F474412

General Info

Members Datasets Scaffolds Average Seq Length
675 367 1350 98

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_101302126|Ga0070683_1013021262
Length 107
Sequence MSASPAESPHVITTEQVSHLANLARIALTADEIEKLTGELGVIIESIAKVSEVATADVPATSHPIPMANVFRPDVVGATLTVEQALSGAPDRDGNRFKVSAILGEEQ

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
4 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003285 Grassland soil microbial communities from Hopland, California, USA - Sample H3_Rhizo_39 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
10 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
48 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
51 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
52 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
53 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
54 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
86 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
87 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
120 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
122 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
123 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
124 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
125 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
126 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
127 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
128 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
129 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
130 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
131 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
132 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
133 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
134 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
135 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
136 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
137 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
138 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
139 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
140 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
141 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
142 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
143 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
144 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
145 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
146 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
147 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
148 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
149 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
150 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
151 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
152 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
153 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
154 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
155 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
156 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
157 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
158 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
159 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
160 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
161 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
162 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
163 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
164 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
165 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
166 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
167 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
168 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
169 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
170 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
171 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
172 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
173 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
174 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
175 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
176 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
177 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
178 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
179 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
180 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
181 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
182 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
183 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
184 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
185 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
186 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
187 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
188 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
189 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
190 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
191 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
192 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
193 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
194 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
195 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
196 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
197 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
198 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
199 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
200 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
201 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
202 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
203 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
204 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
205 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
206 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
207 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
208 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
209 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
210 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
211 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
212 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
213 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
214 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
215 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
216 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
217 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
218 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
219 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
220 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
221 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
222 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
223 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
224 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
225 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
226 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
227 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
228 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
229 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
230 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
231 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
232 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
233 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
234 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
235 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
236 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
237 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
238 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
239 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
240 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
241 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
242 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
243 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
244 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
245 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
246 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
247 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
248 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
249 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
250 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
251 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
252 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
253 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
254 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
255 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
256 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
257 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
258 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
259 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
260 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
261 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
262 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
263 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
264 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
265 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
266 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
267 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
268 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
275 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
281 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
282 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
283 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
284 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
285 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
286 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
287 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
288 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
289 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
290 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
291 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
292 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
293 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
294 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
295 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
296 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
297 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
299 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
300 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
301 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
302 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
303 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
304 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
305 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
306 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
307 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
308 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
309 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
310 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
311 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
312 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
313 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
314 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
315 2554235227 Arthrobacter sp. PAO19 Isolate Rhizosphere
316 2643221617 Nocardioides sp. Root79 Isolate Unclassified
317 2643221620 Nocardioides sp. Root240 Isolate Unclassified
318 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
319 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
320 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
321 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
322 2654587600 Glutamicibacter halophytocola KLBMP5180 Isolate Unclassified
323 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
324 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
325 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
326 2738541305 Nocardioides sp. CF167 Isolate Unclassified
327 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
328 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
329 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
330 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
331 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
332 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
333 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
334 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
335 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
336 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
337 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
338 2857733635 Salinibacterium sp. R-73062 Isolate Unclassified
339 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
340 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
341 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
342 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
343 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
344 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
345 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
346 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
347 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
348 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
349 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
350 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
351 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
352 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
353 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
354 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
355 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
356 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
357 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
358 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
359 2946024296 Arthrobacter woluwensis W4I2 Isolate Rhizosphere
360 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
361 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
362 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
363 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
364 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
365 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere
366 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere
367 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 84.15
Metatranscriptomes 7.7
Isolates 8.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.15
Nodule 0
Rhizoplane 5.33
Rhizosphere 82.37
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_101302126 3300005329 Bacteria 698
2 LJQas_1001861 3300000549 Bacteria 3066
3 JGI25154J39366_1001884 3300002738 Bacteria 6348
4 JGI25152J39213_1000699 3300002773 Bacteria 17424
5 JGI25151J46595_10014226 3300003187 Bacteria 3551
6 Ga0007423J48922_100411 3300003285 Bacteria 4246
7 rootH2_10102474 3300003320 Bacteria 4466
8 rootL2_10098251 3300003322 Bacteria 2365
9 Ga0055542_1008770 3300003762 Bacteria 1954
10 Ga0065714_10012531 3300005288 Bacteria 1795
11 Ga0065714_10028910 3300005288 Bacteria 1319
12 Ga0065714_10180273 3300005288 Bacteria 966
13 Ga0065714_10459246 3300005288 Bacteria 548
14 Ga0065712_10418429 3300005290 Bacteria 714
15 Ga0070658_10002673 3300005327 Bacteria 14824
16 Ga0070658_11023918 3300005327 Bacteria 718
17 Ga0070676_10016654 3300005328 Bacteria 4064
18 Ga0070683_101152629 3300005329 Bacteria 745
19 Ga0070670_100122935 3300005331 Bacteria 2239
20 Ga0070670_100502808 3300005331 Bacteria 1078
21 Ga0070670_101339628 3300005331 Bacteria 656
22 Ga0070677_10302909 3300005333 Bacteria 813
23 Ga0068869_101161801 3300005334 Bacteria 677
24 Ga0070666_10060676 3300005335 Bacteria 2560
25 Ga0070680_100000562 3300005336 Bacteria 25410
26 Ga0070682_101271143 3300005337 Bacteria 624
27 Ga0068868_101192750 3300005338 Bacteria 704
28 Ga0070660_101846103 3300005339 Bacteria 515
29 Ga0070691_10250134 3300005341 Bacteria 950
30 Ga0070668_100009104 3300005347 Bacteria 7374
31 Ga0070668_101894106 3300005347 Bacteria 549
32 Ga0070669_100013316 3300005353 Bacteria 5846
33 Ga0070675_100007446 3300005354 Bacteria 8455
34 Ga0070675_100687832 3300005354 Bacteria 931
35 Ga0070675_101696891 3300005354 Bacteria 583
36 Ga0070671_100042471 3300005355 Bacteria 3779
37 Ga0070674_100035159 3300005356 Bacteria 3353
38 Ga0070674_100502284 3300005356 Bacteria 1010
39 Ga0070673_100033825 3300005364 Bacteria 3863
40 Ga0070673_102404617 3300005364 Bacteria 501
41 Ga0070667_100099808 3300005367 Bacteria 2506
42 Ga0070667_100438714 3300005367 Bacteria 1192
43 Ga0070663_101558454 3300005455 Bacteria 588
44 Ga0070678_100622835 3300005456 Bacteria 965
45 Ga0070678_102327249 3300005456 Bacteria 509
46 Ga0070681_10009608 3300005458 Bacteria 9510
47 Ga0068867_100767491 3300005459 Bacteria 857
48 Ga0070698_100416286 3300005471 Bacteria 1278
49 Ga0070679_100006807 3300005530 Bacteria 10659
50 Ga0070684_101256214 3300005535 Bacteria 697
51 Ga0070672_100670716 3300005543 Bacteria 906
52 Ga0070686_101338120 3300005544 Bacteria 599
53 Ga0070693_100500375 3300005547 Bacteria 862
54 Ga0070665_100626149 3300005548 Bacteria 1089
55 Ga0068854_101286465 3300005578 Bacteria 658
56 Ga0070702_100272361 3300005615 Bacteria 1158
57 Ga0068852_101202969 3300005616 Bacteria 779
58 Ga0068864_102451828 3300005618 Bacteria 528
59 Ga0068870_10835503 3300005840 Bacteria 646
60 Ga0068863_102742216 3300005841 Bacteria 501
61 Ga0075364_10018264 3300006051 Bacteria 4389
62 Ga0075364_10588621 3300006051 Bacteria 760
63 Ga0075432_10007469 3300006058 Bacteria 3723
64 Ga0075432_10022995 3300006058 Bacteria 2134
65 Ga0070716_100495307 3300006173 Bacteria 900
66 Ga0075367_10313619 3300006178 Bacteria 988
67 Ga0075370_10403873 3300006353 Bacteria 820
68 Ga0105251_10016596 3300009011 Bacteria 3972
69 Ga0105244_10037935 3300009036 Bacteria 2515
70 Ga0105244_10093429 3300009036 Bacteria 1478
71 Ga0105244_10262918 3300009036 Bacteria 803
72 Ga0105244_10370857 3300009036 Bacteria 659
73 Ga0105250_10315165 3300009092 Bacteria 679
74 Ga0111539_12819468 3300009094 Bacteria 563
75 Ga0105245_12224497 3300009098 Bacteria 602
76 Ga0105247_10357605 3300009101 Bacteria 1029
77 Ga0114129_10427944 3300009147 Bacteria 1740
78 Ga0105243_10098409 3300009148 Bacteria 2423
79 Ga0105243_10183438 3300009148 Bacteria 1822
80 Ga0105243_11326445 3300009148 Bacteria 738
81 Ga0105241_11289395 3300009174 Bacteria 695
82 Ga0105242_10962490 3300009176 Bacteria 858
83 Ga0105242_13007075 3300009176 Bacteria 522
84 Ga0105248_10639010 3300009177 Bacteria 1201
85 Ga0105248_12194008 3300009177 Bacteria 628
86 Ga0105249_11511651 3300009553 Bacteria 744
87 Ga0105249_13169368 3300009553 Bacteria 529
88 Ga0105239_13349103 3300010375 Bacteria 521
89 Ga0105246_10030340 3300011119 Bacteria 3569
90 Ga0105246_10117506 3300011119 Bacteria 1965
91 Ga0105246_10180153 3300011119 Bacteria 1626
92 Ga0105246_10309427 3300011119 Bacteria 1279
93 Ga0105246_10939560 3300011119 Bacteria 778
94 Ga0105246_11677652 3300011119 Bacteria 603
95 Ga0157373_10020911 3300013100 Bacteria 4751
96 Ga0157373_10308650 3300013100 Bacteria 1124
97 Ga0157371_10140745 3300013102 Bacteria 1718
98 Ga0157371_11132812 3300013102 Bacteria 601
99 Ga0157370_10362592 3300013104 Bacteria 1335
100 Ga0157370_11717862 3300013104 Bacteria 563
101 Ga0157369_10273612 3300013105 Bacteria 1759
102 Ga0157369_10580811 3300013105 Bacteria 1157
103 Ga0163162_10816102 3300013306 Bacteria 1049
104 Ga0163162_10985751 3300013306 Bacteria 952
105 Ga0163162_12085424 3300013306 Bacteria 650
106 Ga0157375_11061904 3300013308 Bacteria 947
107 Ga0157375_11204517 3300013308 Bacteria 888
108 Ga0163163_10860562 3300014325 Bacteria 970
109 Ga0163163_12172408 3300014325 Bacteria 614
110 Ga0157380_11431767 3300014326 Bacteria 742
111 Ga0157380_12085412 3300014326 Bacteria 630
112 Ga0182008_10325833 3300014497 Bacteria 809
113 Ga0157377_11334236 3300014745 Bacteria 562
114 Ga0157379_10985051 3300014968 Bacteria 803
115 Ga0157376_12767755 3300014969 Bacteria 530
116 Ga0182006_1286783 3300015261 Bacteria 540
117 Ga0163161_10501864 3300017792 Bacteria 988
118 Ga0163161_11758811 3300017792 Bacteria 550
119 Ga0197907_10539174 3300020069 Bacteria 2411
120 Ga0206349_1746741 3300020075 Bacteria 1597
121 Ga0206354_10001086 3300020081 Bacteria 591
122 Ga0206354_11451704 3300020081 Bacteria 2671
123 Ga0206353_11470244 3300020082 Bacteria 6212
124 Ga0206353_11934036 3300020082 Bacteria 735
125 Ga0209148_1013241 3300025254 Bacteria 1487
126 Ga0209129_1000959 3300025258 Bacteria 17384
127 Ga0209025_1000279 3300025294 Bacteria 116352
128 Ga0209051_1008200 3300025303 Bacteria 5565
129 Ga0207697_10012933 3300025315 Bacteria 3488
130 Ga0207697_10031182 3300025315 Bacteria 2181
131 Ga0207655_1010844 3300025728 Bacteria 5489
132 Ga0207655_1022278 3300025728 Bacteria 3183
133 Ga0207655_1045256 3300025728 Bacteria 1840
134 Ga0207655_1071885 3300025728 Bacteria 1281
135 Ga0207688_10161444 3300025901 Bacteria 1329
136 Ga0207680_10396937 3300025903 Bacteria 974
137 Ga0207645_10008525 3300025907 Bacteria 7145
138 Ga0207705_10008528 3300025909 Bacteria 7474
139 Ga0207707_10000393 3300025912 Bacteria 45647
140 Ga0207660_10000423 3300025917 Bacteria 27874
141 Ga0207657_11238464 3300025919 Bacteria 566
142 Ga0207652_10000455 3300025921 Bacteria 42150
143 Ga0207681_10180776 3300025923 Bacteria 1606
144 Ga0207650_10044742 3300025925 Bacteria 3254
145 Ga0207650_11750536 3300025925 Bacteria 526
146 Ga0207659_10027636 3300025926 Bacteria 3844
147 Ga0207687_10568371 3300025927 Bacteria 953
148 Ga0207644_10153592 3300025931 Bacteria 1783
149 Ga0207709_10019809 3300025935 Bacteria 3787
150 Ga0207709_10649836 3300025935 Bacteria 840
151 Ga0207709_11421690 3300025935 Bacteria 575
152 Ga0207669_10242588 3300025937 Bacteria 1337
153 Ga0207669_10949562 3300025937 Bacteria 720
154 Ga0207691_10005146 3300025940 Bacteria 12627
155 Ga0207691_10220504 3300025940 Bacteria 1645
156 Ga0207711_10305540 3300025941 Bacteria 1468
157 Ga0207689_10942912 3300025942 Bacteria 728
158 Ga0207661_11919617 3300025944 Bacteria 538
159 Ga0207679_11100990 3300025945 Bacteria 729
160 Ga0207651_10072359 3300025960 Bacteria 2447
161 Ga0207651_11977036 3300025960 Bacteria 524
162 Ga0207651_12034986 3300025960 Bacteria 516
163 Ga0207668_10010350 3300025972 Bacteria 5635
164 Ga0207658_10256906 3300025986 Bacteria 1487
165 Ga0207677_11473694 3300026023 Bacteria 628
166 Ga0207677_11882856 3300026023 Bacteria 556
167 Ga0207678_10411690 3300026067 Bacteria 1171
168 Ga0207648_10578687 3300026089 Bacteria 1033
169 Ga0207676_10946211 3300026095 Bacteria 847
170 Ga0207683_10014776 3300026121 Bacteria 6646
171 Ga0207683_11859990 3300026121 Bacteria 551
172 Ga0209974_10322793 3300027876 Bacteria 595
173 Ga0207428_10031917 3300027907 Bacteria 4338
174 Ga0268266_11106594 3300028379 Bacteria 766
175 Ga0316182_1255603 3300030745 Bacteria 746
176 Ga0307408_100017746 3300031548 Bacteria 4768
177 Ga0307408_100171974 3300031548 Bacteria 1730
178 Ga0307408_100183116 3300031548 Bacteria 1681
179 Ga0307408_100251664 3300031548 Bacteria 1457
180 Ga0307408_100381115 3300031548 Bacteria 1205
181 Ga0307408_100388099 3300031548 Bacteria 1195
182 Ga0307408_100393692 3300031548 Bacteria 1188
183 Ga0307408_100853274 3300031548 Bacteria 830
184 Ga0307408_100920339 3300031548 Bacteria 801
185 Ga0307408_101442822 3300031548 Bacteria 649
186 Ga0307408_101819009 3300031548 Bacteria 582
187 Ga0307514_10002541 3300031649 Bacteria 18815
188 Ga0307405_10029359 3300031731 Bacteria 3214
189 Ga0307405_10063841 3300031731 Bacteria 2337
190 Ga0307405_10129543 3300031731 Bacteria 1741
191 Ga0307405_10184973 3300031731 Bacteria 1499
192 Ga0307405_10188495 3300031731 Bacteria 1487
193 Ga0307405_10278668 3300031731 Bacteria 1257
194 Ga0307405_10445508 3300031731 Bacteria 1025
195 Ga0307405_10523743 3300031731 Bacteria 954
196 Ga0307405_10593691 3300031731 Bacteria 903
197 Ga0307405_10676862 3300031731 Bacteria 852
198 Ga0307405_11531878 3300031731 Bacteria 586
199 Ga0307413_10029754 3300031824 Bacteria 3060
200 Ga0307413_10129464 3300031824 Bacteria 1724
201 Ga0307413_10136666 3300031824 Bacteria 1686
202 Ga0307413_10182766 3300031824 Bacteria 1497
203 Ga0307413_10244033 3300031824 Bacteria 1328
204 Ga0307413_11561951 3300031824 Bacteria 585
205 Ga0307413_12197066 3300031824 Bacteria 500
206 Ga0307410_10005249 3300031852 Bacteria 6828
207 Ga0307410_10016758 3300031852 Bacteria 4380
208 Ga0307410_10040383 3300031852 Bacteria 3070
209 Ga0307410_10137033 3300031852 Bacteria 1805
210 Ga0307410_10228049 3300031852 Bacteria 1436
211 Ga0307410_10298894 3300031852 Bacteria 1269
212 Ga0307410_10354028 3300031852 Bacteria 1174
213 Ga0307410_10483039 3300031852 Bacteria 1016
214 Ga0307410_10501819 3300031852 Bacteria 998
215 Ga0307410_10587320 3300031852 Bacteria 927
216 Ga0307410_12072155 3300031852 Bacteria 508
217 Ga0307406_10006012 3300031901 Bacteria 6663
218 Ga0307406_10052875 3300031901 Bacteria 2585
219 Ga0307406_10180900 3300031901 Bacteria 1535
220 Ga0307406_10605242 3300031901 Bacteria 904
221 Ga0307406_11028149 3300031901 Bacteria 708
222 Ga0307406_11320486 3300031901 Bacteria 630
223 Ga0307406_11952789 3300031901 Bacteria 524
224 Ga0307407_10014783 3300031903 Bacteria 3834
225 Ga0307407_10048235 3300031903 Bacteria 2422
226 Ga0307407_10079056 3300031903 Bacteria 1983
227 Ga0307407_10167397 3300031903 Bacteria 1444
228 Ga0307407_10257613 3300031903 Bacteria 1198
229 Ga0307407_10291745 3300031903 Bacteria 1134
230 Ga0307407_10341559 3300031903 Bacteria 1057
231 Ga0307407_10500149 3300031903 Bacteria 891
232 Ga0307407_10553126 3300031903 Bacteria 851
233 Ga0307407_10842184 3300031903 Bacteria 700
234 Ga0307407_11192369 3300031903 Bacteria 594
235 Ga0307407_11602499 3300031903 Bacteria 517
236 Ga0307412_10020631 3300031911 Bacteria 4013
237 Ga0307412_10026647 3300031911 Bacteria 3595
238 Ga0307412_10073957 3300031911 Bacteria 2333
239 Ga0307412_10104216 3300031911 Bacteria 2012
240 Ga0307412_10164914 3300031911 Bacteria 1651
241 Ga0307412_10242616 3300031911 Bacteria 1394
242 Ga0307412_10244763 3300031911 Bacteria 1389
243 Ga0307412_10544818 3300031911 Bacteria 973
244 Ga0307412_10585712 3300031911 Bacteria 942
245 Ga0307412_10687793 3300031911 Bacteria 876
246 Ga0307412_10901541 3300031911 Bacteria 775
247 Ga0307412_10904814 3300031911 Bacteria 774
248 Ga0307412_11069230 3300031911 Bacteria 716
249 Ga0307412_11959274 3300031911 Bacteria 541
250 Ga0307409_100004028 3300031995 Bacteria 8158
251 Ga0307409_100038616 3300031995 Bacteria 3533
252 Ga0307409_100138123 3300031995 Bacteria 2095
253 Ga0307409_100300781 3300031995 Bacteria 1492
254 Ga0307409_100438733 3300031995 Bacteria 1257
255 Ga0307409_100473893 3300031995 Bacteria 1213
256 Ga0307409_100526584 3300031995 Bacteria 1156
257 Ga0307409_100683282 3300031995 Bacteria 1024
258 Ga0307409_100892071 3300031995 Bacteria 902
259 Ga0307409_101158627 3300031995 Bacteria 795
260 Ga0307409_101295748 3300031995 Bacteria 753
261 Ga0307409_101332307 3300031995 Bacteria 743
262 Ga0307409_101800033 3300031995 Bacteria 641
263 Ga0307416_100006982 3300032002 Bacteria 7119
264 Ga0307416_100022613 3300032002 Bacteria 4541
265 Ga0307416_100041030 3300032002 Bacteria 3601
266 Ga0307416_100047094 3300032002 Bacteria 3409
267 Ga0307416_100402108 3300032002 Bacteria 1407
268 Ga0307416_100536939 3300032002 Bacteria 1240
269 Ga0307416_100773165 3300032002 Bacteria 1054
270 Ga0307416_101871787 3300032002 Bacteria 703
271 Ga0307414_10040954 3300032004 Bacteria 3133
272 Ga0307414_10051886 3300032004 Bacteria 2850
273 Ga0307414_10134527 3300032004 Bacteria 1925
274 Ga0307414_10492564 3300032004 Bacteria 1083
275 Ga0307414_10663957 3300032004 Bacteria 941
276 Ga0307414_11373546 3300032004 Bacteria 656
277 Ga0307414_11648436 3300032004 Bacteria 598
278 Ga0307414_11692806 3300032004 Bacteria 590
279 Ga0307411_10011696 3300032005 Bacteria 4751
280 Ga0307411_10042495 3300032005 Bacteria 2900
281 Ga0307411_10186814 3300032005 Bacteria 1578
282 Ga0307411_10258796 3300032005 Bacteria 1373
283 Ga0307411_10705693 3300032005 Bacteria 879
284 Ga0307415_100066918 3300032126 Bacteria 2509
285 Ga0307415_100136294 3300032126 Bacteria 1867
286 Ga0307415_100330564 3300032126 Bacteria 1275
287 Ga0307415_100428296 3300032126 Bacteria 1137
288 Ga0307415_101129669 3300032126 Bacteria 735
289 Ga0395899_0022969 3300037312 Bacteria 4725
290 Ga0395899_0160624 3300037312 Bacteria 1588
291 Ga0395899_0223139 3300037312 Bacteria 1304
292 Ga0395900_0029820 3300037418 Bacteria 5599
293 Ga0395900_0166859 3300037418 Bacteria 2243
294 Ga0395898_0140123 3300037466 Bacteria 2315
295 Ga0395898_0259807 3300037466 Bacteria 1656
296 Ga0395905_0305191 3300037471 Bacteria 1480
297 Ga0395905_0444137 3300037471 Bacteria 1195
298 Ga0395901_0191553 3300038443 Bacteria 2144
299 Ga0395901_0193532 3300038443 Bacteria 2132
300 Ga0439436_0001792 3300041404 Bacteria 6323
301 Ga0439436_0021675 3300041404 Bacteria 1906
302 Ga0439436_0075642 3300041404 Bacteria 938
303 Ga0439438_002550 3300041405 Bacteria 7725
304 Ga0439438_011166 3300041405 Bacteria 2808
305 Ga0439438_014609 3300041405 Bacteria 2333
306 Ga0439439_0001899 3300041406 Bacteria 4315
307 Ga0439439_0040040 3300041406 Bacteria 1212
308 Ga0439447_124939 3300041407 Bacteria 590
309 Ga0439461_0000878 3300041410 Bacteria 4459
310 Ga0439461_0020215 3300041410 Bacteria 1316
311 Ga0439466_0019657 3300041411 Bacteria 2416
312 Ga0439466_0057632 3300041411 Bacteria 1258
313 Ga0439466_0075617 3300041411 Bacteria 1067
314 Ga0439465_0004976 3300041413 Bacteria 4269
315 Ga0439465_0101564 3300041413 Bacteria 993
316 Ga0451789_0429320 3300041443 Bacteria 535
317 Ga0451789_0802992 3300041443 Bacteria 619
318 Ga0451791_1536256 3300041451 Bacteria 2998
319 Ga0451793_1081233 3300041452 Bacteria 1199
320 Ga0451797_0486614 3300041453 Bacteria 756
321 Ga0451797_1348702 3300041453 Bacteria 2237
322 Ga0451800_0637619 3300041459 Bacteria 637
323 Ga0451833_0331633 3300041491 Bacteria 954
324 Ga0451837_1062277 3300041494 Bacteria 664
325 Ga0451837_1738886 3300041494 Bacteria 742
326 Ga0451839_0828930 3300041496 Bacteria 571
327 Ga0451841_0476654 3300041498 Bacteria 621
328 Ga0451841_0893907 3300041498 Bacteria 542
329 Ga0451853_1425610 3300041512 Bacteria 643
330 Ga0451853_2357515 3300041512 Bacteria 685
331 Ga0439433_0001105 3300041999 Bacteria 5502
332 Ga0439433_0001287 3300041999 Bacteria 5176
333 Ga0439442_000195 3300042002 Bacteria 15453
334 Ga0439442_000422 3300042002 Bacteria 9784
335 Ga0439442_000423 3300042002 Bacteria 9742
336 Ga0439442_000726 3300042002 Bacteria 6904
337 Ga0439442_002475 3300042002 Bacteria 3625
338 Ga0439442_011960 3300042002 Bacteria 1771
339 Ga0439432_001112 3300042006 Bacteria 10220
340 Ga0439432_155712 3300042006 Bacteria 670
341 Ga0439449_0001098 3300042007 Bacteria 10657
342 Ga0439449_0022849 3300042007 Bacteria 2340
343 Ga0439449_0119881 3300042007 Bacteria 976
344 Ga0439452_003001 3300042010 Bacteria 5996
345 Ga0439452_119855 3300042010 Bacteria 560
346 Ga0439454_022327 3300042011 Bacteria 942
347 Ga0439457_000519 3300042014 Bacteria 11170
348 Ga0439457_004433 3300042014 Bacteria 3657
349 Ga0439457_115735 3300042014 Bacteria 631
350 Ga0439462_0003822 3300042015 Bacteria 3635
351 Ga0439462_0046725 3300042015 Bacteria 1160
352 Ga0450911_017806 3300042115 Bacteria 934
353 Ga0450911_030911 3300042115 Bacteria 694
354 Ga0450911_057738 3300042115 Bacteria 504
355 Ga0450919_000441 3300042121 Bacteria 5137
356 Ga0450919_018990 3300042121 Bacteria 776
357 Ga0450920_000421 3300042122 Bacteria 6629
358 Ga0450920_009929 3300042122 Bacteria 1759
359 Ga0450920_030970 3300042122 Bacteria 1053
360 Ga0450906_022257 3300042145 Bacteria 1130
361 Ga0450907_001343 3300042146 Bacteria 5436
362 Ga0450907_007759 3300042146 Bacteria 1788
363 Ga0450907_010864 3300042146 Bacteria 1512
364 Ga0450910_007695 3300042147 Bacteria 1506
365 Ga0439446_0004241 3300042156 Bacteria 3622
366 Ga0439446_0033335 3300042156 Bacteria 1496
367 Ga0439446_0048084 3300042156 Bacteria 1270
368 Ga0450908_010618 3300042184 Bacteria 1696
369 Ga0450908_026491 3300042184 Bacteria 1012
370 Ga0450909_000709 3300042185 Bacteria 4470
371 Ga0450909_010590 3300042185 Bacteria 1349
372 Ga0439434_0002025 3300042435 Bacteria 5858
373 Ga0439434_0026347 3300042435 Bacteria 1756
374 Ga0450918_000561 3300042531 Bacteria 7923
375 Ga0450918_002567 3300042531 Bacteria 3432
376 Ga0466966_0129264 3300044684 Bacteria 1548
377 Ga0466970_0336873 3300044765 Bacteria 855
378 Ga0466967_2543936 3300045976 Bacteria 507
379 Ga0495603_0433635 3300046455 Bacteria 753
380 Ga0495603_0747905 3300046455 Bacteria 558
381 Ga0495629_0308847 3300046459 Bacteria 1082
382 Ga0495629_0542185 3300046459 Bacteria 781
383 Ga0495653_0347605 3300046463 Bacteria 954
384 Ga0495580_0004725 3300046472 Bacteria 11412
385 Ga0495582_0055289 3300046473 Bacteria 2188
386 Ga0495582_0158591 3300046473 Bacteria 1286
387 Ga0495582_0460452 3300046473 Bacteria 734
388 Ga0495639_0104244 3300046475 Bacteria 1341
389 Ga0495639_0106834 3300046475 Bacteria 1325
390 Ga0495662_0069874 3300046476 Bacteria 1701
391 Ga0495662_0578880 3300046476 Bacteria 549
392 Ga0495664_0008177 3300046477 Bacteria 5827
393 Ga0495594_0372692 3300046499 Bacteria 812
394 Ga0495583_0307896 3300046506 Bacteria 629
395 Ga0495606_0049620 3300046507 Bacteria 2751
396 Ga0495610_0191134 3300046512 Bacteria 845
397 Ga0495630_0029446 3300046517 Bacteria 4083
398 Ga0495631_0080220 3300046518 Bacteria 1408
399 Ga0495663_0155479 3300046525 Bacteria 782
400 Ga0495642_0256546 3300046528 Bacteria 764
401 Ga0495665_0000213 3300046531 Bacteria 29388
402 Ga0495665_0068424 3300046531 Bacteria 1872
403 Ga0495586_0000799 3300046535 Bacteria 18101
404 Ga0495586_0008514 3300046535 Bacteria 5458
405 Ga0495586_0102208 3300046535 Bacteria 1591
406 Ga0495587_0001081 3300046536 Bacteria 17885
407 Ga0495598_0308332 3300046537 Bacteria 600
408 Ga0495645_0053475 3300046543 Bacteria 2935
409 Ga0495645_0808218 3300046543 Bacteria 562
410 Ga0495633_0071426 3300046558 Bacteria 1619
411 Ga0495667_0000881 3300046559 Bacteria 19386
412 Ga0495656_0297201 3300046615 Bacteria 827
413 Ga0495656_0564118 3300046615 Bacteria 607
414 Ga0495668_0099901 3300046616 Bacteria 1587
415 Ga0495668_0425710 3300046616 Bacteria 730
416 Ga0495634_0766172 3300046642 Bacteria 552
417 Ga0495659_0422368 3300046664 Bacteria 577
418 Ga0495588_0017340 3300046674 Bacteria 3494
419 Ga0495588_0055707 3300046674 Bacteria 2040
420 Ga0495657_0048249 3300046675 Bacteria 2874
421 Ga0495623_0035811 3300046679 Bacteria 3181
422 Ga0495613_0441012 3300046689 Bacteria 883
423 Ga0495670_0287746 3300046691 Bacteria 879
424 Ga0495670_0432194 3300046691 Bacteria 712
425 Ga0495600_0005908 3300046809 Bacteria 7404
426 Ga0495600_0184068 3300046809 Bacteria 1345
427 Ga0495600_0550116 3300046809 Bacteria 705
428 Ga0495581_0010766 3300047315 Bacteria 5289
429 Ga0495581_0023935 3300047315 Bacteria 3538
430 Ga0495581_0290292 3300047315 Bacteria 956
431 Ga0495604_0170664 3300047317 Bacteria 1530
432 Ga0495636_0016153 3300047318 Bacteria 2979
433 Ga0495636_0353724 3300047318 Bacteria 694
434 Ga0495680_0229448 3300047322 Bacteria 1322
435 Ga0495680_0796520 3300047322 Bacteria 617
436 Ga0495675_0001025 3300047444 Bacteria 16974
437 Ga0495677_0102207 3300047445 Bacteria 1086
438 Ga0495677_0124247 3300047445 Bacteria 985
439 Ga0495685_080776 3300047447 Bacteria 1083
440 Ga0495684_0107891 3300047471 Bacteria 2103
441 Ga0495684_0602599 3300047471 Bacteria 741
442 Ga0495686_0246027 3300047472 Bacteria 1007
443 Ga0495593_0081061 3300047673 Bacteria 1678
444 Ga0495593_0250659 3300047673 Bacteria 886
445 Ga0495615_0005275 3300048090 Bacteria 2314
446 Ga0496100_0470532 3300048903 Bacteria 965
447 Ga0496101_0668310 3300048904 Bacteria 821
448 Ga0496101_1199694 3300048904 Bacteria 595
449 Ga0496102_0451770 3300048905 Bacteria 1205
450 Ga0496103_0161178 3300048906 Bacteria 1438
451 Ga0496103_0420813 3300048906 Bacteria 857
452 Ga0496104_0791466 3300048907 Bacteria 854
453 Ga0496106_0380491 3300048909 Bacteria 1134
454 Ga0496106_0551093 3300048909 Bacteria 925
455 Ga0496107_0114214 3300048910 Bacteria 1987
456 Ga0496108_1028509 3300048911 Bacteria 702
457 Ga0496108_1753775 3300048911 Bacteria 510
458 Ga0496109_0055681 3300048912 Bacteria 3607
459 Ga0496110_0074021 3300048913 Bacteria 3024
460 Ga0496110_0398610 3300048913 Bacteria 1254
461 Ga0496110_0670242 3300048913 Bacteria 938
462 Ga0496111_0007283 3300048914 Bacteria 7241
463 Ga0496111_0102145 3300048914 Bacteria 2107
464 Ga0496111_0237923 3300048914 Bacteria 1352
465 Ga0496112_0046000 3300048915 Bacteria 4279
466 Ga0496112_0096230 3300048915 Bacteria 2931
467 Ga0496112_0107643 3300048915 Bacteria 2758
468 Ga0496112_0643752 3300048915 Bacteria 990
469 Ga0496113_0453443 3300048916 Bacteria 1030
470 Ga0496113_0539999 3300048916 Bacteria 935
471 Ga0496113_0663019 3300048916 Bacteria 834
472 Ga0496113_0870945 3300048916 Bacteria 713
473 Ga0496114_0121715 3300048917 Bacteria 2244
474 Ga0496115_0072037 3300048918 Bacteria 2803
475 Ga0496117_0238874 3300048920 Bacteria 999
476 Ga0496118_0047967 3300048921 Bacteria 3305
477 Ga0496118_0153728 3300048921 Bacteria 1435
478 Ga0496119_0025815 3300048922 Bacteria 4093
479 Ga0496119_0035575 3300048922 Bacteria 3261
480 Ga0496119_0111896 3300048922 Bacteria 1514
481 Ga0496119_0283993 3300048922 Bacteria 822
482 Ga0496122_0000646 3300048925 Bacteria 70740
483 Ga0496123_0000405 3300048926 Bacteria 79019
484 Ga0496124_0001857 3300048927 Bacteria 29169
485 Ga0496124_0115506 3300048927 Bacteria 2153
486 Ga0496124_0185981 3300048927 Bacteria 1594
487 Ga0496125_0001474 3300048928 Bacteria 34047
488 Ga0496125_0151462 3300048928 Bacteria 1592
489 Ga0496126_0234679 3300048929 Bacteria 1535
490 Ga0496126_0554651 3300048929 Bacteria 911
491 Ga0496126_0850010 3300048929 Bacteria 696
492 Ga0501306_002667 3300049127 Bacteria 1856
493 Ga0501306_006234 3300049127 Bacteria 1393
494 Ga0501308_009834 3300049128 Bacteria 1052
495 Ga0501308_027315 3300049128 Bacteria 749
496 Ga0501308_034376 3300049128 Bacteria 692
497 Ga0501309_012195 3300049129 Bacteria 1129
498 Ga0501310_023399 3300049130 Bacteria 786
499 Ga0501310_052602 3300049130 Bacteria 592
500 Ga0501304_005082 3300049160 Bacteria 1021
501 Ga0501304_040227 3300049160 Bacteria 521
502 Ga0501305_012741 3300049161 Bacteria 1154
503 Ga0501311_017470 3300049527 Bacteria 944
504 Ga0501311_018031 3300049527 Bacteria 935
505 Ga0501311_064289 3300049527 Bacteria 598
506 Ga0501312_013283 3300049528 Bacteria 1143
507 Ga0501313_002958 3300049529 Bacteria 1651
508 Ga0501313_020731 3300049529 Bacteria 811
509 Ga0501314_043607 3300049530 Bacteria 528
510 Ga0501315_019255 3300049531 Bacteria 907
511 Ga0501315_025297 3300049531 Bacteria 826
512 Ga0501315_037416 3300049531 Bacteria 723
513 Ga0501316_032865 3300049532 Bacteria 700
514 Ga0501317_001276 3300049533 Bacteria 2130
515 Ga0501317_035152 3300049533 Bacteria 744
516 Ga0501317_041526 3300049533 Bacteria 704
517 Ga0501317_049249 3300049533 Bacteria 665
518 Ga0501317_108027 3300049533 Bacteria 509
519 Ga0501318_021527 3300049534 Bacteria 820
520 Ga0501318_051739 3300049534 Bacteria 612
521 Ga0501319_012634 3300049535 Bacteria 693
522 Ga0501319_022237 3300049535 Bacteria 574
523 Ga0501320_006767 3300049536 Bacteria 1085
524 Ga0501321_077493 3300049537 Bacteria 526
525 Ga0501321_079216 3300049537 Bacteria 522
526 Ga0501321_088798 3300049537 Bacteria 502
527 Ga0501323_003639 3300049539 Bacteria 1587
528 Ga0501323_031027 3300049539 Bacteria 751
529 Ga0501324_003617 3300049540 Bacteria 1194
530 Ga0501325_044567 3300049541 Bacteria 549
531 Ga0501336_031130 3300049552 Bacteria 525
532 Ga0501340_002030 3300049556 Bacteria 1145
533 Ga0501032_0001361 3300049569 Bacteria 19395
534 Ga0501032_0010838 3300049569 Bacteria 6560
535 Ga0501032_0484173 3300049569 Bacteria 791
536 Ga0501032_1032075 3300049569 Bacteria 516
537 Ga0501033_0216061 3300049570 Bacteria 1366
538 Ga0501033_0251901 3300049570 Bacteria 1251
539 Ga0501034_0014274 3300049571 Bacteria 8185
540 Ga0501034_0049401 3300049571 Bacteria 4244
541 Ga0501034_0073598 3300049571 Bacteria 3425
542 Ga0501034_0132871 3300049571 Bacteria 2471
543 Ga0501036_0572058 3300049572 Bacteria 938
544 Ga0501036_0811226 3300049572 Bacteria 770
545 Ga0501036_1031949 3300049572 Bacteria 673
546 Ga0501037_0058769 3300049573 Bacteria 2805
547 Ga0501037_0152158 3300049573 Bacteria 1653
548 Ga0501038_0013254 3300049574 Bacteria 7518
549 Ga0501038_0088062 3300049574 Bacteria 2606
550 Ga0501038_0110531 3300049574 Bacteria 2277
551 Ga0501039_0138097 3300049575 Bacteria 1914
552 Ga0501039_0516129 3300049575 Bacteria 938
553 Ga0501039_0664115 3300049575 Bacteria 816
554 Ga0501039_0727091 3300049575 Bacteria 776
555 Ga0501040_1119129 3300049576 Bacteria 571
556 Ga0501043_0009011 3300049579 Bacteria 7852
557 Ga0501043_0022650 3300049579 Bacteria 4925
558 Ga0501043_0046870 3300049579 Bacteria 3399
559 Ga0501043_0178150 3300049579 Bacteria 1657
560 Ga0501046_0112725 3300049580 Bacteria 2076
561 Ga0501046_0115637 3300049580 Bacteria 2045
562 Ga0501047_0003410 3300049581 Bacteria 15048
563 Ga0501047_0103158 3300049581 Bacteria 2732
564 Ga0501047_0505229 3300049581 Bacteria 1035
565 Ga0501048_0141180 3300049582 Bacteria 1703
566 Ga0501067_0141651 3300049583 Bacteria 1339
567 Ga0501068_1064664 3300049584 Bacteria 534
568 Ga0501069_0068350 3300049585 Bacteria 1988
569 Ga0501069_0679020 3300049585 Bacteria 621
570 Ga0501070_0002817 3300049586 Bacteria 15182
571 Ga0501070_0184951 3300049586 Bacteria 1714
572 Ga0501070_0590210 3300049586 Bacteria 886
573 Ga0501071_0000388 3300049587 Bacteria 21660
574 Ga0501072_1193403 3300049588 Bacteria 591
575 Ga0501073_0023868 3300049589 Bacteria 4391
576 Ga0501073_0798663 3300049589 Bacteria 650
577 Ga0501074_0228728 3300049590 Bacteria 1324
578 Ga0501075_0747716 3300049591 Bacteria 744
579 Ga0501077_0055826 3300049593 Bacteria 2508
580 Ga0501198_080568 3300049649 Bacteria 630
581 Ga0501249_169344 3300049679 Bacteria 559
582 Ga0501225_0077573 3300049705 Bacteria 951
583 Ga0501079_0562611 3300049741 Bacteria 897
584 Ga0501080_0000083 3300049742 Bacteria 63863
585 Ga0501080_0978097 3300049742 Bacteria 735
586 Ga0501083_0018445 3300049744 Bacteria 4863
587 Ga0501083_0029058 3300049744 Bacteria 3806
588 Ga0501279_006475 3300049775 Bacteria 1547
589 Ga0501279_019315 3300049775 Bacteria 964
590 Ga0501035_0024155 3300049822 Bacteria 5576
591 Ga0501044_0121775 3300049823 Bacteria 2609
592 Ga0501044_0130866 3300049823 Bacteria 2503
593 Ga0501044_0148794 3300049823 Bacteria 2325
594 nmdc:mga00v17_447618_c1 3300050491 Bacteria 838
595 nmdc:mga06z11_287213_c1 3300050494 Bacteria 975
596 nmdc:mga05p37_557789_c1 3300050507 Bacteria 1302
597 Ga0495655_0017509 3300053083 Bacteria 1562
598 Ga0500643_000072 3300053087 Bacteria 112810
599 Ga0500559_0002035 3300053136 Bacteria 10821
600 Ga0500573_0000001 3300053140 Bacteria 436394
601 Ga0500573_0006393 3300053140 Bacteria 6374
602 Ga0500573_0010761 3300053140 Bacteria 5111
603 Ga0500573_0030368 3300053140 Bacteria 3118
604 Ga0500573_0035445 3300053140 Bacteria 2879
605 Ga0500573_0055150 3300053140 Bacteria 2280
606 Ga0500573_0088671 3300053140 Bacteria 1750
607 Ga0500573_0160667 3300053140 Bacteria 1223
608 Ga0500573_0256276 3300053140 Bacteria 898
609 Ga0500577_0071098 3300053142 Bacteria 1365
610 Ga0500577_0260854 3300053142 Bacteria 754
611 Ga0500616_0000427 3300053153 Bacteria 56111
612 Ga0500616_0000881 3300053153 Bacteria 33077
613 Ga0501084_0034593 3300054114 Bacteria 4224
614 Ga0501084_0048348 3300054114 Bacteria 3561
615 Ga0587082_110032 3300059504 Bacteria 611
616 Ga0587090_083455 3300059510 Bacteria 644
617 Ga0587091_225542 3300059511 Bacteria 514
618 Ga0587106_161086 3300059605 Bacteria 506
619 Ga0501082_0004516 3300060353 Bacteria 12151
620 Ga0501082_0012010 3300060353 Bacteria 7448
621 2537899440 2537561592 Bacteria 4348607
622 2555229745 2554235227 Bacteria 3637389
623 2644099577 2643221617 Bacteria 5139111
624 2644116228 2643221620 Bacteria 5134593
625 2644183100 2643221632 Bacteria 3406696
626 2644506746 2643221690 Bacteria 4654705
627 2644527735 2643221694 Bacteria 4392972
628 2644670644 2643221722 Bacteria 4247614
629 2655031785 2654587600 Bacteria 3911798
630 2691513330 2690315906 Bacteria 4517044
631 2729908982 2728369276 Bacteria 5610032
632 2738696572 2738541272 Bacteria 6848551
633 2738871593 2738541305 Bacteria 4910150
634 2739324302 2738543027 Bacteria 6409078
635 2760306420 2758568522 Bacteria 5953541
636 2760625118 2758568621 Bacteria 5967089
637 2775656310 2775506735 Bacteria 4556596
638 2808830575 2808606357 Bacteria 4466944
639 2808851768 2808606360 Bacteria 4404006
640 2808879922 2808606366 Bacteria 4415912
641 2808894837 2808606370 Bacteria 4942454
642 2808895784 2808606371 Bacteria 4251511
643 2812321871 2811994871 Bacteria 4497550
644 2844852125 2844849076 Bacteria 4091819
645 2857733903 2857733635 Bacteria 3532004
646 2857744698 2857740372 Bacteria 4782044
647 2884994594 2884994152 Bacteria 4492978
648 2904499513 2904497146 Bacteria 4731781
649 2904778599 2904776348 Bacteria 4658726
650 2905927491 2905926851 Bacteria 4423176
651 2905928951 2905926851 Bacteria 4423176
652 2910810505 2910809715 Bacteria 4982797
653 2919035960 2919034639 Bacteria 4763403
654 2919060669 2919059106 Bacteria 4991624
655 2919392261 2919391150 Bacteria 4884741
656 2932430957 2932426870 Bacteria 4547726
657 2933418988 2933418574 Bacteria 4476724
658 2939599892 2939598168 Bacteria 4687164
659 2939648061 2939647034 Bacteria 4681660
660 2939662635 2939660829 Bacteria 3784848
661 2939678361 2939674588 Bacteria 4844420
662 2945919740 2945916053 Bacteria 4555517
663 2945924358 2945920336 Bacteria 4501603
664 2945943921 2945941187 Bacteria 4682474
665 2945957898 2945956166 Bacteria 5110334
666 2945971937 2945968032 Bacteria 4111363
667 2946025096 2946024296 Bacteria 3508095
668 2946039877 2946037020 Bacteria 4900426
669 2946063464 2946059875 Bacteria 4386623
670 2954001105 2953998280 Bacteria 4812144
671 2974303372 2974302888 Bacteria 4369871
672 8004024004 8004021418 Bacteria 4313954
673 8004029164 8004025490 Bacteria 4327753
674 8054111624 8054107350 Bacteria 5022511
675 8055071718 8055066027 Bacteria 9479577
676 Ga0070683_101302126
677 LJQas_1001861
678 JGI25154J39366_1001884
679 JGI25152J39213_1000699
680 JGI25151J46595_10014226
681 Ga0007423J48922_100411
682 rootH2_10102474
683 rootL2_10098251
684 Ga0055542_1008770
685 Ga0065714_10012531
686 Ga0065714_10028910
687 Ga0065714_10180273
688 Ga0065714_10459246
689 Ga0065712_10418429
690 Ga0070658_10002673
691 Ga0070658_11023918
692 Ga0070676_10016654
693 Ga0070683_101152629
694 Ga0070670_100122935
695 Ga0070670_100502808
696 Ga0070670_101339628
697 Ga0070677_10302909
698 Ga0068869_101161801
699 Ga0070666_10060676
700 Ga0070680_100000562
701 Ga0070682_101271143
702 Ga0068868_101192750
703 Ga0070660_101846103
704 Ga0070691_10250134
705 Ga0070668_100009104
706 Ga0070668_101894106
707 Ga0070669_100013316
708 Ga0070675_100007446
709 Ga0070675_100687832
710 Ga0070675_101696891
711 Ga0070671_100042471
712 Ga0070674_100035159
713 Ga0070674_100502284
714 Ga0070673_100033825
715 Ga0070673_102404617
716 Ga0070667_100099808
717 Ga0070667_100438714
718 Ga0070663_101558454
719 Ga0070678_100622835
720 Ga0070678_102327249
721 Ga0070681_10009608
722 Ga0068867_100767491
723 Ga0070698_100416286
724 Ga0070679_100006807
725 Ga0070684_101256214
726 Ga0070672_100670716
727 Ga0070686_101338120
728 Ga0070693_100500375
729 Ga0070665_100626149
730 Ga0068854_101286465
731 Ga0070702_100272361
732 Ga0068852_101202969
733 Ga0068864_102451828
734 Ga0068870_10835503
735 Ga0068863_102742216
736 Ga0075364_10018264
737 Ga0075364_10588621
738 Ga0075432_10007469
739 Ga0075432_10022995
740 Ga0070716_100495307
741 Ga0075367_10313619
742 Ga0075370_10403873
743 Ga0105251_10016596
744 Ga0105244_10037935
745 Ga0105244_10093429
746 Ga0105244_10262918
747 Ga0105244_10370857
748 Ga0105250_10315165
749 Ga0111539_12819468
750 Ga0105245_12224497
751 Ga0105247_10357605
752 Ga0114129_10427944
753 Ga0105243_10098409
754 Ga0105243_10183438
755 Ga0105243_11326445
756 Ga0105241_11289395
757 Ga0105242_10962490
758 Ga0105242_13007075
759 Ga0105248_10639010
760 Ga0105248_12194008
761 Ga0105249_11511651
762 Ga0105249_13169368
763 Ga0105239_13349103
764 Ga0105246_10030340
765 Ga0105246_10117506
766 Ga0105246_10180153
767 Ga0105246_10309427
768 Ga0105246_10939560
769 Ga0105246_11677652
770 Ga0157373_10020911
771 Ga0157373_10308650
772 Ga0157371_10140745
773 Ga0157371_11132812
774 Ga0157370_10362592
775 Ga0157370_11717862
776 Ga0157369_10273612
777 Ga0157369_10580811
778 Ga0163162_10816102
779 Ga0163162_10985751
780 Ga0163162_12085424
781 Ga0157375_11061904
782 Ga0157375_11204517
783 Ga0163163_10860562
784 Ga0163163_12172408
785 Ga0157380_11431767
786 Ga0157380_12085412
787 Ga0182008_10325833
788 Ga0157377_11334236
789 Ga0157379_10985051
790 Ga0157376_12767755
791 Ga0182006_1286783
792 Ga0163161_10501864
793 Ga0163161_11758811
794 Ga0197907_10539174
795 Ga0206349_1746741
796 Ga0206354_10001086
797 Ga0206354_11451704
798 Ga0206353_11470244
799 Ga0206353_11934036
800 Ga0209148_1013241
801 Ga0209129_1000959
802 Ga0209025_1000279
803 Ga0209051_1008200
804 Ga0207697_10012933
805 Ga0207697_10031182
806 Ga0207655_1010844
807 Ga0207655_1022278
808 Ga0207655_1045256
809 Ga0207655_1071885
810 Ga0207688_10161444
811 Ga0207680_10396937
812 Ga0207645_10008525
813 Ga0207705_10008528
814 Ga0207707_10000393
815 Ga0207660_10000423
816 Ga0207657_11238464
817 Ga0207652_10000455
818 Ga0207681_10180776
819 Ga0207650_10044742
820 Ga0207650_11750536
821 Ga0207659_10027636
822 Ga0207687_10568371
823 Ga0207644_10153592
824 Ga0207709_10019809
825 Ga0207709_10649836
826 Ga0207709_11421690
827 Ga0207669_10242588
828 Ga0207669_10949562
829 Ga0207691_10005146
830 Ga0207691_10220504
831 Ga0207711_10305540
832 Ga0207689_10942912
833 Ga0207661_11919617
834 Ga0207679_11100990
835 Ga0207651_10072359
836 Ga0207651_11977036
837 Ga0207651_12034986
838 Ga0207668_10010350
839 Ga0207658_10256906
840 Ga0207677_11473694
841 Ga0207677_11882856
842 Ga0207678_10411690
843 Ga0207648_10578687
844 Ga0207676_10946211
845 Ga0207683_10014776
846 Ga0207683_11859990
847 Ga0209974_10322793
848 Ga0207428_10031917
849 Ga0268266_11106594
850 Ga0316182_1255603
851 Ga0307408_100017746
852 Ga0307408_100171974
853 Ga0307408_100183116
854 Ga0307408_100251664
855 Ga0307408_100381115
856 Ga0307408_100388099
857 Ga0307408_100393692
858 Ga0307408_100853274
859 Ga0307408_100920339
860 Ga0307408_101442822
861 Ga0307408_101819009
862 Ga0307514_10002541
863 Ga0307405_10029359
864 Ga0307405_10063841
865 Ga0307405_10129543
866 Ga0307405_10184973
867 Ga0307405_10188495
868 Ga0307405_10278668
869 Ga0307405_10445508
870 Ga0307405_10523743
871 Ga0307405_10593691
872 Ga0307405_10676862
873 Ga0307405_11531878
874 Ga0307413_10029754
875 Ga0307413_10129464
876 Ga0307413_10136666
877 Ga0307413_10182766
878 Ga0307413_10244033
879 Ga0307413_11561951
880 Ga0307413_12197066
881 Ga0307410_10005249
882 Ga0307410_10016758
883 Ga0307410_10040383
884 Ga0307410_10137033
885 Ga0307410_10228049
886 Ga0307410_10298894
887 Ga0307410_10354028
888 Ga0307410_10483039
889 Ga0307410_10501819
890 Ga0307410_10587320
891 Ga0307410_12072155
892 Ga0307406_10006012
893 Ga0307406_10052875
894 Ga0307406_10180900
895 Ga0307406_10605242
896 Ga0307406_11028149
897 Ga0307406_11320486
898 Ga0307406_11952789
899 Ga0307407_10014783
900 Ga0307407_10048235
901 Ga0307407_10079056
902 Ga0307407_10167397
903 Ga0307407_10257613
904 Ga0307407_10291745
905 Ga0307407_10341559
906 Ga0307407_10500149
907 Ga0307407_10553126
908 Ga0307407_10842184
909 Ga0307407_11192369
910 Ga0307407_11602499
911 Ga0307412_10020631
912 Ga0307412_10026647
913 Ga0307412_10073957
914 Ga0307412_10104216
915 Ga0307412_10164914
916 Ga0307412_10242616
917 Ga0307412_10244763
918 Ga0307412_10544818
919 Ga0307412_10585712
920 Ga0307412_10687793
921 Ga0307412_10901541
922 Ga0307412_10904814
923 Ga0307412_11069230
924 Ga0307412_11959274
925 Ga0307409_100004028
926 Ga0307409_100038616
927 Ga0307409_100138123
928 Ga0307409_100300781
929 Ga0307409_100438733
930 Ga0307409_100473893
931 Ga0307409_100526584
932 Ga0307409_100683282
933 Ga0307409_100892071
934 Ga0307409_101158627
935 Ga0307409_101295748
936 Ga0307409_101332307
937 Ga0307409_101800033
938 Ga0307416_100006982
939 Ga0307416_100022613
940 Ga0307416_100041030
941 Ga0307416_100047094
942 Ga0307416_100402108
943 Ga0307416_100536939
944 Ga0307416_100773165
945 Ga0307416_101871787
946 Ga0307414_10040954
947 Ga0307414_10051886
948 Ga0307414_10134527
949 Ga0307414_10492564
950 Ga0307414_10663957
951 Ga0307414_11373546
952 Ga0307414_11648436
953 Ga0307414_11692806
954 Ga0307411_10011696
955 Ga0307411_10042495
956 Ga0307411_10186814
957 Ga0307411_10258796
958 Ga0307411_10705693
959 Ga0307415_100066918
960 Ga0307415_100136294
961 Ga0307415_100330564
962 Ga0307415_100428296
963 Ga0307415_101129669
964 Ga0395899_0022969
965 Ga0395899_0160624
966 Ga0395899_0223139
967 Ga0395900_0029820
968 Ga0395900_0166859
969 Ga0395898_0140123
970 Ga0395898_0259807
971 Ga0395905_0305191
972 Ga0395905_0444137
973 Ga0395901_0191553
974 Ga0395901_0193532
975 Ga0439436_0001792
976 Ga0439436_0021675
977 Ga0439436_0075642
978 Ga0439438_002550
979 Ga0439438_011166
980 Ga0439438_014609
981 Ga0439439_0001899
982 Ga0439439_0040040
983 Ga0439447_124939
984 Ga0439461_0000878
985 Ga0439461_0020215
986 Ga0439466_0019657
987 Ga0439466_0057632
988 Ga0439466_0075617
989 Ga0439465_0004976
990 Ga0439465_0101564
991 Ga0451789_0429320
992 Ga0451789_0802992
993 Ga0451791_1536256
994 Ga0451793_1081233
995 Ga0451797_0486614
996 Ga0451797_1348702
997 Ga0451800_0637619
998 Ga0451833_0331633
999 Ga0451837_1062277
1000 Ga0451837_1738886
1001 Ga0451839_0828930
1002 Ga0451841_0476654
1003 Ga0451841_0893907
1004 Ga0451853_1425610
1005 Ga0451853_2357515
1006 Ga0439433_0001105
1007 Ga0439433_0001287
1008 Ga0439442_000195
1009 Ga0439442_000422
1010 Ga0439442_000423
1011 Ga0439442_000726
1012 Ga0439442_002475
1013 Ga0439442_011960
1014 Ga0439432_001112
1015 Ga0439432_155712
1016 Ga0439449_0001098
1017 Ga0439449_0022849
1018 Ga0439449_0119881
1019 Ga0439452_003001
1020 Ga0439452_119855
1021 Ga0439454_022327
1022 Ga0439457_000519
1023 Ga0439457_004433
1024 Ga0439457_115735
1025 Ga0439462_0003822
1026 Ga0439462_0046725
1027 Ga0450911_017806
1028 Ga0450911_030911
1029 Ga0450911_057738
1030 Ga0450919_000441
1031 Ga0450919_018990
1032 Ga0450920_000421
1033 Ga0450920_009929
1034 Ga0450920_030970
1035 Ga0450906_022257
1036 Ga0450907_001343
1037 Ga0450907_007759
1038 Ga0450907_010864
1039 Ga0450910_007695
1040 Ga0439446_0004241
1041 Ga0439446_0033335
1042 Ga0439446_0048084
1043 Ga0450908_010618
1044 Ga0450908_026491
1045 Ga0450909_000709
1046 Ga0450909_010590
1047 Ga0439434_0002025
1048 Ga0439434_0026347
1049 Ga0450918_000561
1050 Ga0450918_002567
1051 Ga0466966_0129264
1052 Ga0466970_0336873
1053 Ga0466967_2543936
1054 Ga0495603_0433635
1055 Ga0495603_0747905
1056 Ga0495629_0308847
1057 Ga0495629_0542185
1058 Ga0495653_0347605
1059 Ga0495580_0004725
1060 Ga0495582_0055289
1061 Ga0495582_0158591
1062 Ga0495582_0460452
1063 Ga0495639_0104244
1064 Ga0495639_0106834
1065 Ga0495662_0069874
1066 Ga0495662_0578880
1067 Ga0495664_0008177
1068 Ga0495594_0372692
1069 Ga0495583_0307896
1070 Ga0495606_0049620
1071 Ga0495610_0191134
1072 Ga0495630_0029446
1073 Ga0495631_0080220
1074 Ga0495663_0155479
1075 Ga0495642_0256546
1076 Ga0495665_0000213
1077 Ga0495665_0068424
1078 Ga0495586_0000799
1079 Ga0495586_0008514
1080 Ga0495586_0102208
1081 Ga0495587_0001081
1082 Ga0495598_0308332
1083 Ga0495645_0053475
1084 Ga0495645_0808218
1085 Ga0495633_0071426
1086 Ga0495667_0000881
1087 Ga0495656_0297201
1088 Ga0495656_0564118
1089 Ga0495668_0099901
1090 Ga0495668_0425710
1091 Ga0495634_0766172
1092 Ga0495659_0422368
1093 Ga0495588_0017340
1094 Ga0495588_0055707
1095 Ga0495657_0048249
1096 Ga0495623_0035811
1097 Ga0495613_0441012
1098 Ga0495670_0287746
1099 Ga0495670_0432194
1100 Ga0495600_0005908
1101 Ga0495600_0184068
1102 Ga0495600_0550116
1103 Ga0495581_0010766
1104 Ga0495581_0023935
1105 Ga0495581_0290292
1106 Ga0495604_0170664
1107 Ga0495636_0016153
1108 Ga0495636_0353724
1109 Ga0495680_0229448
1110 Ga0495680_0796520
1111 Ga0495675_0001025
1112 Ga0495677_0102207
1113 Ga0495677_0124247
1114 Ga0495685_080776
1115 Ga0495684_0107891
1116 Ga0495684_0602599
1117 Ga0495686_0246027
1118 Ga0495593_0081061
1119 Ga0495593_0250659
1120 Ga0495615_0005275
1121 Ga0496100_0470532
1122 Ga0496101_0668310
1123 Ga0496101_1199694
1124 Ga0496102_0451770
1125 Ga0496103_0161178
1126 Ga0496103_0420813
1127 Ga0496104_0791466
1128 Ga0496106_0380491
1129 Ga0496106_0551093
1130 Ga0496107_0114214
1131 Ga0496108_1028509
1132 Ga0496108_1753775
1133 Ga0496109_0055681
1134 Ga0496110_0074021
1135 Ga0496110_0398610
1136 Ga0496110_0670242
1137 Ga0496111_0007283
1138 Ga0496111_0102145
1139 Ga0496111_0237923
1140 Ga0496112_0046000
1141 Ga0496112_0096230
1142 Ga0496112_0107643
1143 Ga0496112_0643752
1144 Ga0496113_0453443
1145 Ga0496113_0539999
1146 Ga0496113_0663019
1147 Ga0496113_0870945
1148 Ga0496114_0121715
1149 Ga0496115_0072037
1150 Ga0496117_0238874
1151 Ga0496118_0047967
1152 Ga0496118_0153728
1153 Ga0496119_0025815
1154 Ga0496119_0035575
1155 Ga0496119_0111896
1156 Ga0496119_0283993
1157 Ga0496122_0000646
1158 Ga0496123_0000405
1159 Ga0496124_0001857
1160 Ga0496124_0115506
1161 Ga0496124_0185981
1162 Ga0496125_0001474
1163 Ga0496125_0151462
1164 Ga0496126_0234679
1165 Ga0496126_0554651
1166 Ga0496126_0850010
1167 Ga0501306_002667
1168 Ga0501306_006234
1169 Ga0501308_009834
1170 Ga0501308_027315
1171 Ga0501308_034376
1172 Ga0501309_012195
1173 Ga0501310_023399
1174 Ga0501310_052602
1175 Ga0501304_005082
1176 Ga0501304_040227
1177 Ga0501305_012741
1178 Ga0501311_017470
1179 Ga0501311_018031
1180 Ga0501311_064289
1181 Ga0501312_013283
1182 Ga0501313_002958
1183 Ga0501313_020731
1184 Ga0501314_043607
1185 Ga0501315_019255
1186 Ga0501315_025297
1187 Ga0501315_037416
1188 Ga0501316_032865
1189 Ga0501317_001276
1190 Ga0501317_035152
1191 Ga0501317_041526
1192 Ga0501317_049249
1193 Ga0501317_108027
1194 Ga0501318_021527
1195 Ga0501318_051739
1196 Ga0501319_012634
1197 Ga0501319_022237
1198 Ga0501320_006767
1199 Ga0501321_077493
1200 Ga0501321_079216
1201 Ga0501321_088798
1202 Ga0501323_003639
1203 Ga0501323_031027
1204 Ga0501324_003617
1205 Ga0501325_044567
1206 Ga0501336_031130
1207 Ga0501340_002030
1208 Ga0501032_0001361
1209 Ga0501032_0010838
1210 Ga0501032_0484173
1211 Ga0501032_1032075
1212 Ga0501033_0216061
1213 Ga0501033_0251901
1214 Ga0501034_0014274
1215 Ga0501034_0049401
1216 Ga0501034_0073598
1217 Ga0501034_0132871
1218 Ga0501036_0572058
1219 Ga0501036_0811226
1220 Ga0501036_1031949
1221 Ga0501037_0058769
1222 Ga0501037_0152158
1223 Ga0501038_0013254
1224 Ga0501038_0088062
1225 Ga0501038_0110531
1226 Ga0501039_0138097
1227 Ga0501039_0516129
1228 Ga0501039_0664115
1229 Ga0501039_0727091
1230 Ga0501040_1119129
1231 Ga0501043_0009011
1232 Ga0501043_0022650
1233 Ga0501043_0046870
1234 Ga0501043_0178150
1235 Ga0501046_0112725
1236 Ga0501046_0115637
1237 Ga0501047_0003410
1238 Ga0501047_0103158
1239 Ga0501047_0505229
1240 Ga0501048_0141180
1241 Ga0501067_0141651
1242 Ga0501068_1064664
1243 Ga0501069_0068350
1244 Ga0501069_0679020
1245 Ga0501070_0002817
1246 Ga0501070_0184951
1247 Ga0501070_0590210
1248 Ga0501071_0000388
1249 Ga0501072_1193403
1250 Ga0501073_0023868
1251 Ga0501073_0798663
1252 Ga0501074_0228728
1253 Ga0501075_0747716
1254 Ga0501077_0055826
1255 Ga0501198_080568
1256 Ga0501249_169344
1257 Ga0501225_0077573
1258 Ga0501079_0562611
1259 Ga0501080_0000083
1260 Ga0501080_0978097
1261 Ga0501083_0018445
1262 Ga0501083_0029058
1263 Ga0501279_006475
1264 Ga0501279_019315
1265 Ga0501035_0024155
1266 Ga0501044_0121775
1267 Ga0501044_0130866
1268 Ga0501044_0148794
1269 nmdc:mga00v17_447618_c1
1270 nmdc:mga06z11_287213_c1
1271 nmdc:mga05p37_557789_c1
1272 Ga0495655_0017509
1273 Ga0500643_000072
1274 Ga0500559_0002035
1275 Ga0500573_0000001
1276 Ga0500573_0006393
1277 Ga0500573_0010761
1278 Ga0500573_0030368
1279 Ga0500573_0035445
1280 Ga0500573_0055150
1281 Ga0500573_0088671
1282 Ga0500573_0160667
1283 Ga0500573_0256276
1284 Ga0500577_0071098
1285 Ga0500577_0260854
1286 Ga0500616_0000427
1287 Ga0500616_0000881
1288 Ga0501084_0034593
1289 Ga0501084_0048348
1290 Ga0587082_110032
1291 Ga0587090_083455
1292 Ga0587091_225542
1293 Ga0587106_161086
1294 Ga0501082_0004516
1295 Ga0501082_0012010
1296 2537899440
1297 2555229745
1298 2644099577
1299 2644116228
1300 2644183100
1301 2644506746
1302 2644527735
1303 2644670644
1304 2655031785
1305 2691513330
1306 2729908982
1307 2738696572
1308 2738871593
1309 2739324302
1310 2760306420
1311 2760625118
1312 2775656310
1313 2808830575
1314 2808851768
1315 2808879922
1316 2808894837
1317 2808895784
1318 2812321871
1319 2844852125
1320 2857733903
1321 2857744698
1322 2884994594
1323 2904499513
1324 2904778599
1325 2905927491
1326 2905928951
1327 2910810505
1328 2919035960
1329 2919060669
1330 2919392261
1331 2932430957
1332 2933418988
1333 2939599892
1334 2939648061
1335 2939662635
1336 2939678361
1337 2945919740
1338 2945924358
1339 2945943921
1340 2945957898
1341 2945971937
1342 2946025096
1343 2946039877
1344 2946063464
1345 2954001105
1346 2974303372
1347 8004024004
1348 8004029164
1349 8054111624
1350 8055071718

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02686

GatC

Glu-tRNAGln amidotransferase C subunit

28

99

0.97

Map