309972 796
332 3300005547 Ga0070693_100011018 Ga0070693_1000110183 796
333 3300005844 Ga0068862_100034412 Ga0068862_1000344123 796
334 3300006852 Ga0075433_10046828 Ga0075433_100468282 796
335 3300021384 Ga0213876_10000524 Ga0213876_100005243 796
336 3300025940 Ga0207691_10048964 Ga0207691_100489643 796
337 3300025981 Ga0207640_10030917 Ga0207640_100309172 796
338 3300026035 Ga0207703_10001844 Ga0207703_100018442 796
339 3300026116 Ga0207674_10010652 Ga0207674_100106527 796
340 3300028380 Ga0268265_10019969 Ga0268265_100199693 796
341 3300039437 Ga0436365_0712054 Ga0436365_0712054_1727_4438 796
342 3300048924 Ga0496121_0000070 Ga0496121_0000070_102593_105196 796
343 3300050515 nmdc:mga0a205_1958_c1 nmdc:mga0a205_1958_c1_2722_5469 796
344 3300005356 Ga0070674_100001269 Ga0070674_1000012692 797
345 3300005456 Ga0070678_100000152 Ga0070678_1000001525 797
346 3300025937 Ga0207669_10000171 Ga0207669_1000017120 797
347 3300026121 Ga0207683_10004155 Ga0207683_100041556 797
348 3300005345 Ga0070692_10000336 Ga0070692_100003365 798
349 3300046500 Ga0495596_0001630 Ga0495596_0001630_4095_6638 798
350 3300046660 Ga0495625_0045175 Ga0495625_0045175_572_3115 798
351 3300005327 Ga0070658_10040746 Ga0070658_100407462 799
352 3300005339 Ga0070660_100020181 Ga0070660_1000201813 799
353 3300005347 Ga0070668_100028146 Ga0070668_1000281461 799
354 3300005435 Ga0070714_100038998 Ga0070714_1000389983 799
355 3300005457 Ga0070662_100004016 Ga0070662_1000040162 799
356 3300013102 Ga0157371_10019625 Ga0157371_100196253 799
357 3300013105 Ga0157369_10027670 Ga0157369_100276703 799
358 3300025929 Ga0207664_10045238 Ga0207664_100452382 799
359 3300025933 Ga0207706_10002787 Ga0207706_100027876 799
360 3300025972 Ga0207668_10039494 Ga0207668_100394941 799
361 3300026078 Ga0207702_10028453 Ga0207702_100284531 799
362 3300037418 Ga0395900_0032222 Ga0395900_0032222_194_2803 799
363 3300037466 Ga0395898_0057012 Ga0395898_0057012_114_2732 799
364 3300037471 Ga0395905_0035144 Ga0395905_0035144_1284_3902 799
365 3300011119 Ga0105246_10000491 Ga0105246_100004919 800
366 3300021384 Ga0213876_10008661 Ga0213876_100086613 800
367 3300039437 Ga0436365_1754682 Ga0436365_1754682_20440_23127 800
368 3300005331 Ga0070670_100006019 Ga0070670_1000060199 801
369 3300005335 Ga0070666_10003370 Ga0070666_100033701 801
370 3300005338 Ga0068868_100000269 Ga0068868_10000026929 801
371 3300005339 Ga0070660_100011146 Ga0070660_1000111463 801
372 3300005366 Ga0070659_100000025 Ga0070659_10000002568 801
373 3300005844 Ga0068862_100016228 Ga0068862_1000162284 801
374 3300025919 Ga0207657_10003194 Ga0207657_1000319414 801
375 3300025932 Ga0207690_10000005 Ga0207690_10000005408 801
376 3300026023 Ga0207677_10000059 Ga0207677_1000005974 801
377 3300028380 Ga0268265_10001693 Ga0268265_1000169313 801
378 3300053087 Ga0500643_001424 Ga0500643_001424_4932_7559 801
379 3300053724 Ga0500570_000304 Ga0500570_000304_7456_10086 801
380 3300005344 Ga0070661_100006733 Ga0070661_1000067334 802
381 3300005578 Ga0068854_100015038 Ga0068854_1000150383 802
382 3300025981 Ga0207640_10010081 Ga0207640_100100813 802
383 3300037312 Ga0395899_0000981 Ga0395899_0000981_21127_23832 802
384 3300002774 JGI25150J39212_1000195 JGI25150J39212_100019517 803
385 3300003215 JGI25153J46596_10000208 JGI25153J46596_1000020829 803
386 3300003792 Ga0055540_1001676 Ga0055540_10016762 803
387 3300005355 Ga0070671_100004621 Ga0070671_1000046218 803
388 3300005367 Ga0070667_100010417 Ga0070667_1000104174 803
389 3300005564 Ga0070664_100013905 Ga0070664_1000139052 803
390 3300005577 Ga0068857_100013092 Ga0068857_1000130925 803
391 3300005614 Ga0068856_100013973 Ga0068856_1000139732 803
392 3300005618 Ga0068864_100001220 Ga0068864_10000122011 803
393 3300005841 Ga0068863_100020341 Ga0068863_1000203412 803
394 3300005842 Ga0068858_100013557 Ga0068858_1000135571 803
395 3300009011 Ga0105251_10006302 Ga0105251_100063025 803
396 3300009177 Ga0105248_10021987 Ga0105248_100219875 803
397 3300013100 Ga0157373_10012355 Ga0157373_100123553 803
398 3300013307 Ga0157372_10025212 Ga0157372_100252124 803
399 3300014497 Ga0182008_10015332 Ga0182008_100153323 803
400 3300014968 Ga0157379_10000931 Ga0157379_1000093112 803
401 3300025245 Ga0207425_1000025 Ga0207425_100002526 803
402 3300025258 Ga0209129_1001489 Ga0209129_10014897 803
403 3300025294 Ga0209025_1000630 Ga0209025_100063051 803
404 3300025297 Ga0209758_1000002 Ga0209758_1000002110 803
405 3300025297 Ga0209758_1000108 Ga0209758_1000108107 803
406 3300025298 Ga0209050_1000001 Ga0209050_100000118 803
407 3300025303 Ga0209051_1000699 Ga0209051_100069918 803
408 3300025933 Ga0207706_10024036 Ga0207706_100240363 803
409 3300025945 Ga0207679_10007251 Ga0207679_100072514 803
410 3300025986 Ga0207658_10010628 Ga0207658_100106282 803
411 3300026035 Ga0207703_10008783 Ga0207703_100087837 803
412 3300026078 Ga0207702_10004206 Ga0207702_100042065 803
413 3300026116 Ga0207674_10000060 Ga0207674_1000006032 803
414 3300028381 Ga0268264_10014440 Ga0268264_100144404 803
415 3300032005 Ga0307411_10010227 Ga0307411_100102272 803
416 3300037471 Ga0395905_0046337 Ga0395905_0046337_1068_3800 803
417 3300048905 Ga0496102_0003478 Ga0496102_0003478_8227_10959 803
418 3300048912 Ga0496109_0022671 Ga0496109_0022671_893_3625 803
419 3300048915 Ga0496112_0042785 Ga0496112_0042785_419_3124 803
420 3300048916 Ga0496113_0006171 Ga0496113_0006171_2157_4889 803
421 3300005364 Ga0070673_100025134 Ga0070673_1000251343 804
422 3300005367 Ga0070667_100014231 Ga0070667_1000142315 804
423 3300006871 Ga0075434_100038812 Ga0075434_1000388122 804
424 3300013308 Ga0157375_10046829 Ga0157375_100468293 804
425 3300025904 Ga0207647_10001088 Ga0207647_100010885 804
426 3300025933 Ga0207706_10005207 Ga0207706_1000520710 804
427 3300037312 Ga0395899_0051287 Ga0395899_0051287_203_2848 804
428 3300037418 Ga0395900_0039052 Ga0395900_0039052_1042_3687 804
429 3300037466 Ga0395898_0019094 Ga0395898_0019094_491_3136 804
430 3300037471 Ga0395905_0025177 Ga0395905_0025177_1183_3828 804
431 3300038443 Ga0395901_0018571 Ga0395901_0018571_4180_6825 804
432 3300042005 Ga0439448_0010905 Ga0439448_0010905_81_2678 804
433 3300042012 Ga0439455_0000040 Ga0439455_0000040_1658_4255 804
434 3300046471 Ga0495650_0000290 Ga0495650_0000290_23881_26454 804
435 3300046492 Ga0495585_0002673 Ga0495585_0002673_6280_8853 804
436 3300046512 Ga0495610_0000061 Ga0495610_0000061_73866_76484 804
437 3300046515 Ga0495620_0022603 Ga0495620_0022603_18_2636 804
438 3300046660 Ga0495625_0000915 Ga0495625_0000915_6987_9560 804
439 3300053119 Ga0500595_001579 Ga0500595_001579_4018_6591 804
440 3300001979 JGI24740J21852_10006563 JGI24740J21852_100065633 805
441 3300005339 Ga0070660_100000517 Ga0070660_10000051715 805
442 3300005339 Ga0070660_100003837 Ga0070660_1000038373 805
443 3300005345 Ga0070692_10002274 Ga0070692_100022743 805
444 3300005366 Ga0070659_100007854 Ga0070659_1000078542 805
445 3300005444 Ga0070694_100001237 Ga0070694_1000012376 805
446 3300005457 Ga0070662_100000794 Ga0070662_1000007946 805
447 3300005577 Ga0068857_100055120 Ga0068857_1000551202 805
448 3300005843 Ga0068860_100004969 Ga0068860_1000049693 805
449 3300009553 Ga0105249_10001260 Ga0105249_1000126015 805
450 3300010375 Ga0105239_10016097 Ga0105239_100160975 805
451 3300013306 Ga0163162_10096226 Ga0163162_100962262 805
452 3300025904 Ga0207647_10000509 Ga0207647_1000050922 805
453 3300025919 Ga0207657_10001399 Ga0207657_1000139915 805
454 3300025919 Ga0207657_10001882 Ga0207657_1000188210 805
455 3300025919 Ga0207657_10059277 Ga0207657_100592771 805
456 3300025932 Ga0207690_10001059 Ga0207690_100010599 805
457 3300025933 Ga0207706_10017644 Ga0207706_100176442 805
458 3300025940 Ga0207691_10020611 Ga0207691_100206114 805
459 3300025961 Ga0207712_10000280 Ga0207712_1000028034 805
460 3300026041 Ga0207639_10029517 Ga0207639_100295172 805
461 3300026116 Ga0207674_10062676 Ga0207674_100626762 805
462 3300028381 Ga0268264_10000750 Ga0268264_100007504 805
463 3300046501 Ga0495607_0010945 Ga0495607_0010945_438_3023 805
464 3300046539 Ga0495621_0000694 Ga0495621_0000694_224_3025 805
465 3300046694 Ga0495649_0032293 Ga0495649_0032293_10_2712 805
466 3300049764 Ga0501267_000246 Ga0501267_000246_844_3519 805
467 3300053130 Ga0500642_0000001 Ga0500642_0000001_698624_701296 805
468 3300046691 Ga0495670_0000029 Ga0495670_0000029_27688_30366 806
469 3300005327 Ga0070658_10013616 Ga0070658_100136165 807
470 3300005577 Ga0068857_100011184 Ga0068857_1000111845 807
471 3300005618 Ga0068864_100046691 Ga0068864_1000466912 807
472 3300005841 Ga0068863_100003094 Ga0068863_1000030945 807
473 3300025254 Ga0209148_1001558 Ga0209148_100155810 807
474 3300025909 Ga0207705_10008793 Ga0207705_100087932 807
475 3300026116 Ga0207674_10000065 Ga0207674_1000006597 807
476 3300037418 Ga0395900_0047347 Ga0395900_0047347_625_3282 807
477 3300038443 Ga0395901_0076311 Ga0395901_0076311_705_3362 807
478 3300042157 Ga0439458_0000036 Ga0439458_0000036_3439_6096 807
479 3300046453 Ga0495627_001098 Ga0495627_001098_188_2818 807
480 3300046471 Ga0495650_0008893 Ga0495650_0008893_169_2799 807
481 3300047470 Ga0495681_0001474 Ga0495681_0001474_14764_17394 807
482 3300048918 Ga0496115_0000991 Ga0496115_0000991_6571_9387 807
483 3300053087 Ga0500643_010993 Ga0500643_010993_421_3291 807
484 3300005331 Ga0070670_100036835 Ga0070670_1000368352 808
485 3300009177 Ga0105248_10002150 Ga0105248_1000215010 808
486 3300009551 Ga0105238_10026317 Ga0105238_100263171 808
487 3300025924 Ga0207694_10005329 Ga0207694_100053295 808
488 3300025925 Ga0207650_10009402 Ga0207650_100094023 808
489 3300046491 Ga0495584_0016999 Ga0495584_0016999_655_3432 808
490 3300046506 Ga0495583_0000373 Ga0495583_0000373_955_3555 808
491 3300046520 Ga0495637_0017962 Ga0495637_0017962_723_3272 808
492 3300046660 Ga0495625_0006851 Ga0495625_0006851_5008_7785 808
493 3300046684 Ga0495669_0000848 Ga0495669_0000848_6942_9719 808
494 3300046692 Ga0495671_0000125 Ga0495671_0000125_1063_3663 808
495 3300047443 Ga0495687_000109 Ga0495687_000109_73739_76516 808
496 3300047469 Ga0495673_0000275 Ga0495673_0000275_66399_68999 808
497 3300048916 Ga0496113_0052846 Ga0496113_0052846_221_2998 808
498 3300048926 Ga0496123_0036766 Ga0496123_0036766_511_3288 808
499 3300048928 Ga0496125_0000639 Ga0496125_0000639_53994_56771 808
500 3300053730 Ga0500645_000001 Ga0500645_000001_376668_379445 808
501 3300003214 JGI25165J46597_1000094 JGI25165J46597_100009450 809
502 3300005614 Ga0068856_100014424 Ga0068856_1000144245 809
503 3300025231 Ga0207427_100561 Ga0207427_1005616 809
504 3300025250 Ga0209026_1001031 Ga0209026_10010314 809
505 3300025261 Ga0209233_1000003 Ga0209233_10000031329 809
506 3300025919 Ga0207657_10060508 Ga0207657_100605082 809
507 3300025972 Ga0207668_10001009 Ga0207668_1000100920 809
508 3300026078 Ga0207702_10008323 Ga0207702_100083236 809
509 3300037418 Ga0395900_0043982 Ga0395900_0043982_517_3198 809
510 3300037466 Ga0395898_0090031 Ga0395898_0090031_185_2866 809
511 3300038443 Ga0395901_0011606 Ga0395901_0011606_3520_6201 809
512 3300046522 Ga0495643_0002608 Ga0495643_0002608_6253_8973 809
513 iso_pu_bacteria 2510917021 2511127624 809
514 3300046512 Ga0495610_0000095 Ga0495610_0000095_9773_12337 810
515 3300047470 Ga0495681_0000008 Ga0495681_0000008_182155_184719 810
516 iso_pu_bacteria 2512564014 2512641958 810
517 3300001990 JGI24737J22298_10004687 JGI24737J22298_100046873 811
518 3300003759 Ga0055525_1000037 Ga0055525_100003781 811
519 3300005339 Ga0070660_100010005 Ga0070660_1000100052 811
520 3300005353 Ga0070669_100017384 Ga0070669_1000173842 811
521 3300005367 Ga0070667_100029798 Ga0070667_1000297982 811
522 3300005457 Ga0070662_100008146 Ga0070662_1000081463 811
523 3300005539 Ga0068853_100046429 Ga0068853_1000464292 811
524 3300005543 Ga0070672_100003962 Ga0070672_1000039625 811
525 3300005563 Ga0068855_100082566 Ga0068855_1000825662 811
526 3300005577 Ga0068857_100055649 Ga0068857_1000556492 811
527 3300005834 Ga0068851_10014299 Ga0068851_100142992 811
528 3300005841 Ga0068863_100001606 Ga0068863_10000160616 811
529 3300005842 Ga0068858_100001226 Ga0068858_10000122610 811
530 3300009177 Ga0105248_10027068 Ga0105248_100270682 811
531 3300013296 Ga0157374_10001212 Ga0157374_1000121219 811
532 3300014325 Ga0163163_10002967 Ga0163163_1000296710 811
533 3300025230 Ga0209563_100105 Ga0209563_10010555 811
534 3300025321 Ga0207656_10006855 Ga0207656_100068552 811
535 3300025914 Ga0207671_10006263 Ga0207671_100062635 811
536 3300025925 Ga0207650_10002895 Ga0207650_1000289510 811
537 3300025931 Ga0207644_10010126 Ga0207644_100101262 811
538 3300025932 Ga0207690_10010182 Ga0207690_100101822 811
539 3300025933 Ga0207706_10038867 Ga0207706_100388672 811
540 3300025940 Ga0207691_10000916 Ga0207691_1000091620 811
541 3300025941 Ga0207711_10001043 Ga0207711_100010434 811
542 3300025941 Ga0207711_10004471 Ga0207711_1000447110 811
543 3300025945 Ga0207679_10010931 Ga0207679_100109312 811
544 3300026041 Ga0207639_10035340 Ga0207639_100353402 811
545 3300026088 Ga0207641_10018178 Ga0207641_100181782 811
546 3300026095 Ga0207676_10001732 Ga0207676_100017327 811
547 3300026121 Ga0207683_10000976 Ga0207683_1000097623 811
548 3300044901 Ga0466960_0009985 Ga0466960_0009985_823_3615 811
549 3300046660 Ga0495625_0016101 Ga0495625_0016101_2009_4654 811
550 3300048904 Ga0496101_0004862 Ga0496101_0004862_4685_7426 811
551 3300048910 Ga0496107_0004786 Ga0496107_0004786_6112_8853 811
552 3300048912 Ga0496109_0007457 Ga0496109_0007457_5713_8454 811
553 3300048914 Ga0496111_0003869 Ga0496111_0003869_2301_5042 811
554 3300048915 Ga0496112_0002520 Ga0496112_0002520_2476_5217 811
555 3300048916 Ga0496113_0001156 Ga0496113_0001156_831_3572 811
556 3300048917 Ga0496114_0013429 Ga0496114_0013429_3416_6157 811
557 3300048918 Ga0496115_0023646 Ga0496115_0023646_1990_4731 811
558 3300048921 Ga0496118_0000475 Ga0496118_0000475_8967_11480 811
559 3300053104 Ga0500556_0000014 Ga0500556_0000014_72384_75029 811
560 3300053148 Ga0500590_001811 Ga0500590_001811_4231_6933 811
561 3300003781 Ga0055536_1002435 Ga0055536_100243513 812
562 3300005327 Ga0070658_10000037 Ga0070658_1000003736 812
563 3300005339 Ga0070660_100002339 Ga0070660_1000023399 812
564 3300005366 Ga0070659_100010876 Ga0070659_1000108763 812
565 3300005842 Ga0068858_100001536 Ga0068858_1000015364 812
566 3300025292 Ga0209676_1000557 Ga0209676_100055725 812
567 3300025909 Ga0207705_10000008 Ga0207705_10000008120 812
568 3300025932 Ga0207690_10013749 Ga0207690_100137491 812
569 3300026035 Ga0207703_10001249 Ga0207703_100012492 812
570 3300053139 Ga0500568_0011025 Ga0500568_0011025_404_3094 812
571 3300053153 Ga0500616_0000411 Ga0500616_0000411_29416_32106 812
572 3300013297 Ga0157378_10032569 Ga0157378_100325692 813
573 3300042004 Ga0439445_0004692 Ga0439445_0004692_260_3013 813
574 3300046660 Ga0495625_0000107 Ga0495625_0000107_54738_57392 813
575 3300053151 Ga0500604_0000053 Ga0500604_0000053_32206_34995 813
576 3300053730 Ga0500645_000315 Ga0500645_000315_6693_9338 813
577 iso_pu_bacteria 2738541275 2738712446 813
578 iso_pu_bacteria 2738541301 2738850860 813
579 iso_pu_bacteria 2738541304 2738866600 813
580 iso_pu_bacteria 2738543022 2739299107 813
581 iso_pu_bacteria 2738543033 2739360796 813
582 iso_pu_bacteria 2928959182 2928962809 813
583 3300003762 Ga0055542_1000286 Ga0055542_100028646 814
584 3300003763 Ga0055529_1000207 Ga0055529_100020746 814
585 3300005333 Ga0070677_10000384 Ga0070677_100003849 814
586 3300005548 Ga0070665_100000444 Ga0070665_10000044440 814
587 3300025254 Ga0209148_1000011 Ga0209148_10000111146 814
588 3300025272 Ga0209455_1000006 Ga0209455_100000646 814
589 3300025893 Ga0207682_10000704 Ga0207682_100007049 814
590 3300028379 Ga0268266_10000131 Ga0268266_1000013117 814
591 3300033180 Ga0307510_10005453 Ga0307510_100054538 814
592 3300046660 Ga0495625_0011108 Ga0495625_0011108_1689_4415 814
593 3300053735 Ga0500596_000599 Ga0500596_000599_4051_6681 815
594 3300001915 JGI24741J21665_1002154 JGI24741J21665_10021543 816
595 3300001979 JGI24740J21852_10010664 JGI24740J21852_100106642 816
596 3300005354 Ga0070675_100032470 Ga0070675_1000324702 816
597 3300005356 Ga0070674_100002821 Ga0070674_1000028217 816
598 3300005564 Ga0070664_100067024 Ga0070664_1000670241 816
599 3300005578 Ga0068854_100027206 Ga0068854_1000272062 816
600 3300005614 Ga0068856_100067422 Ga0068856_1000674222 816
601 3300005616 Ga0068852_100049090 Ga0068852_1000490902 816
602 3300009094 Ga0111539_10080121 Ga0111539_100801212 816
603 3300009174 Ga0105241_10023208 Ga0105241_100232083 816
604 3300010375 Ga0105239_10094196 Ga0105239_100941962 816
605 3300013100 Ga0157373_10031816 Ga0157373_100318162 816
606 3300013102 Ga0157371_10000285 Ga0157371_1000028515 816
607 3300013105 Ga0157369_10083649 Ga0157369_100836491 816
608 3300025904 Ga0207647_10008471 Ga0207647_100084715 816
609 3300025911 Ga0207654_10001371 Ga0207654_100013711 816
610 3300025924 Ga0207694_10016934 Ga0207694_100169342 816
611 3300025926 Ga0207659_10024563 Ga0207659_100245632 816
612 3300025933 Ga0207706_10036198 Ga0207706_100361982 816
613 3300025937 Ga0207669_10001692 Ga0207669_100016926 816
614 3300026067 Ga0207678_10050579 Ga0207678_100505792 816
615 3300026078 Ga0207702_10010790 Ga0207702_100107904 816
616 3300026142 Ga0207698_10019761 Ga0207698_100197612 816
617 3300031456 Ga0307513_10011868 Ga0307513_100118682 816
618 3300046506 Ga0495583_0001065 Ga0495583_0001065_5627_8263 816
619 3300046616 Ga0495668_0000181 Ga0495668_0000181_9863_12607 816
620 3300046660 Ga0495625_0034633 Ga0495625_0034633_726_3470 816
621 3300047323 Ga0495683_0001719 Ga0495683_0001719_8315_11083 816
622 3300047323 Ga0495683_0012193 Ga0495683_0012193_1246_3990 816
623 3300047445 Ga0495677_0008252 Ga0495677_0008252_647_3391 816
624 3300050511 nmdc:mga08y16_66807_c1 nmdc:mga08y16_66807_c1_329_3040 816
625 3300005843 Ga0068860_100032161 Ga0068860_1000321614 817
626 3300009551 Ga0105238_10047069 Ga0105238_100470693 817
627 3300025291 Ga0209675_1001006 Ga0209675_100100612 817
628 3300025292 Ga0209676_1013843 Ga0209676_10138431 817
629 3300028381 Ga0268264_10052488 Ga0268264_100524881 817
630 3300005289 Ga0065704_10000479 Ga0065704_100004791 819
631 3300005347 Ga0070668_100000426 Ga0070668_1000004267 819
632 3300025735 Ga0207713_1018000 Ga0207713_10180002 819
633 iso_pu_bacteria 2928100450 2928103498 819
634 3300046557 Ga0495622_0010263 Ga0495622_0010263_864_3515 820
635 3300046660 Ga0495625_0027441 Ga0495625_0027441_39_2645 820
636 3300002239 JGI24034J26672_10000853 JGI24034J26672_100008533 823
637 3300005353 Ga0070669_100000160 Ga0070669_10000016044 823
638 3300005355 Ga0070671_100038781 Ga0070671_1000387812 823
639 3300005548 Ga0070665_100001375 Ga0070665_1000013754 823
640 3300025711 Ga0207696_1001333 Ga0207696_10013334 823
641 3300025735 Ga0207713_1017913 Ga0207713_10179131 823
642 3300025923 Ga0207681_10000128 Ga0207681_1000012851 823
643 3300025931 Ga0207644_10003103 Ga0207644_100031036 823
644 3300025986 Ga0207658_10003201 Ga0207658_100032012 823
645 3300028379 Ga0268266_10002172 Ga0268266_100021723 823
646 3300048905 Ga0496102_0001684 Ga0496102_0001684_10532_13195 823
647 3300048906 Ga0496103_0000049 Ga0496103_0000049_51783_54446 823
648 3300048907 Ga0496104_0000073 Ga0496104_0000073_62267_64951 823
649 3300048908 Ga0496105_0000040 Ga0496105_0000040_52001_54685 823
650 3300048916 Ga0496113_0018925 Ga0496113_0018925_386_3049 823
651 3300048920 Ga0496117_0000123 Ga0496117_0000123_48238_50901 823
652 3300048921 Ga0496118_0004909 Ga0496118_0004909_181_2844 823
653 3300048922 Ga0496119_0000090 Ga0496119_0000090_79671_82355 823
654 3300048923 Ga0496120_0000530 Ga0496120_0000530_25584_28268 823
655 3300048924 Ga0496121_0018903 Ga0496121_0018903_162_2825 823
656 3300048927 Ga0496124_0002815 Ga0496124_0002815_3590_6247 823
657 3300048929 Ga0496126_0000045 Ga0496126_0000045_276585_279269 823
658 3300048913 Ga0496110_0050825 Ga0496110_0050825_430_2910 824
659 3300048926 Ga0496123_0042471 Ga0496123_0042471_473_2953 824
660 3300048928 Ga0496125_0011263 Ga0496125_0011263_5349_7829 824
661 iso_pu_bacteria 2808606401 2809061867 825
662 iso_pu_bacteria 2808606404 2809077831 825
663 iso_pu_bacteria 2808606405 2809082461 825
664 iso_pu_bacteria 2880518877 2880519950 825
665 3300001989 JGI24739J22299_10012243 JGI24739J22299_100122432 829
666 3300005457 Ga0070662_100035798 Ga0070662_1000357982 829
667 3300005616 Ga0068852_100056353 Ga0068852_1000563532 829
668 3300009551 Ga0105238_10033510 Ga0105238_100335102 829
669 3300025924 Ga0207694_10047086 Ga0207694_100470862 829
670 3300025933 Ga0207706_10057359 Ga0207706_100573592 829
671 3300025949 Ga0207667_10072956 Ga0207667_100729562 829
672 3300031731 Ga0307405_10013608 Ga0307405_100136082 829
673 3300001904 JGI24736J21556_1002799 JGI24736J21556_10027992 835
674 3300002075 JGI24738J21930_10000692 JGI24738J21930_100006928 835
675 3300005339 Ga0070660_100055360 Ga0070660_1000553601 835
676 3300010375 Ga0105239_10122728 Ga0105239_101227282 835
677 3300013307 Ga0157372_10087211 Ga0157372_100872112 835

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07715

Plug

TonB-dependent Receptor Plug Domain

49

159

0.93

PF00593

TonB_dep_Rec_b-barrel

TonB dependent receptor-like, beta-barrel

295

902

0.62

Structural Annotation

Top 5 Hits

ID Description Score Start End
1nqf-assembly1.cif.gz_A outer membrane cobalamin transporter (btub) from e. coli, methionine substiution construct for se-met sad phasing 0.8538 53 830
1kmp-assembly1.cif.gz_A crystal structure of the outer membrane transporter feca complexed with ferric citrate 0.8506 54 830
1kmp-assembly1.cif.gz_A crystal structure of the outer membrane transporter feca complexed with ferric citrate 0.8424 54 830
6v81-assembly1.cif.gz_A the crystal structure of the outer-membrane transporter yncd 0.8382 50 830
3rgn-assembly1.cif.gz_A crystal structure of spin-labeled btub w371r1 0.8345 55 830
ID Description Score Start End Superfamily
1kmpA02 Mainly Beta;Beta Barrel;Maltoporin; Chain A;TonB-dependent receptor, beta-barrel domain 0.816 172 830 2.40.170.20
1kmpA02 Mainly Beta;Beta Barrel;Maltoporin; Chain A;TonB-dependent receptor, beta-barrel domain 0.8116 172 830 2.40.170.20
af_P76115_176_696_2.40.170.20 Mainly Beta;Beta Barrel;Maltoporin; Chain A;TonB-dependent receptor, beta-barrel domain 0.8065 185 828 2.40.170.20
4epaA00 Mainly Beta;Beta Barrel;Maltoporin; Chain A;TonB-dependent receptor, beta-barrel domain 0.8062 43 830 2.40.170.20
3rgnA02 Mainly Beta;Beta Barrel;Maltoporin; Chain A;TonB-dependent receptor, beta-barrel domain 0.8054 167 830 2.40.170.20
ID Description Score Start End GO Terms
AF-A0A2M7HFE1-F1-model_v4 deleted 0.913 449 830
AF-A0A0S7XYG3-F1-model_v4 TonB-dependent receptor plug domain-containing protein 0.8796 53 830 GO:0009279
GO:0015344
AF-A0A4Q2XVS8-F1-model_v4 deleted 0.8756 20 257
AF-A0A6S6PJ28-F1-model_v4 TonB-dependent receptor 0.8729 49 830 GO:0009279
GO:0015344
AF-A0A7Z9GL55-F1-model_v4 TonB-dependent receptor 0.8716 606 830 GO:0009279
GO:0015344

Feature Viewer

pLDDT pTM Quality
84.5 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map