F474378

General Info

Members Datasets Scaffolds Average Seq Length
674 417 1348 268

Family's Representative Sequence

Representative Sequence 3300035170|Ga0373943_0018624|Ga0373943_0018624_867_1850
Length 322
Sequence VSLGDRCGDHPADRNQGAGGSQLIAAIFAVCPRIRVSTLPAIDHNGRQRPMGGRNPMSNQSLPRLAGLILGVSMMIAAPASADPLKDEIAPTGKLRVAIAISPAGGAFWSTKNEAGGYAGVPVDLGKEMAAELGVPVEYVVHQNSGQITDAASKGTWDVTFLPKDPEREGKMSFGPIYEVADATYIVKAGSSATNFQTLDQPGIKVAAVNNTTTMRGAIAHLKNAKVTGYQTYDEIFGLLKSGEIDAFALSRDQLNAMAKKLPGTKVLDETFKQTVTAVAVPPNHPLALAFATKFMTEATTNGTLRKAYDNNGLKDNPIRVK

Samples

Sample ID Description Type Environment
1 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
2 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
54 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
55 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
59 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
63 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
88 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
90 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
92 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
93 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
139 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
140 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
141 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
146 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
147 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
148 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
149 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
150 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
151 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
152 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
153 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
154 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
155 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
156 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
157 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
158 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
159 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
160 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
161 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
162 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
163 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
164 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
165 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
166 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
167 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
168 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
169 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
170 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
171 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
172 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
173 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
174 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
175 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
176 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
177 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
178 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
179 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
180 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
181 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
182 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
183 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
184 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
185 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
186 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
187 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
188 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
189 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
190 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
191 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
192 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
193 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
194 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
195 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
196 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
197 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
198 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
199 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
200 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
201 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
202 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
203 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
204 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
205 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
206 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
207 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
208 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
209 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
210 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
211 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
212 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
213 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
214 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
215 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
216 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
217 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
218 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
219 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
220 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
221 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
222 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
223 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
224 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
225 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
226 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
227 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
228 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
229 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
230 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
231 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
232 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
233 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
234 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
235 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
236 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
237 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
238 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
239 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
240 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
241 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
242 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
243 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
244 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
245 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
246 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
247 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
248 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
249 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
250 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
251 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
252 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
253 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
254 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
255 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
256 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
257 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
258 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
259 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
260 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
261 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
262 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
263 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
264 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
265 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
266 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
267 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
268 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
269 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
270 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
271 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
272 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
273 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
276 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
278 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
282 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
285 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
286 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
287 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
288 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
289 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
290 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
291 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
292 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
293 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
294 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
295 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
296 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
299 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
300 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
301 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
302 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
303 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
304 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
305 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
306 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
307 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
308 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
309 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
310 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
311 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
312 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
313 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
314 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
315 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
316 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
317 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
318 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
319 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
320 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
321 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
322 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
323 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
324 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
325 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
326 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
327 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
328 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
329 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
330 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
331 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
332 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
333 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
334 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
335 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
336 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
337 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
338 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
339 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
340 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
341 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
342 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
343 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
344 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
345 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
346 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
347 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
348 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
349 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
350 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
351 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
352 2791355199
353 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
354 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
355 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
356 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
357 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
358 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
359 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
360 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
361 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
362 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
363 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
364 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
365 2906610324
366 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
367 2922425934
368 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
369 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
370 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
371 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
372 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
373 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
374 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
375 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
376 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
377 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
378 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
379 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
380 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
381 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
382 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
383 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
384 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
385 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
386 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
387 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
388 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
389 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
390 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
391 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
392 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
393 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
394 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
395 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
396 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
397 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
398 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
399 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
400 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
401 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
402 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
403 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
404 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
405 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
406 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
407 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
408 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
409 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
410 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
411 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
412 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
413 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
414 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
415 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
416 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
417 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 88.52
Metatranscriptomes 0
Isolates 11.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.64
Nodule 9.79
Rhizoplane 6.38
Rhizosphere 65.58
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373943_0018624 3300035170 Bacteria 3191
2 JGI25165J46597_1009555 3300003214 Bacteria 1453
3 rootH2_10144904 3300003320 Bacteria 1138
4 JGI25404J52841_10004652 3300003659 Bacteria 2796
5 JGI25404J52841_10035186 3300003659 Bacteria 1066
6 Ga0065707_10295803 3300005295 Bacteria 1015
7 Ga0070658_10124610 3300005327 Bacteria 2143
8 Ga0070658_10148275 3300005327 Bacteria 1963
9 Ga0070658_10206761 3300005327 Bacteria 1657
10 Ga0070683_100211378 3300005329 Bacteria 1843
11 Ga0070690_100140343 3300005330 Bacteria 1640
12 Ga0070670_100074468 3300005331 Bacteria 2917
13 Ga0070670_100295537 3300005331 Bacteria 1416
14 Ga0068869_100369642 3300005334 Bacteria 1173
15 Ga0070680_100016170 3300005336 Bacteria 5866
16 Ga0070680_100017832 3300005336 Bacteria 5601
17 Ga0070680_100040761 3300005336 Bacteria 3762
18 Ga0070680_100072730 3300005336 Bacteria 2826
19 Ga0070682_100068721 3300005337 Bacteria 2260
20 Ga0068868_100004520 3300005338 Bacteria 9759
21 Ga0068868_100777961 3300005338 Bacteria 862
22 Ga0070689_100512664 3300005340 Bacteria 1029
23 Ga0070661_100343533 3300005344 Bacteria 1170
24 Ga0070668_100025123 3300005347 Bacteria 4516
25 Ga0070669_100382644 3300005353 Bacteria 1148
26 Ga0070671_100291911 3300005355 Bacteria 1388
27 Ga0070674_100015279 3300005356 Bacteria 4790
28 Ga0070674_100024950 3300005356 Bacteria 3884
29 Ga0070688_100312769 3300005365 Bacteria 1139
30 Ga0070667_100339405 3300005367 Bacteria 1358
31 Ga0070667_100658865 3300005367 Bacteria 967
32 Ga0070709_10009481 3300005434 Bacteria 5372
33 Ga0070709_10022406 3300005434 Bacteria 3694
34 Ga0070713_100057175 3300005436 Bacteria 3247
35 Ga0070713_100066981 3300005436 Bacteria 3022
36 Ga0070713_100257053 3300005436 Bacteria 1595
37 Ga0070710_10012718 3300005437 Bacteria 4188
38 Ga0070710_10073404 3300005437 Bacteria 1978
39 Ga0070711_100006317 3300005439 Bacteria 7134
40 Ga0070711_100165448 3300005439 Bacteria 1681
41 Ga0070711_100274184 3300005439 Bacteria 1332
42 Ga0070663_100007143 3300005455 Bacteria 6779
43 Ga0070663_100146256 3300005455 Bacteria 1808
44 Ga0070663_100159888 3300005455 Bacteria 1733
45 Ga0070663_100287335 3300005455 Bacteria 1312
46 Ga0070678_100004657 3300005456 Bacteria 7802
47 Ga0070678_100027471 3300005456 Bacteria 3864
48 Ga0070678_100092212 3300005456 Bacteria 2327
49 Ga0070662_100082889 3300005457 Bacteria 2392
50 Ga0070681_10013002 3300005458 Bacteria 8265
51 Ga0070681_10024950 3300005458 Bacteria 6015
52 Ga0070681_10119463 3300005458 Bacteria 2572
53 Ga0070681_10573215 3300005458 Bacteria 1042
54 Ga0068867_100112861 3300005459 Bacteria 2090
55 Ga0070706_100315871 3300005467 Bacteria 1457
56 Ga0070698_100023197 3300005471 Bacteria 6486
57 Ga0070679_100004371 3300005530 Bacteria 13057
58 Ga0070679_100042435 3300005530 Bacteria 4529
59 Ga0070684_100020742 3300005535 Bacteria 5452
60 Ga0070684_100463366 3300005535 Bacteria 1172
61 Ga0070697_100155390 3300005536 Bacteria 1931
62 Ga0068853_100007746 3300005539 Bacteria 8610
63 Ga0068853_100228067 3300005539 Bacteria 1703
64 Ga0068853_100308360 3300005539 Bacteria 1465
65 Ga0070672_100290602 3300005543 Bacteria 1384
66 Ga0070686_100022580 3300005544 Bacteria 3749
67 Ga0070693_100178536 3300005547 Bacteria 1365
68 Ga0068855_100036422 3300005563 Bacteria 5856
69 Ga0068855_100131119 3300005563 Bacteria 2863
70 Ga0068855_100258589 3300005563 Bacteria 1940
71 Ga0068857_100090006 3300005577 Bacteria 2746
72 Ga0068857_100443619 3300005577 Bacteria 1213
73 Ga0068854_100112324 3300005578 Bacteria 2057
74 Ga0068854_100596157 3300005578 Bacteria 943
75 Ga0068856_100000799 3300005614 Bacteria 33936
76 Ga0068856_100060606 3300005614 Bacteria 3738
77 Ga0068856_100333077 3300005614 Bacteria 1536
78 Ga0068852_100031844 3300005616 Bacteria 4359
79 Ga0068852_100056070 3300005616 Bacteria 3403
80 Ga0068852_100084715 3300005616 Bacteria 2822
81 Ga0068852_100157225 3300005616 Bacteria 2119
82 Ga0068861_100178974 3300005719 Bacteria 1763
83 Ga0068851_10132799 3300005834 Bacteria 1348
84 Ga0068851_10234912 3300005834 Bacteria 1035
85 Ga0068858_100162350 3300005842 Bacteria 2104
86 Ga0068858_100181777 3300005842 Bacteria 1986
87 Ga0068858_100188838 3300005842 Bacteria 1947
88 Ga0068860_100000737 3300005843 Bacteria 37293
89 Ga0068862_100119542 3300005844 Bacteria 2321
90 Ga0081455_10084524 3300005937 Bacteria 2590
91 Ga0081540_1002603 3300005983 Bacteria 14665
92 Ga0081540_1003426 3300005983 Bacteria 12538
93 Ga0081540_1007984 3300005983 Bacteria 7453
94 Ga0081540_1010685 3300005983 Bacteria 6190
95 Ga0081540_1016183 3300005983 Bacteria 4682
96 Ga0081540_1066797 3300005983 Bacteria 1683
97 Ga0081539_10000172 3300005985 Bacteria 151505
98 Ga0075365_10043464 3300006038 Bacteria 2942
99 Ga0075365_10056316 3300006038 Bacteria 2613
100 Ga0075365_10229289 3300006038 Bacteria 1303
101 Ga0075368_10012359 3300006042 Bacteria 3119
102 Ga0075368_10030028 3300006042 Bacteria 2103
103 Ga0075364_10231317 3300006051 Bacteria 1255
104 Ga0070716_100037183 3300006173 Bacteria 2689
105 Ga0070712_100016896 3300006175 Bacteria 4719
106 Ga0075367_10130576 3300006178 Bacteria 1553
107 Ga0075369_10016203 3300006186 Bacteria 3003
108 Ga0097621_100140831 3300006237 Bacteria 2061
109 Ga0097621_100517627 3300006237 Bacteria 1082
110 Ga0068871_100130075 3300006358 Bacteria 2134
111 Ga0068871_100193254 3300006358 Bacteria 1754
112 Ga0068871_100205688 3300006358 Bacteria 1701
113 Ga0099794_10043122 3300007265 Bacteria 2153
114 Ga0099794_10048597 3300007265 Bacteria 2037
115 Ga0099795_10035126 3300007788 Bacteria 1751
116 Ga0105240_10009861 3300009093 Bacteria 13482
117 Ga0105240_10023910 3300009093 Bacteria 8071
118 Ga0111539_10110345 3300009094 Bacteria 3228
119 Ga0105245_10006924 3300009098 Bacteria 9941
120 Ga0105247_10012998 3300009101 Bacteria 4991
121 Ga0105247_10035576 3300009101 Bacteria 3036
122 Ga0105243_10037305 3300009148 Bacteria 3776
123 Ga0105242_10132360 3300009176 Bacteria 2154
124 Ga0105248_10098851 3300009177 Bacteria 3288
125 Ga0105248_10215379 3300009177 Bacteria 2163
126 Ga0105237_10083609 3300009545 Bacteria 3183
127 Ga0105237_10134648 3300009545 Bacteria 2465
128 Ga0105238_10025651 3300009551 Bacteria 6008
129 Ga0105238_10326276 3300009551 Bacteria 1521
130 Ga0105238_10372068 3300009551 Bacteria 1419
131 Ga0105249_10358666 3300009553 Bacteria 1479
132 Ga0099796_10068559 3300010159 Bacteria 1275
133 Ga0105239_10050676 3300010375 Bacteria 4553
134 Ga0105239_10125084 3300010375 Bacteria 2857
135 Ga0105239_10916695 3300010375 Bacteria 1006
136 Ga0105246_10001811 3300011119 Bacteria 12805
137 Ga0157371_10087642 3300013102 Bacteria 2204
138 Ga0157370_10025034 3300013104 Bacteria 5908
139 Ga0157370_10145716 3300013104 Bacteria 2205
140 Ga0157369_10067578 3300013105 Bacteria 3842
141 Ga0157369_10177177 3300013105 Bacteria 2244
142 Ga0157374_10072046 3300013296 Bacteria 3259
143 Ga0157374_10222930 3300013296 Bacteria 1851
144 Ga0163162_10006184 3300013306 Bacteria 11599
145 Ga0163162_10216808 3300013306 Bacteria 2044
146 Ga0157372_10312234 3300013307 Bacteria 1830
147 Ga0157372_10957711 3300013307 Bacteria 992
148 Ga0157375_10016118 3300013308 Bacteria 6702
149 Ga0157375_10038520 3300013308 Bacteria 4590
150 Ga0157375_10781438 3300013308 Bacteria 1104
151 Ga0163163_10016611 3300014325 Bacteria 6843
152 Ga0163163_10401316 3300014325 Bacteria 1429
153 Ga0157380_10721724 3300014326 Bacteria 1004
154 Ga0157376_10050808 3300014969 Bacteria 3441
155 Ga0157376_10051218 3300014969 Bacteria 3429
156 Ga0213876_10132769 3300021384 Bacteria 1324
157 Ga0209677_100713 3300025253 Bacteria 16931
158 Ga0209233_1007304 3300025261 Bacteria 3508
159 Ga0209455_1004092 3300025272 Bacteria 4908
160 Ga0209758_1039511 3300025297 Bacteria 1793
161 Ga0207426_1000534 3300025302 Bacteria 54468
162 Ga0209257_1011601 3300025304 Bacteria 4217
163 Ga0207697_10021876 3300025315 Bacteria 2620
164 Ga0207656_10084686 3300025321 Bacteria 1430
165 Ga0207656_10143957 3300025321 Bacteria 1125
166 Ga0207692_10062606 3300025898 Bacteria 1931
167 Ga0207692_10136770 3300025898 Bacteria 1389
168 Ga0207688_10035748 3300025901 Bacteria 2752
169 Ga0207647_10003512 3300025904 Bacteria 11750
170 Ga0207643_10183587 3300025908 Bacteria 1267
171 Ga0207705_10090701 3300025909 Bacteria 2238
172 Ga0207705_10496090 3300025909 Bacteria 948
173 Ga0207707_10001897 3300025912 Bacteria 19031
174 Ga0207707_10007545 3300025912 Bacteria 9476
175 Ga0207707_10022037 3300025912 Bacteria 5568
176 Ga0207707_10178941 3300025912 Bacteria 1852
177 Ga0207695_10053065 3300025913 Bacteria 4242
178 Ga0207695_10161383 3300025913 Bacteria 2173
179 Ga0207695_10405980 3300025913 Bacteria 1247
180 Ga0207671_10041203 3300025914 Bacteria 3417
181 Ga0207671_10171834 3300025914 Bacteria 1683
182 Ga0207693_10005591 3300025915 Bacteria 10449
183 Ga0207693_10042547 3300025915 Bacteria 3575
184 Ga0207663_10124009 3300025916 Bacteria 1774
185 Ga0207660_10006849 3300025917 Bacteria 7382
186 Ga0207660_10101737 3300025917 Bacteria 2147
187 Ga0207657_10063310 3300025919 Bacteria 3163
188 Ga0207649_10490758 3300025920 Bacteria 933
189 Ga0207652_10008027 3300025921 Bacteria 8471
190 Ga0207652_10066249 3300025921 Bacteria 3130
191 Ga0207681_10235937 3300025923 Bacteria 1422
192 Ga0207681_10301413 3300025923 Bacteria 1268
193 Ga0207694_10005588 3300025924 Bacteria 9639
194 Ga0207694_10482792 3300025924 Bacteria 1037
195 Ga0207687_10211817 3300025927 Bacteria 1521
196 Ga0207687_10741121 3300025927 Bacteria 836
197 Ga0207700_10044071 3300025928 Bacteria 3282
198 Ga0207700_10048616 3300025928 Bacteria 3151
199 Ga0207700_10076270 3300025928 Bacteria 2600
200 Ga0207644_10165054 3300025931 Bacteria 1725
201 Ga0207690_10424428 3300025932 Bacteria 1064
202 Ga0207706_10029036 3300025933 Bacteria 4938
203 Ga0207709_10054620 3300025935 Bacteria 2464
204 Ga0207709_10436123 3300025935 Bacteria 1009
205 Ga0207670_10232673 3300025936 Bacteria 1416
206 Ga0207669_10027178 3300025937 Bacteria 3127
207 Ga0207669_10325001 3300025937 Bacteria 1179
208 Ga0207669_10678011 3300025937 Bacteria 845
209 Ga0207704_10070766 3300025938 Bacteria 2210
210 Ga0207665_10076528 3300025939 Bacteria 2295
211 Ga0207665_10255718 3300025939 Bacteria 1296
212 Ga0207691_10223781 3300025940 Bacteria 1631
213 Ga0207711_10101009 3300025941 Bacteria 2552
214 Ga0207711_10268412 3300025941 Bacteria 1569
215 Ga0207711_10430830 3300025941 Bacteria 1227
216 Ga0207661_10032573 3300025944 Bacteria 4039
217 Ga0207661_10077927 3300025944 Bacteria 2727
218 Ga0207679_10046923 3300025945 Bacteria 3135
219 Ga0207679_10625367 3300025945 Bacteria 972
220 Ga0207667_10081655 3300025949 Bacteria 3349
221 Ga0207667_10166723 3300025949 Bacteria 2264
222 Ga0207668_10095484 3300025972 Bacteria 2194
223 Ga0207668_10376111 3300025972 Bacteria 1194
224 Ga0207640_10103073 3300025981 Bacteria 2005
225 Ga0207677_10010709 3300026023 Bacteria 5198
226 Ga0207703_10058263 3300026035 Bacteria 3152
227 Ga0207703_10227666 3300026035 Bacteria 1670
228 Ga0207639_10080123 3300026041 Bacteria 2582
229 Ga0207639_10379087 3300026041 Bacteria 1270
230 Ga0207639_10837204 3300026041 Bacteria 858
231 Ga0207678_10030249 3300026067 Bacteria 4727
232 Ga0207678_10060959 3300026067 Bacteria 3244
233 Ga0207678_10062181 3300026067 Bacteria 3210
234 Ga0207678_10126017 3300026067 Bacteria 2185
235 Ga0207702_10000052 3300026078 Bacteria 137784
236 Ga0207702_10078464 3300026078 Bacteria 2859
237 Ga0207702_10310836 3300026078 Bacteria 1498
238 Ga0207648_10051479 3300026089 Bacteria 3599
239 Ga0207648_10110776 3300026089 Bacteria 2410
240 Ga0207674_10028377 3300026116 Bacteria 5908
241 Ga0207674_10155933 3300026116 Bacteria 2239
242 Ga0207674_10169828 3300026116 Bacteria 2135
243 Ga0207675_100070885 3300026118 Bacteria 3258
244 Ga0207675_100156396 3300026118 Bacteria 2173
245 Ga0207683_10005293 3300026121 Bacteria 11067
246 Ga0207683_10007091 3300026121 Bacteria 9607
247 Ga0207683_10076533 3300026121 Bacteria 2963
248 Ga0207683_10133638 3300026121 Bacteria 2232
249 Ga0209589_1000007 3300027357 Bacteria 425699
250 Ga0209489_100008 3300027361 Bacteria 425699
251 Ga0209700_100009 3300027363 Bacteria 425699
252 Ga0209179_1026397 3300027512 Bacteria 1165
253 Ga0268266_10294454 3300028379 Bacteria 1512
254 Ga0268265_10477968 3300028380 Bacteria 1169
255 Ga0268264_10000158 3300028381 Bacteria 153433
256 Ga0307517_10000248 3300028786 Bacteria 92084
257 Ga0307515_10016931 3300028794 Bacteria 13324
258 Ga0307515_10368081 3300028794 Bacteria 1075
259 Ga0265330_10052153 3300031235 Bacteria 1792
260 Ga0265330_10054773 3300031235 Bacteria 1743
261 Ga0265325_10055343 3300031241 Bacteria 2029
262 Ga0265340_10153215 3300031247 Bacteria 1049
263 Ga0265339_10003666 3300031249 Bacteria 10716
264 Ga0265316_10205312 3300031344 Bacteria 1459
265 Ga0307513_10217019 3300031456 Bacteria 1738
266 Ga0307509_10030512 3300031507 Bacteria 5961
267 Ga0307408_100275364 3300031548 Bacteria 1399
268 Ga0307508_10000184 3300031616 Bacteria 75613
269 Ga0265314_10287702 3300031711 Bacteria 927
270 Ga0265342_10067417 3300031712 Bacteria 2094
271 Ga0265342_10107072 3300031712 Bacteria 1586
272 Ga0307516_10013426 3300031730 Bacteria 8730
273 Ga0307516_10349052 3300031730 Bacteria 1145
274 Ga0307406_10113662 3300031901 Bacteria 1869
275 Ga0307414_10276629 3300032004 Bacteria 1409
276 Ga0307415_100047317 3300032126 Bacteria 2895
277 Ga0307507_10019790 3300033179 Bacteria 7566
278 Ga0307510_10323032 3300033180 Bacteria 1000
279 Ga0373934_0014983 3300035086 Bacteria 2940
280 Ga0373944_0122163 3300035089 Bacteria 898
281 Ga0373923_0017213 3300035111 Bacteria 2761
282 Ga0373923_0020312 3300035111 Bacteria 2579
283 Ga0373945_0032469 3300035116 Bacteria 1850
284 Ga0373953_0010187 3300035117 Bacteria 3260
285 Ga0373954_0000367 3300035118 Bacteria 16635
286 Ga0373954_0043749 3300035118 Bacteria 2089
287 Ga0373954_0085725 3300035118 Bacteria 1508
288 Ga0373956_0040230 3300035119 Bacteria 2073
289 Ga0373957_0148428 3300035120 Bacteria 961
290 Ga0373955_0000688 3300035172 Bacteria 14485
291 Ga0373955_0006769 3300035172 Bacteria 5233
292 Ga0373924_0010934 3300035410 Bacteria 3360
293 Ga0373924_0015046 3300035410 Bacteria 2933
294 Ga0373924_0028142 3300035410 Bacteria 2238
295 Ga0373931_0011731 3300035691 Bacteria 4235
296 Ga0373935_0245084 3300035692 Bacteria 1252
297 Ga0373927_0000775 3300035695 Bacteria 24436
298 Ga0373927_0027623 3300035695 Bacteria 3705
299 Ga0373927_0044757 3300035695 Bacteria 2863
300 Ga0373947_0003576 3300035725 Bacteria 9165
301 Ga0373947_0027236 3300035725 Bacteria 3345
302 Ga0373937_0049419 3300036401 Bacteria 3851
303 Ga0373937_0076066 3300036401 Bacteria 3100
304 Ga0373937_0269257 3300036401 Bacteria 1607
305 Ga0373925_0021417 3300037068 Bacteria 4710
306 Ga0395899_0154030 3300037312 Bacteria 1628
307 Ga0436365_1872887 3300039437 Bacteria 2561
308 Ga0466965_0046509 3300044683 Bacteria 2148
309 Ga0466957_0074209 3300044842 Bacteria 2109
310 Ga0466967_0008442 3300045976 Bacteria 7548
311 Ga0466967_0078090 3300045976 Bacteria 2982
312 Ga0466967_0219600 3300045976 Bacteria 1806
313 Ga0495603_0008240 3300046455 Bacteria 6298
314 Ga0495603_0043720 3300046455 Bacteria 2674
315 Ga0495590_0007890 3300046457 Bacteria 4082
316 Ga0495590_0077317 3300046457 Bacteria 1171
317 Ga0495629_0000524 3300046459 Bacteria 32047
318 Ga0495629_0004363 3300046459 Bacteria 10605
319 Ga0495638_0004521 3300046460 Bacteria 10538
320 Ga0495638_0055783 3300046460 Bacteria 2452
321 Ga0495641_0008724 3300046461 Bacteria 6128
322 Ga0495651_0018913 3300046462 Bacteria 5338
323 Ga0495653_0302176 3300046463 Bacteria 1043
324 Ga0495580_0004882 3300046472 Bacteria 11211
325 Ga0495582_0008830 3300046473 Bacteria 5558
326 Ga0495582_0190655 3300046473 Bacteria 1169
327 Ga0495639_0000276 3300046475 Bacteria 25317
328 Ga0495664_0039581 3300046477 Bacteria 2786
329 Ga0495664_0090456 3300046477 Bacteria 1840
330 Ga0495664_0182522 3300046477 Bacteria 1272
331 Ga0495584_0073681 3300046491 Bacteria 1716
332 Ga0495584_0109123 3300046491 Bacteria 1400
333 Ga0495594_0005521 3300046499 Bacteria 6494
334 Ga0495606_0002837 3300046507 Bacteria 19219
335 Ga0495606_0028152 3300046507 Bacteria 3969
336 Ga0495606_0077399 3300046507 Bacteria 2077
337 Ga0495606_0166616 3300046507 Bacteria 1282
338 Ga0495608_0093768 3300046511 Bacteria 1940
339 Ga0495610_0099046 3300046512 Bacteria 1309
340 Ga0495616_0032354 3300046513 Bacteria 2733
341 Ga0495616_0036067 3300046513 Bacteria 2554
342 Ga0495618_0016586 3300046514 Bacteria 4509
343 Ga0495628_0014375 3300046516 Bacteria 6635
344 Ga0495628_0023567 3300046516 Bacteria 5051
345 Ga0495630_0010766 3300046517 Bacteria 6604
346 Ga0495630_0558202 3300046517 Bacteria 878
347 Ga0495632_0143071 3300046519 Bacteria 1108
348 Ga0495637_0116024 3300046520 Bacteria 1034
349 Ga0495643_0025007 3300046522 Bacteria 3382
350 Ga0495644_0033171 3300046523 Bacteria 1951
351 Ga0495648_0035296 3300046524 Bacteria 3242
352 Ga0495666_0064824 3300046526 Bacteria 1743
353 Ga0495652_0013727 3300046529 Bacteria 7287
354 Ga0495652_0106748 3300046529 Bacteria 2260
355 Ga0495665_0000150 3300046531 Bacteria 34308
356 Ga0495640_0011066 3300046533 Bacteria 6947
357 Ga0495640_0017606 3300046533 Bacteria 5320
358 Ga0495640_0097653 3300046533 Bacteria 1931
359 Ga0495586_0111342 3300046535 Bacteria 1524
360 Ga0495586_0121243 3300046535 Bacteria 1461
361 Ga0495587_0019697 3300046536 Bacteria 4173
362 Ga0495587_0247500 3300046536 Bacteria 1002
363 Ga0495597_0163631 3300046542 Bacteria 906
364 Ga0495645_0039441 3300046543 Bacteria 3444
365 Ga0495645_0043419 3300046543 Bacteria 3279
366 Ga0495622_0015579 3300046557 Bacteria 3533
367 Ga0495622_0201209 3300046557 Bacteria 887
368 Ga0495667_0014289 3300046559 Bacteria 5362
369 Ga0495656_0030930 3300046615 Bacteria 2167
370 Ga0495656_0054301 3300046615 Bacteria 1723
371 Ga0495668_0019151 3300046616 Bacteria 3949
372 Ga0495668_0142157 3300046616 Bacteria 1313
373 Ga0495668_0154001 3300046616 Bacteria 1259
374 Ga0495668_0162762 3300046616 Bacteria 1222
375 Ga0495634_0004893 3300046642 Bacteria 10378
376 Ga0495634_0015787 3300046642 Bacteria 5415
377 Ga0495634_0029307 3300046642 Bacteria 3811
378 Ga0495625_0079890 3300046660 Bacteria 2279
379 Ga0495635_0002626 3300046663 Bacteria 12294
380 Ga0495635_0005141 3300046663 Bacteria 9107
381 Ga0495635_0007787 3300046663 Bacteria 7479
382 Ga0495635_0371434 3300046663 Bacteria 952
383 Ga0495661_0105763 3300046665 Bacteria 1576
384 Ga0495661_0164346 3300046665 Bacteria 1189
385 Ga0495588_0004538 3300046674 Bacteria 6138
386 Ga0495588_0018591 3300046674 Bacteria 3391
387 Ga0495599_0005278 3300046678 Bacteria 7710
388 Ga0495599_0020388 3300046678 Bacteria 4129
389 Ga0495599_0244759 3300046678 Bacteria 1093
390 Ga0495623_0014426 3300046679 Bacteria 5114
391 Ga0495623_0117249 3300046679 Bacteria 1607
392 Ga0495646_0091015 3300046680 Bacteria 1761
393 Ga0495658_0000284 3300046683 Bacteria 28686
394 Ga0495669_0014032 3300046684 Bacteria 3424
395 Ga0495669_0015724 3300046684 Bacteria 3240
396 Ga0495669_0021325 3300046684 Bacteria 2811
397 Ga0495613_0009661 3300046689 Bacteria 7166
398 Ga0495613_0011769 3300046689 Bacteria 6502
399 Ga0495613_0019087 3300046689 Bacteria 5110
400 Ga0495624_0003963 3300046690 Bacteria 10899
401 Ga0495624_0023966 3300046690 Bacteria 4020
402 Ga0495624_0248840 3300046690 Bacteria 1075
403 Ga0495600_0004251 3300046809 Bacteria 8554
404 Ga0495600_0055059 3300046809 Bacteria 2598
405 Ga0495600_0064181 3300046809 Bacteria 2400
406 Ga0495581_0008972 3300047315 Bacteria 5787
407 Ga0495581_0331502 3300047315 Bacteria 888
408 Ga0495604_0002296 3300047317 Bacteria 15315
409 Ga0495604_0003363 3300047317 Bacteria 12756
410 Ga0495604_0022456 3300047317 Bacteria 5037
411 Ga0495604_0223340 3300047317 Bacteria 1296
412 Ga0495674_0004847 3300047319 Bacteria 12942
413 Ga0495674_0010106 3300047319 Bacteria 8943
414 Ga0495674_0012088 3300047319 Bacteria 8135
415 Ga0495674_0199778 3300047319 Bacteria 1659
416 Ga0495672_0020956 3300047320 Bacteria 4271
417 Ga0495672_0178669 3300047320 Bacteria 1076
418 Ga0495676_0080965 3300047321 Bacteria 2463
419 Ga0495676_0107642 3300047321 Bacteria 2052
420 Ga0495680_0016073 3300047322 Bacteria 6434
421 Ga0495683_0098892 3300047323 Bacteria 1405
422 Ga0495687_005898 3300047443 Bacteria 7664
423 Ga0495675_0229223 3300047444 Bacteria 1121
424 Ga0495684_0003054 3300047471 Bacteria 13169
425 Ga0495684_0065879 3300047471 Bacteria 2754
426 Ga0495686_0223562 3300047472 Bacteria 1070
427 Ga0495593_0008845 3300047673 Bacteria 5843
428 Ga0495593_0010892 3300047673 Bacteria 5239
429 Ga0495602_0041516 3300048088 Bacteria 4201
430 Ga0495602_0098163 3300048088 Bacteria 2411
431 Ga0495614_0046020 3300048089 Bacteria 1871
432 Ga0496101_0004141 3300048904 Bacteria 9081
433 Ga0496101_0524530 3300048904 Bacteria 936
434 Ga0496102_0001612 3300048905 Bacteria 19881
435 Ga0496102_0028443 3300048905 Bacteria 4993
436 Ga0496102_0032413 3300048905 Bacteria 4692
437 Ga0496102_0127903 3300048905 Bacteria 2376
438 Ga0496102_0443426 3300048905 Bacteria 1218
439 Ga0496103_0072028 3300048906 Bacteria 2164
440 Ga0496103_0130037 3300048906 Bacteria 1608
441 Ga0496104_0005606 3300048907 Bacteria 10989
442 Ga0496104_0034886 3300048907 Bacteria 4693
443 Ga0496104_0048269 3300048907 Bacteria 4014
444 Ga0496105_0004852 3300048908 Bacteria 10156
445 Ga0496105_0011256 3300048908 Bacteria 7060
446 Ga0496105_0087508 3300048908 Bacteria 2574
447 Ga0496105_0127782 3300048908 Bacteria 2095
448 Ga0496106_0008034 3300048909 Bacteria 7795
449 Ga0496106_0120546 3300048909 Bacteria 2050
450 Ga0496106_0407552 3300048909 Bacteria 1093
451 Ga0496107_0007098 3300048910 Bacteria 7719
452 Ga0496107_0221089 3300048910 Bacteria 1409
453 Ga0496108_0080408 3300048911 Bacteria 2760
454 Ga0496109_0049864 3300048912 Bacteria 3812
455 Ga0496109_0067986 3300048912 Bacteria 3265
456 Ga0496109_0136153 3300048912 Bacteria 2295
457 Ga0496109_0261488 3300048912 Bacteria 1630
458 Ga0496110_0088524 3300048913 Bacteria 2765
459 Ga0496110_0246659 3300048913 Bacteria 1625
460 Ga0496111_0004961 3300048914 Bacteria 8458
461 Ga0496112_0000111 3300048915 Bacteria 50958
462 Ga0496112_0017487 3300048915 Bacteria 6736
463 Ga0496112_0032777 3300048915 Bacteria 5044
464 Ga0496113_0009577 3300048916 Bacteria 6357
465 Ga0496113_0137376 3300048916 Bacteria 1921
466 Ga0496113_0237362 3300048916 Bacteria 1454
467 Ga0496114_0001820 3300048917 Bacteria 16179
468 Ga0496114_0028753 3300048917 Bacteria 4564
469 Ga0496114_0082281 3300048917 Bacteria 2721
470 Ga0496114_0182938 3300048917 Bacteria 1831
471 Ga0496114_0250922 3300048917 Bacteria 1557
472 Ga0496115_0001906 3300048918 Bacteria 14888
473 Ga0496115_0043246 3300048918 Bacteria 3592
474 Ga0496117_0004309 3300048920 Bacteria 15841
475 Ga0496117_0280689 3300048920 Bacteria 892
476 Ga0496118_0007639 3300048921 Bacteria 11387
477 Ga0496118_0019405 3300048921 Bacteria 6078
478 Ga0496118_0068670 3300048921 Bacteria 2572
479 Ga0496119_0009444 3300048922 Bacteria 8369
480 Ga0496119_0036936 3300048922 Bacteria 3181
481 Ga0496119_0174537 3300048922 Bacteria 1132
482 Ga0496120_0014931 3300048923 Bacteria 5145
483 Ga0496121_0000500 3300048924 Bacteria 74914
484 Ga0496121_0000595 3300048924 Bacteria 67907
485 Ga0496121_0020477 3300048924 Bacteria 6544
486 Ga0496121_0029976 3300048924 Bacteria 5009
487 Ga0496121_0047905 3300048924 Bacteria 3641
488 Ga0496121_0102459 3300048924 Bacteria 2205
489 Ga0496121_0138375 3300048924 Bacteria 1810
490 Ga0496122_0076084 3300048925 Bacteria 2364
491 Ga0496124_0004399 3300048927 Bacteria 16450
492 Ga0496124_0107569 3300048927 Bacteria 2250
493 Ga0496124_0208189 3300048927 Bacteria 1482
494 Ga0496125_0021747 3300048928 Bacteria 5970
495 Ga0496125_0073250 3300048928 Bacteria 2664
496 Ga0496126_0008306 3300048929 Bacteria 11212
497 Ga0496126_0010646 3300048929 Bacteria 9617
498 Ga0496126_0013437 3300048929 Bacteria 8326
499 Ga0496126_0025453 3300048929 Bacteria 5693
500 Ga0496126_0072424 3300048929 Bacteria 3065
501 Ga0496126_0107858 3300048929 Bacteria 2429
502 Ga0496126_0234286 3300048929 Bacteria 1537
503 Ga0501031_0001272 3300049568 Bacteria 15446
504 Ga0501032_0000257 3300049569 Bacteria 44325
505 Ga0501033_0004602 3300049570 Bacteria 11053
506 Ga0501033_0327382 3300049570 Bacteria 1076
507 Ga0501034_0000159 3300049571 Bacteria 127397
508 Ga0501036_0000039 3300049572 Bacteria 83065
509 Ga0501037_0001316 3300049573 Bacteria 18220
510 Ga0501038_0000207 3300049574 Bacteria 50307
511 Ga0501039_0000148 3300049575 Bacteria 47789
512 Ga0501042_0059098 3300049578 Bacteria 2738
513 Ga0501043_0000202 3300049579 Bacteria 54441
514 Ga0501047_0000288 3300049581 Bacteria 57965
515 Ga0501047_0411099 3300049581 Bacteria 1185
516 Ga0501048_0001300 3300049582 Bacteria 18963
517 Ga0501067_0000896 3300049583 Bacteria 16010
518 Ga0501067_0146967 3300049583 Bacteria 1313
519 Ga0501068_0003765 3300049584 Bacteria 8212
520 Ga0501069_0060842 3300049585 Bacteria 2108
521 Ga0501070_0000557 3300049586 Bacteria 34014
522 Ga0501071_0099188 3300049587 Bacteria 2146
523 Ga0501072_0001033 3300049588 Bacteria 20627
524 Ga0501073_0000034 3300049589 Bacteria 95224
525 Ga0501073_0014114 3300049589 Bacteria 5803
526 Ga0501074_0004133 3300049590 Bacteria 10356
527 Ga0501074_0061878 3300049590 Bacteria 2697
528 Ga0501079_0010335 3300049741 Bacteria 7091
529 Ga0501080_0011296 3300049742 Bacteria 8174
530 Ga0501080_0041622 3300049742 Bacteria 4280
531 Ga0501083_0000118 3300049744 Bacteria 54096
532 Ga0501035_0000137 3300049822 Bacteria 89273
533 Ga0501044_0000431 3300049823 Bacteria 51668
534 Ga0501044_0335366 3300049823 Bacteria 1434
535 Ga0501044_0456091 3300049823 Bacteria 1184
536 Ga0501045_0015065 3300049824 Bacteria 5488
537 nmdc:mga03n38_241362_c1 3300050490 Bacteria 951
538 nmdc:mga0yw44_107537_c1 3300050492 Bacteria 1784
539 nmdc:mga0yw44_134725_c1 3300050492 Bacteria 1602
540 nmdc:mga0yw44_93197_c1 3300050492 Bacteria 1907
541 nmdc:mga0k408_187735_c1 3300050493 Bacteria 1233
542 nmdc:mga0k408_99217_c1 3300050493 Bacteria 1716
543 nmdc:mga06z11_121613_c1 3300050494 Bacteria 1457
544 nmdc:mga07m45_356628_c1 3300050496 Bacteria 850
545 nmdc:mga07m45_88209_c2 3300050496 Bacteria 1387
546 nmdc:mga08y16_365061_c1 3300050511 Bacteria 1482
547 nmdc:mga0n895_459470_c1 3300050512 Bacteria 1285
548 nmdc:mga0sz30_104461_c1 3300050516 Bacteria 1239
549 Ga0495601_0051292 3300053077 Bacteria 2604
550 Ga0495601_0098627 3300053077 Bacteria 1886
551 Ga0500610_0038109 3300053079 Bacteria 2477
552 Ga0500635_0005108 3300053080 Bacteria 3424
553 Ga0500635_0017297 3300053080 Bacteria 2157
554 Ga0500635_0051040 3300053080 Bacteria 1417
555 Ga0500635_0084300 3300053080 Bacteria 1147
556 Ga0495595_0015904 3300053084 Bacteria 3212
557 Ga0495619_0029673 3300053085 Bacteria 3535
558 Ga0500651_0034761 3300053093 Bacteria 3176
559 Ga0500566_0000365 3300053094 Bacteria 24720
560 Ga0500566_0025219 3300053094 Bacteria 3486
561 Ga0500566_0084305 3300053094 Bacteria 1764
562 Ga0500640_083387 3300053095 Bacteria 1352
563 Ga0500641_0012783 3300053096 Bacteria 3073
564 Ga0500641_0076946 3300053096 Bacteria 1412
565 Ga0500554_007762 3300053102 Bacteria 2485
566 Ga0500572_000489 3300053111 Bacteria 13636
567 Ga0500594_0020755 3300053118 Bacteria 1642
568 Ga0500595_000621 3300053119 Bacteria 21205
569 Ga0500595_005790 3300053119 Bacteria 5336
570 Ga0500595_023061 3300053119 Bacteria 2192
571 Ga0500614_023257 3300053123 Bacteria 1455
572 Ga0500642_0005776 3300053130 Bacteria 4022
573 Ga0500559_0035254 3300053136 Bacteria 2160
574 Ga0500559_0053831 3300053136 Bacteria 1782
575 Ga0500568_0004098 3300053139 Bacteria 7891
576 Ga0500573_0102370 3300053140 Bacteria 1610
577 Ga0500603_000169 3300053150 Bacteria 16499
578 Ga0500604_0108554 3300053151 Bacteria 920
579 Ga0500616_0018358 3300053153 Bacteria 3957
580 Ga0500619_012484 3300053154 Bacteria 2222
581 Ga0500622_0018744 3300053156 Bacteria 3677
582 Ga0500622_0022016 3300053156 Bacteria 3381
583 Ga0500638_025777 3300053162 Bacteria 2812
584 Ga0500636_0002854 3300053177 Bacteria 9650
585 Ga0500636_0006333 3300053177 Bacteria 6792
586 Ga0500636_0150286 3300053177 Bacteria 1280
587 Ga0500637_0002118 3300053178 Bacteria 8708
588 Ga0500637_0126278 3300053178 Bacteria 1483
589 Ga0500637_0128676 3300053178 Bacteria 1468
590 Ga0500596_003396 3300053735 Bacteria 3034
591 Ga0500599_005772 3300053736 Bacteria 1562
592 Ga0501084_0002041 3300054114 Bacteria 16122
593 Ga0500661_006039 3300055283 Bacteria 2258
594 Ga0501082_0002604 3300060353 Bacteria 15767
595 2507511142 2507262055 Bacteria 8048963
596 2508693689 2508501042 Bacteria 8719808
597 2509153439 2508501128 Bacteria 8613869
598 2513655146 2513237096 Bacteria 8722461
599 2513693360 2513237101 Bacteria 7952346
600 2513861400 2513237137 Bacteria 9558895
601 2513915831 2513237145 Bacteria 8979722
602 2514010515 2513237161 Bacteria 8871253
603 2517894865 2517572143 Bacteria 9484767
604 2524534632 2524023228 Bacteria 10118060
605 2617353541 2617270735 Bacteria 9163226
606 2671119279 2667528175 Bacteria 7532676
607 2728747469 2728368998 Bacteria 8720350
608 2793071954 2791355197 Bacteria 8420563
609 2793083218
610 2805916767 2802429603 Bacteria 8777136
611 2824675188 2824671348 Bacteria 8369588
612 2824691467 2824687955 Bacteria 8360029
613 2824773434 2824773399 Bacteria 8360218
614 2847944119 2847939898 Bacteria 8606328
615 2874626158 2874620515 Bacteria 8290088
616 2876809697 2876808645 Bacteria 8824342
617 2879111000 2879110137 Bacteria 8907982
618 2885375466 2885374607 Bacteria 8927485
619 2885412577 2885409591 Bacteria 9235467
620 2889037210 2889033259 Bacteria 9099371
621 2904669176 2904666416 Bacteria 8226587
622 2906611597
623 2908745176 2908739725 Bacteria 8628932
624 2922427749
625 2929619443 2929615660 Bacteria 9193770
626 2929628087 2929624759 Bacteria 9339455
627 2933581363 2933577622 Bacteria 9116884
628 2935612628 2935608549 Bacteria 8203142
629 2935653476 2935648319 Bacteria 8801166
630 2935662225 2935656913 Bacteria 8965014
631 2935677707 2935675223 Bacteria 9928132
632 2935784575 2935777560 Bacteria 8077691
633 2935824117 2935819856 Bacteria 8261050
634 2935842605 2935837841 Bacteria 9454360
635 2935852736 2935847175 Bacteria 8228321
636 2935912112 2935908558 Bacteria 8568796
637 2935929141 2935926038 Bacteria 8601059
638 2935935772 2935934488 Bacteria 8602579
639 2935947338 2935942939 Bacteria 8599779
640 2935953568 2935951376 Bacteria 8602333
641 2935961921 2935959822 Bacteria 7869783
642 2935968594 2935967501 Bacteria 8603075
643 2935990424 2935984226 Bacteria 8302647
644 2936016527 2936011229 Bacteria 8801034
645 2936025159 2936019824 Bacteria 8804134
646 2936034002 2936028420 Bacteria 8965941
647 2936052058 2936046547 Bacteria 8903709
648 2936059831 2936055302 Bacteria 8785755
649 2941544548 2941538514 Bacteria 9402094
650 3005477467 3005474847 Bacteria 9259049
651 3005511390 3005506211 Bacteria 6943378
652 3005719551 3005718088 Bacteria 8283608
653 8006933766 8006933436 Bacteria 10410654
654 8006969574 8006964411 Bacteria 8966052
655 8006983438 8006973647 Bacteria 10679141
656 8006988787 8006984368 Bacteria 9651211
657 8016523980 8016522445 Bacteria 8156687
658 8016541783 8016539877 Bacteria 8155419
659 8016551487 8016548790 Bacteria 8155074
660 8016559873 8016557553 Bacteria 8154380
661 8016567171 8016566248 Bacteria 8158151
662 8016579890 8016575299 Bacteria 8154085
663 8016597808 8016595262 Bacteria 8149947
664 8016620520 8016613128 Bacteria 8794220
665 8016629468 8016622563 Bacteria 7999408
666 8016637929 8016630954 Bacteria 9217207
667 8019537192 8019530166 Bacteria 8155624
668 8019542353 8019538911 Bacteria 7872763
669 8019548405 8019547302 Bacteria 7996444
670 8019559695 8019555841 Bacteria 9642137
671 8019694254 8019687851 Bacteria 8712826
672 8055749300 8055742211 Bacteria 9226248
673 8056675825 8056673599 Bacteria 7871253
674 8056693157 8056689827 Bacteria 6712655
675 Ga0373943_0018624
676 JGI25165J46597_1009555
677 rootH2_10144904
678 JGI25404J52841_10004652
679 JGI25404J52841_10035186
680 Ga0065707_10295803
681 Ga0070658_10124610
682 Ga0070658_10148275
683 Ga0070658_10206761
684 Ga0070683_100211378
685 Ga0070690_100140343
686 Ga0070670_100074468
687 Ga0070670_100295537
688 Ga0068869_100369642
689 Ga0070680_100016170
690 Ga0070680_100017832
691 Ga0070680_100040761
692 Ga0070680_100072730
693 Ga0070682_100068721
694 Ga0068868_100004520
695 Ga0068868_100777961
696 Ga0070689_100512664
697 Ga0070661_100343533
698 Ga0070668_100025123
699 Ga0070669_100382644
700 Ga0070671_100291911
701 Ga0070674_100015279
702 Ga0070674_100024950
703 Ga0070688_100312769
704 Ga0070667_100339405
705 Ga0070667_100658865
706 Ga0070709_10009481
707 Ga0070709_10022406
708 Ga0070713_100057175
709 Ga0070713_100066981
710 Ga0070713_100257053
711 Ga0070710_10012718
712 Ga0070710_10073404
713 Ga0070711_100006317
714 Ga0070711_100165448
715 Ga0070711_100274184
716 Ga0070663_100007143
717 Ga0070663_100146256
718 Ga0070663_100159888
719 Ga0070663_100287335
720 Ga0070678_100004657
721 Ga0070678_100027471
722 Ga0070678_100092212
723 Ga0070662_100082889
724 Ga0070681_10013002
725 Ga0070681_10024950
726 Ga0070681_10119463
727 Ga0070681_10573215
728 Ga0068867_100112861
729 Ga0070706_100315871
730 Ga0070698_100023197
731 Ga0070679_100004371
732 Ga0070679_100042435
733 Ga0070684_100020742
734 Ga0070684_100463366
735 Ga0070697_100155390
736 Ga0068853_100007746
737 Ga0068853_100228067
738 Ga0068853_100308360
739 Ga0070672_100290602
740 Ga0070686_100022580
741 Ga0070693_100178536
742 Ga0068855_100036422
743 Ga0068855_100131119
744 Ga0068855_100258589
745 Ga0068857_100090006
746 Ga0068857_100443619
747 Ga0068854_100112324
748 Ga0068854_100596157
749 Ga0068856_100000799
750 Ga0068856_100060606
751 Ga0068856_100333077
752 Ga0068852_100031844
753 Ga0068852_100056070
754 Ga0068852_100084715
755 Ga0068852_100157225
756 Ga0068861_100178974
757 Ga0068851_10132799
758 Ga0068851_10234912
759 Ga0068858_100162350
760 Ga0068858_100181777
761 Ga0068858_100188838
762 Ga0068860_100000737
763 Ga0068862_100119542
764 Ga0081455_10084524
765 Ga0081540_1002603
766 Ga0081540_1003426
767 Ga0081540_1007984
768 Ga0081540_1010685
769 Ga0081540_1016183
770 Ga0081540_1066797
771 Ga0081539_10000172
772 Ga0075365_10043464
773 Ga0075365_10056316
774 Ga0075365_10229289
775 Ga0075368_10012359
776 Ga0075368_10030028
777 Ga0075364_10231317
778 Ga0070716_100037183
779 Ga0070712_100016896
780 Ga0075367_10130576
781 Ga0075369_10016203
782 Ga0097621_100140831
783 Ga0097621_100517627
784 Ga0068871_100130075
785 Ga0068871_100193254
786 Ga0068871_100205688
787 Ga0099794_10043122
788 Ga0099794_10048597
789 Ga0099795_10035126
790 Ga0105240_10009861
791 Ga0105240_10023910
792 Ga0111539_10110345
793 Ga0105245_10006924
794 Ga0105247_10012998
795 Ga0105247_10035576
796 Ga0105243_10037305
797 Ga0105242_10132360
798 Ga0105248_10098851
799 Ga0105248_10215379
800 Ga0105237_10083609
801 Ga0105237_10134648
802 Ga0105238_10025651
803 Ga0105238_10326276
804 Ga0105238_10372068
805 Ga0105249_10358666
806 Ga0099796_10068559
807 Ga0105239_10050676
808 Ga0105239_10125084
809 Ga0105239_10916695
810 Ga0105246_10001811
811 Ga0157371_10087642
812 Ga0157370_10025034
813 Ga0157370_10145716
814 Ga0157369_10067578
815 Ga0157369_10177177
816 Ga0157374_10072046
817 Ga0157374_10222930
818 Ga0163162_10006184
819 Ga0163162_10216808
820 Ga0157372_10312234
821 Ga0157372_10957711
822 Ga0157375_10016118
823 Ga0157375_10038520
824 Ga0157375_10781438
825 Ga0163163_10016611
826 Ga0163163_10401316
827 Ga0157380_10721724
828 Ga0157376_10050808
829 Ga0157376_10051218
830 Ga0213876_10132769
831 Ga0209677_100713
832 Ga0209233_1007304
833 Ga0209455_1004092
834 Ga0209758_1039511
835 Ga0207426_1000534
836 Ga0209257_1011601
837 Ga0207697_10021876
838 Ga0207656_10084686
839 Ga0207656_10143957
840 Ga0207692_10062606
841 Ga0207692_10136770
842 Ga0207688_10035748
843 Ga0207647_10003512
844 Ga0207643_10183587
845 Ga0207705_10090701
846 Ga0207705_10496090
847 Ga0207707_10001897
848 Ga0207707_10007545
849 Ga0207707_10022037
850 Ga0207707_10178941
851 Ga0207695_10053065
852 Ga0207695_10161383
853 Ga0207695_10405980
854 Ga0207671_10041203
855 Ga0207671_10171834
856 Ga0207693_10005591
857 Ga0207693_10042547
858 Ga0207663_10124009
859 Ga0207660_10006849
860 Ga0207660_10101737
861 Ga0207657_10063310
862 Ga0207649_10490758
863 Ga0207652_10008027
864 Ga0207652_10066249
865 Ga0207681_10235937
866 Ga0207681_10301413
867 Ga0207694_10005588
868 Ga0207694_10482792
869 Ga0207687_10211817
870 Ga0207687_10741121
871 Ga0207700_10044071
872 Ga0207700_10048616
873 Ga0207700_10076270
874 Ga0207644_10165054
875 Ga0207690_10424428
876 Ga0207706_10029036
877 Ga0207709_10054620
878 Ga0207709_10436123
879 Ga0207670_10232673
880 Ga0207669_10027178
881 Ga0207669_10325001
882 Ga0207669_10678011
883 Ga0207704_10070766
884 Ga0207665_10076528
885 Ga0207665_10255718
886 Ga0207691_10223781
887 Ga0207711_10101009
888 Ga0207711_10268412
889 Ga0207711_10430830
890 Ga0207661_10032573
891 Ga0207661_10077927
892 Ga0207679_10046923
893 Ga0207679_10625367
894 Ga0207667_10081655
895 Ga0207667_10166723
896 Ga0207668_10095484
897 Ga0207668_10376111
898 Ga0207640_10103073
899 Ga0207677_10010709
900 Ga0207703_10058263
901 Ga0207703_10227666
902 Ga0207639_10080123
903 Ga0207639_10379087
904 Ga0207639_10837204
905 Ga0207678_10030249
906 Ga0207678_10060959
907 Ga0207678_10062181
908 Ga0207678_10126017
909 Ga0207702_10000052
910 Ga0207702_10078464
911 Ga0207702_10310836
912 Ga0207648_10051479
913 Ga0207648_10110776
914 Ga0207674_10028377
915 Ga0207674_10155933
916 Ga0207674_10169828
917 Ga0207675_100070885
918 Ga0207675_100156396
919 Ga0207683_10005293
920 Ga0207683_10007091
921 Ga0207683_10076533
922 Ga0207683_10133638
923 Ga0209589_1000007
924 Ga0209489_100008
925 Ga0209700_100009
926 Ga0209179_1026397
927 Ga0268266_10294454
928 Ga0268265_10477968
929 Ga0268264_10000158
930 Ga0307517_10000248
931 Ga0307515_10016931
932 Ga0307515_10368081
933 Ga0265330_10052153
934 Ga0265330_10054773
935 Ga0265325_10055343
936 Ga0265340_10153215
937 Ga0265339_10003666
938 Ga0265316_10205312
939 Ga0307513_10217019
940 Ga0307509_10030512
941 Ga0307408_100275364
942 Ga0307508_10000184
943 Ga0265314_10287702
944 Ga0265342_10067417
945 Ga0265342_10107072
946 Ga0307516_10013426
947 Ga0307516_10349052
948 Ga0307406_10113662
949 Ga0307414_10276629
950 Ga0307415_100047317
951 Ga0307507_10019790
952 Ga0307510_10323032
953 Ga0373934_0014983
954 Ga0373944_0122163
955 Ga0373923_0017213
956 Ga0373923_0020312
957 Ga0373945_0032469
958 Ga0373953_0010187
959 Ga0373954_0000367
960 Ga0373954_0043749
961 Ga0373954_0085725
962 Ga0373956_0040230
963 Ga0373957_0148428
964 Ga0373955_0000688
965 Ga0373955_0006769
966 Ga0373924_0010934
967 Ga0373924_0015046
968 Ga0373924_0028142
969 Ga0373931_0011731
970 Ga0373935_0245084
971 Ga0373927_0000775
972 Ga0373927_0027623
973 Ga0373927_0044757
974 Ga0373947_0003576
975 Ga0373947_0027236
976 Ga0373937_0049419
977 Ga0373937_0076066
978 Ga0373937_0269257
979 Ga0373925_0021417
980 Ga0395899_0154030
981 Ga0436365_1872887
982 Ga0466965_0046509
983 Ga0466957_0074209
984 Ga0466967_0008442
985 Ga0466967_0078090
986 Ga0466967_0219600
987 Ga0495603_0008240
988 Ga0495603_0043720
989 Ga0495590_0007890
990 Ga0495590_0077317
991 Ga0495629_0000524
992 Ga0495629_0004363
993 Ga0495638_0004521
994 Ga0495638_0055783
995 Ga0495641_0008724
996 Ga0495651_0018913
997 Ga0495653_0302176
998 Ga0495580_0004882
999 Ga0495582_0008830
1000 Ga0495582_0190655
1001 Ga0495639_0000276
1002 Ga0495664_0039581
1003 Ga0495664_0090456
1004 Ga0495664_0182522
1005 Ga0495584_0073681
1006 Ga0495584_0109123
1007 Ga0495594_0005521
1008 Ga0495606_0002837
1009 Ga0495606_0028152
1010 Ga0495606_0077399
1011 Ga0495606_0166616
1012 Ga0495608_0093768
1013 Ga0495610_0099046
1014 Ga0495616_0032354
1015 Ga0495616_0036067
1016 Ga0495618_0016586
1017 Ga0495628_0014375
1018 Ga0495628_0023567
1019 Ga0495630_0010766
1020 Ga0495630_0558202
1021 Ga0495632_0143071
1022 Ga0495637_0116024
1023 Ga0495643_0025007
1024 Ga0495644_0033171
1025 Ga0495648_0035296
1026 Ga0495666_0064824
1027 Ga0495652_0013727
1028 Ga0495652_0106748
1029 Ga0495665_0000150
1030 Ga0495640_0011066
1031 Ga0495640_0017606
1032 Ga0495640_0097653
1033 Ga0495586_0111342
1034 Ga0495586_0121243
1035 Ga0495587_0019697
1036 Ga0495587_0247500
1037 Ga0495597_0163631
1038 Ga0495645_0039441
1039 Ga0495645_0043419
1040 Ga0495622_0015579
1041 Ga0495622_0201209
1042 Ga0495667_0014289
1043 Ga0495656_0030930
1044 Ga0495656_0054301
1045 Ga0495668_0019151
1046 Ga0495668_0142157
1047 Ga0495668_0154001
1048 Ga0495668_0162762
1049 Ga0495634_0004893
1050 Ga0495634_0015787
1051 Ga0495634_0029307
1052 Ga0495625_0079890
1053 Ga0495635_0002626
1054 Ga0495635_0005141
1055 Ga0495635_0007787
1056 Ga0495635_0371434
1057 Ga0495661_0105763
1058 Ga0495661_0164346
1059 Ga0495588_0004538
1060 Ga0495588_0018591
1061 Ga0495599_0005278
1062 Ga0495599_0020388
1063 Ga0495599_0244759
1064 Ga0495623_0014426
1065 Ga0495623_0117249
1066 Ga0495646_0091015
1067 Ga0495658_0000284
1068 Ga0495669_0014032
1069 Ga0495669_0015724
1070 Ga0495669_0021325
1071 Ga0495613_0009661
1072 Ga0495613_0011769
1073 Ga0495613_0019087
1074 Ga0495624_0003963
1075 Ga0495624_0023966
1076 Ga0495624_0248840
1077 Ga0495600_0004251
1078 Ga0495600_0055059
1079 Ga0495600_0064181
1080 Ga0495581_0008972
1081 Ga0495581_0331502
1082 Ga0495604_0002296
1083 Ga0495604_0003363
1084 Ga0495604_0022456
1085 Ga0495604_0223340
1086 Ga0495674_0004847
1087 Ga0495674_0010106
1088 Ga0495674_0012088
1089 Ga0495674_0199778
1090 Ga0495672_0020956
1091 Ga0495672_0178669
1092 Ga0495676_0080965
1093 Ga0495676_0107642
1094 Ga0495680_0016073
1095 Ga0495683_0098892
1096 Ga0495687_005898
1097 Ga0495675_0229223
1098 Ga0495684_0003054
1099 Ga0495684_0065879
1100 Ga0495686_0223562
1101 Ga0495593_0008845
1102 Ga0495593_0010892
1103 Ga0495602_0041516
1104 Ga0495602_0098163
1105 Ga0495614_0046020
1106 Ga0496101_0004141
1107 Ga0496101_0524530
1108 Ga0496102_0001612
1109 Ga0496102_0028443
1110 Ga0496102_0032413
1111 Ga0496102_0127903
1112 Ga0496102_0443426
1113 Ga0496103_0072028
1114 Ga0496103_0130037
1115 Ga0496104_0005606
1116 Ga0496104_0034886
1117 Ga0496104_0048269
1118 Ga0496105_0004852
1119 Ga0496105_0011256
1120 Ga0496105_0087508
1121 Ga0496105_0127782
1122 Ga0496106_0008034
1123 Ga0496106_0120546
1124 Ga0496106_0407552
1125 Ga0496107_0007098
1126 Ga0496107_0221089
1127 Ga0496108_0080408
1128 Ga0496109_0049864
1129 Ga0496109_0067986
1130 Ga0496109_0136153
1131 Ga0496109_0261488
1132 Ga0496110_0088524
1133 Ga0496110_0246659
1134 Ga0496111_0004961
1135 Ga0496112_0000111
1136 Ga0496112_0017487
1137 Ga0496112_0032777
1138 Ga0496113_0009577
1139 Ga0496113_0137376
1140 Ga0496113_0237362
1141 Ga0496114_0001820
1142 Ga0496114_0028753
1143 Ga0496114_0082281
1144 Ga0496114_0182938
1145 Ga0496114_0250922
1146 Ga0496115_0001906
1147 Ga0496115_0043246
1148 Ga0496117_0004309
1149 Ga0496117_0280689
1150 Ga0496118_0007639
1151 Ga0496118_0019405
1152 Ga0496118_0068670
1153 Ga0496119_0009444
1154 Ga0496119_0036936
1155 Ga0496119_0174537
1156 Ga0496120_0014931
1157 Ga0496121_0000500
1158 Ga0496121_0000595
1159 Ga0496121_0020477
1160 Ga0496121_0029976
1161 Ga0496121_0047905
1162 Ga0496121_0102459
1163 Ga0496121_0138375
1164 Ga0496122_0076084
1165 Ga0496124_0004399
1166 Ga0496124_0107569
1167 Ga0496124_0208189
1168 Ga0496125_0021747
1169 Ga0496125_0073250
1170 Ga0496126_0008306
1171 Ga0496126_0010646
1172 Ga0496126_0013437
1173 Ga0496126_0025453
1174 Ga0496126_0072424
1175 Ga0496126_0107858
1176 Ga0496126_0234286
1177 Ga0501031_0001272
1178 Ga0501032_0000257
1179 Ga0501033_0004602
1180 Ga0501033_0327382
1181 Ga0501034_0000159
1182 Ga0501036_0000039
1183 Ga0501037_0001316
1184 Ga0501038_0000207
1185 Ga0501039_0000148
1186 Ga0501042_0059098
1187 Ga0501043_0000202
1188 Ga0501047_0000288
1189 Ga0501047_0411099
1190 Ga0501048_0001300
1191 Ga0501067_0000896
1192 Ga0501067_0146967
1193 Ga0501068_0003765
1194 Ga0501069_0060842
1195 Ga0501070_0000557
1196 Ga0501071_0099188
1197 Ga0501072_0001033
1198 Ga0501073_0000034
1199 Ga0501073_0014114
1200 Ga0501074_0004133
1201 Ga0501074_0061878
1202 Ga0501079_0010335
1203 Ga0501080_0011296
1204 Ga0501080_0041622
1205 Ga0501083_0000118
1206 Ga0501035_0000137
1207 Ga0501044_0000431
1208 Ga0501044_0335366
1209 Ga0501044_0456091
1210 Ga0501045_0015065
1211 nmdc:mga03n38_241362_c1
1212 nmdc:mga0yw44_107537_c1
1213 nmdc:mga0yw44_134725_c1
1214 nmdc:mga0yw44_93197_c1
1215 nmdc:mga0k408_187735_c1
1216 nmdc:mga0k408_99217_c1
1217 nmdc:mga06z11_121613_c1
1218 nmdc:mga07m45_356628_c1
1219 nmdc:mga07m45_88209_c2
1220 nmdc:mga08y16_365061_c1
1221 nmdc:mga0n895_459470_c1
1222 nmdc:mga0sz30_104461_c1
1223 Ga0495601_0051292
1224 Ga0495601_0098627
1225 Ga0500610_0038109
1226 Ga0500635_0005108
1227 Ga0500635_0017297
1228 Ga0500635_0051040
1229 Ga0500635_0084300
1230 Ga0495595_0015904
1231 Ga0495619_0029673
1232 Ga0500651_0034761
1233 Ga0500566_0000365
1234 Ga0500566_0025219
1235 Ga0500566_0084305
1236 Ga0500640_083387
1237 Ga0500641_0012783
1238 Ga0500641_0076946
1239 Ga0500554_007762
1240 Ga0500572_000489
1241 Ga0500594_0020755
1242 Ga0500595_000621
1243 Ga0500595_005790
1244 Ga0500595_023061
1245 Ga0500614_023257
1246 Ga0500642_0005776
1247 Ga0500559_0035254
1248 Ga0500559_0053831
1249 Ga0500568_0004098
1250 Ga0500573_0102370
1251 Ga0500603_000169
1252 Ga0500604_0108554
1253 Ga0500616_0018358
1254 Ga0500619_012484
1255 Ga0500622_0018744
1256 Ga0500622_0022016
1257 Ga0500638_025777
1258 Ga0500636_0002854
1259 Ga0500636_0006333
1260 Ga0500636_0150286
1261 Ga0500637_0002118
1262 Ga0500637_0126278
1263 Ga0500637_0128676
1264 Ga0500596_003396
1265 Ga0500599_005772
1266 Ga0501084_0002041
1267 Ga0500661_006039
1268 Ga0501082_0002604
1269 2507511142
1270 2508693689
1271 2509153439
1272 2513655146
1273 2513693360
1274 2513861400
1275 2513915831
1276 2514010515
1277 2517894865
1278 2524534632
1279 2617353541
1280 2671119279
1281 2728747469
1282 2793071954
1283 2793083218
1284 2805916767
1285 2824675188
1286 2824691467
1287 2824773434
1288 2847944119
1289 2874626158
1290 2876809697
1291 2879111000
1292 2885375466
1293 2885412577
1294 2889037210
1295 2904669176
1296 2906611597
1297 2908745176
1298 2922427749
1299 2929619443
1300 2929628087
1301 2933581363
1302 2935612628
1303 2935653476
1304 2935662225
1305 2935677707
1306 2935784575
1307 2935824117
1308 2935842605
1309 2935852736
1310 2935912112
1311 2935929141
1312 2935935772
1313 2935947338
1314 2935953568
1315 2935961921
1316 2935968594
1317 2935990424
1318 2936016527
1319 2936025159
1320 2936034002
1321 2936052058
1322 2936059831
1323 2941544548
1324 3005477467
1325 3005511390
1326 3005719551
1327 8006933766
1328 8006969574
1329 8006983438
1330 8006988787
1331 8016523980
1332 8016541783
1333 8016551487
1334 8016559873
1335 8016567171
1336 8016579890
1337 8016597808
1338 8016620520
1339 8016629468
1340 8016637929
1341 8019537192
1342 8019542353
1343 8019548405
1344 8019559695
1345 8019694254
1346 8055749300
1347 8056675825
1348 8056693157

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00497

SBP_bac_3

Bacterial extracellular solute-binding proteins, family 3

97

314

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6q3u-assembly1.cif.gz_A gly52ala mutant of arginine-bound argbp from t. maritima 0.8743 31 241
4zv1-assembly1.cif.gz_A an ancestral arginine-binding protein bound to arginine 0.87 37 255
4ymx-assembly2.cif.gz_B crystal structure of the substrate binding protein of an amino acid abc transporter 0.8642 37 255
8hnj-assembly2.cif.gz_B domain-stabilized glutamine-binding protein 0.8617 38 255
4g4p-assembly1.cif.gz_A crystal structure of glutamine-binding protein from enterococcus faecalis at 1.5 a 0.8596 38 255
ID Description Score Start End Superfamily
5l9mA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9147 126 213 3.40.190.10
af_P30860_108_189_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9128 126 209 3.40.190.10
2y7iB02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9122 126 214 3.40.190.10
5eyfB02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9034 124 216 3.40.190.10
af_P30860_108_189_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8924 126 209 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A7S7Z3J0-F1-model_v4 Amino acid ABC transporter substrate-binding protein 0.9926 21 265 GO:0030313
AF-A0A7S7Z3J0-F1-model_v4 Amino acid ABC transporter substrate-binding protein 0.9767 21 265 GO:0030313
AF-A0A2N2RJU0-F1-model_v4 ABC transporter substrate-binding protein 0.9683 29 263 GO:0030313
AF-A0A0Q7TT95-F1-model_v4 Solute-binding protein family 3/N-terminal domain-containing protein 0.9653 30 263 GO:0030313
AF-A0A4R3LX53-F1-model_v4 Amino acid ABC transporter substrate-binding protein (PAAT family) 0.9605 28 263 GO:0030313

Map