F474358

General Info

Members Datasets Scaffolds Average Seq Length
674 390 1348 206

Family's Representative Sequence

Representative Sequence 3300007788|Ga0099795_10129105|Ga0099795_101291051
Length 229
Sequence MDPKTTAVVLIEFQNDFTTPRGVFHDVVKDVMQSTNMLAHTVKVANAARAAGAAVMHVAISFADGYRELGHPYGILKDVADNQAFRKDTWGAAIVEVLKPQPDDIVIEGKRGLDAFASTNLDFILRHKGIRTVALAGFLTNVCVESTMRSAYERGFDVVTLKDCTATLSQAAQDAALAHSFGVFSHPMNHDEFLKRLAPRPSRRVPRSANGRDLLLGAMPCGPDSDTTH

Samples

Sample ID Description Type Environment
1 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
69 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
71 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
72 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
76 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
88 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
104 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
105 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
106 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
113 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
114 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
115 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
116 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
117 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
118 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
121 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
122 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
123 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
124 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
180 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
184 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
185 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
186 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
187 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
188 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
189 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
190 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
191 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
192 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
193 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
194 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
195 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
196 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
197 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
198 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
199 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
200 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
201 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
202 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
203 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
204 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
205 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
206 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
207 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
208 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
209 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
210 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
211 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
212 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
213 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
214 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
215 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
216 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
217 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
218 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
219 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
220 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
221 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
222 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
223 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
224 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
225 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
226 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
227 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
228 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
229 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
230 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
231 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
232 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
233 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
234 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
235 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
236 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
237 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
238 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
239 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
240 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
241 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
242 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
243 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
244 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
245 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
246 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
247 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
248 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
249 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
250 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
251 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
252 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
253 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
254 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
255 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
256 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
257 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
258 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
259 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
260 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
261 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
262 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
263 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
264 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
265 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
266 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
267 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
268 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
269 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
270 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
271 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
272 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
273 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
274 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
275 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
276 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
277 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
278 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
279 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
280 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
281 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
282 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
283 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
284 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
285 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
286 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
287 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
288 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
289 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
290 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
291 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
295 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
298 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
300 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
301 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
302 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
305 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
306 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
307 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
308 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
309 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
310 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
311 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
312 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
313 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
314 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
315 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
316 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
317 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
318 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
319 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
321 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
322 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
323 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
324 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
325 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
326 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
327 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
328 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
329 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
330 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
331 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
332 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
333 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
334 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
335 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
336 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
337 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
338 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
339 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
340 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
341 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
342 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
343 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
344 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
345 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
346 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
347 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
348 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
349 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
350 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
351 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
352 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
353 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
354 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
355 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
356 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
357 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
358 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
359 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
360 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
361 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
362 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
363 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
364 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
365 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
366 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
367 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
368 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
369 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
370 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
371 2643221584 Caulobacter sp. Root656 Isolate Unclassified
372 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
373 2734482000 Kineosporia rhizophila JCM 9960 Isolate Unclassified
374 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
375 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
376 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
377 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
378 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
379 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
380 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
381 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
382 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
383 2922554459 Rhodococcus sp. 66b Isolate Unclassified
384 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
385 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
386 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
387 2952252522 Salinicola sp. DM10 Isolate Unclassified
388 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
389 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
390 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.4
Metatranscriptomes 0.74
Isolates 3.86

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.23
Nodule 0.45
Rhizoplane 9.5
Rhizosphere 76.56
Stem 0
Stem Tuber 0
Unclassified 1.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0099795_10129105 3300007788 Bacteria 1018
2 JGI24743J22301_10056078 3300001991 Bacteria 808
3 JGI25153J46596_10000851 3300003215 Bacteria 18700
4 Ga0058863_11309610 3300004799 Bacteria 963
5 Ga0070658_10515093 3300005327 Bacteria 1034
6 Ga0070683_100000288 3300005329 Bacteria 34747
7 Ga0070683_100108167 3300005329 Bacteria 2622
8 Ga0070683_100324769 3300005329 Bacteria 1465
9 Ga0070683_101263880 3300005329 Bacteria 709
10 Ga0070670_100000837 3300005331 Bacteria 24028
11 Ga0070670_100836744 3300005331 Bacteria 832
12 Ga0068869_100105228 3300005334 Bacteria 2140
13 Ga0068869_100112821 3300005334 Bacteria 2070
14 Ga0070666_10031447 3300005335 Bacteria 3504
15 Ga0070682_100013283 3300005337 Bacteria 4736
16 Ga0070682_100871263 3300005337 Bacteria 737
17 Ga0068868_100013934 3300005338 Bacteria 5914
18 Ga0068868_100372279 3300005338 Bacteria 1227
19 Ga0068868_100589609 3300005338 Bacteria 983
20 Ga0070660_100233543 3300005339 Bacteria 1496
21 Ga0070689_100091303 3300005340 Bacteria 2401
22 Ga0070689_100653702 3300005340 Bacteria 915
23 Ga0070687_100353096 3300005343 Bacteria 950
24 Ga0070661_100384070 3300005344 Bacteria 1107
25 Ga0070661_100429219 3300005344 Bacteria 1048
26 Ga0070669_100040436 3300005353 Bacteria 3389
27 Ga0070669_100177833 3300005353 Bacteria 1663
28 Ga0070675_100058722 3300005354 Bacteria 3173
29 Ga0070671_100060034 3300005355 Bacteria 3166
30 Ga0070674_100013315 3300005356 Bacteria 5081
31 Ga0070674_100252468 3300005356 Bacteria 1386
32 Ga0070674_100290903 3300005356 Bacteria 1299
33 Ga0070673_100114051 3300005364 Bacteria 2245
34 Ga0070688_100100413 3300005365 Bacteria 1907
35 Ga0070659_100042563 3300005366 Bacteria 3551
36 Ga0070659_100216322 3300005366 Bacteria 1580
37 Ga0070667_100939008 3300005367 Bacteria 806
38 Ga0070703_10076463 3300005406 Bacteria 1130
39 Ga0070709_10050700 3300005434 Bacteria 2602
40 Ga0070714_100317379 3300005435 Bacteria 1456
41 Ga0070710_10216062 3300005437 Bacteria 1217
42 Ga0070710_10263349 3300005437 Bacteria 1112
43 Ga0070701_10056806 3300005438 Bacteria 2049
44 Ga0070711_100027443 3300005439 Bacteria 3738
45 Ga0070700_100021693 3300005441 Bacteria 3736
46 Ga0070700_100111998 3300005441 Bacteria 1816
47 Ga0070700_100173475 3300005441 Bacteria 1495
48 Ga0070694_100555736 3300005444 Bacteria 920
49 Ga0070708_100277002 3300005445 Unclassified 1578
50 Ga0070708_100375508 3300005445 Bacteria 1340
51 Ga0070663_100031372 3300005455 Bacteria 3652
52 Ga0070663_100098123 3300005455 Bacteria 2182
53 Ga0070678_100052206 3300005456 Bacteria 2967
54 Ga0070678_100950298 3300005456 Bacteria 788
55 Ga0070662_100005528 3300005457 Bacteria 8081
56 Ga0070662_100033462 3300005457 Bacteria 3619
57 Ga0070662_100050720 3300005457 Bacteria 2994
58 Ga0070681_10001465 3300005458 Bacteria 20823
59 Ga0068867_100851346 3300005459 Bacteria 817
60 Ga0070706_101197298 3300005467 Bacteria 698
61 Ga0070707_100022560 3300005468 Bacteria 5951
62 Ga0070707_100720782 3300005468 Unclassified 960
63 Ga0070698_100003457 3300005471 Bacteria 17377
64 Ga0070698_100278927 3300005471 Bacteria 1603
65 Ga0070699_100036931 3300005518 Bacteria 4226
66 Ga0070699_100483761 3300005518 Unclassified 1124
67 Ga0070684_100000368 3300005535 Bacteria 31049
68 Ga0070697_100328292 3300005536 Bacteria 1318
69 Ga0068853_100047811 3300005539 Bacteria 3672
70 Ga0068853_100447109 3300005539 Bacteria 1215
71 Ga0070672_100594207 3300005543 Bacteria 963
72 Ga0070686_100039657 3300005544 Bacteria 2935
73 Ga0070695_100049482 3300005545 Bacteria 2691
74 Ga0070696_100367515 3300005546 Bacteria 1118
75 Ga0070693_100026018 3300005547 Bacteria 3155
76 Ga0070665_100091733 3300005548 Bacteria 3043
77 Ga0070665_100632900 3300005548 Bacteria 1083
78 Ga0070665_100846256 3300005548 Bacteria 928
79 Ga0070665_101161696 3300005548 Bacteria 783
80 Ga0070704_100186031 3300005549 Bacteria 1665
81 Ga0068855_100025515 3300005563 Bacteria 7070
82 Ga0068855_100160857 3300005563 Bacteria 2549
83 Ga0070664_100093798 3300005564 Bacteria 2602
84 Ga0070664_100751476 3300005564 Bacteria 910
85 Ga0068857_100015624 3300005577 Bacteria 6635
86 Ga0068854_100008193 3300005578 Bacteria 6704
87 Ga0068854_100070346 3300005578 Bacteria 2557
88 Ga0068856_100037793 3300005614 Bacteria 4738
89 Ga0068856_100076530 3300005614 Bacteria 3315
90 Ga0068856_100502125 3300005614 Bacteria 1234
91 Ga0070702_100019199 3300005615 Bacteria 3560
92 Ga0070702_100118369 3300005615 Bacteria 1654
93 Ga0068852_100182062 3300005616 Bacteria 1977
94 Ga0068852_100203656 3300005616 Bacteria 1873
95 Ga0068852_100209418 3300005616 Bacteria 1849
96 Ga0068852_101046176 3300005616 Bacteria 836
97 Ga0068859_100133746 3300005617 Bacteria 2552
98 Ga0068859_100185047 3300005617 Bacteria 2166
99 Ga0068859_100650759 3300005617 Bacteria 1146
100 Ga0068866_10007833 3300005718 Bacteria 4482
101 Ga0068866_10043531 3300005718 Bacteria 2241
102 Ga0068861_100132373 3300005719 Bacteria 2025
103 Ga0068861_100437798 3300005719 Bacteria 1168
104 Ga0068861_100809992 3300005719 Bacteria 880
105 Ga0068851_10000640 3300005834 Bacteria 14904
106 Ga0068851_10051419 3300005834 Bacteria 2094
107 Ga0068863_100075493 3300005841 Bacteria 3189
108 Ga0068858_100031244 3300005842 Bacteria 4944
109 Ga0068858_100100394 3300005842 Bacteria 2699
110 Ga0068860_100008433 3300005843 Bacteria 10265
111 Ga0068860_100047500 3300005843 Bacteria 4091
112 Ga0068860_100566437 3300005843 Bacteria 1139
113 Ga0068862_100679413 3300005844 Bacteria 996
114 Ga0081455_10000072 3300005937 Bacteria 108040
115 Ga0081540_1002791 3300005983 Bacteria 14161
116 Ga0081540_1091255 3300005983 Bacteria 1339
117 Ga0081539_10036091 3300005985 Bacteria 2963
118 Ga0070717_10027092 3300006028 Bacteria 4578
119 Ga0070717_10520141 3300006028 Bacteria 1076
120 Ga0075365_10491862 3300006038 Bacteria 867
121 Ga0075432_10030625 3300006058 Bacteria 1860
122 Ga0070716_100309949 3300006173 Bacteria 1101
123 Ga0070712_100271111 3300006175 Bacteria 1363
124 Ga0075367_10165513 3300006178 Bacteria 1376
125 Ga0075369_10000521 3300006186 Bacteria 12079
126 Ga0097621_100061893 3300006237 Bacteria 3071
127 Ga0068871_100245339 3300006358 Bacteria 1558
128 Ga0075428_100312147 3300006844 Bacteria 1690
129 Ga0075430_100243081 3300006846 Bacteria 1491
130 Ga0075433_10003948 3300006852 Bacteria 11485
131 Ga0075434_100116714 3300006871 Bacteria 2682
132 Ga0068865_100144055 3300006881 Bacteria 1800
133 Ga0075436_100044129 3300006914 Bacteria 3073
134 Ga0097620_100133749 3300006931 Bacteria 2552
135 Ga0097620_100185046 3300006931 Bacteria 2166
136 Ga0097620_100650771 3300006931 Bacteria 1146
137 Ga0075435_100061390 3300007076 Bacteria 3049
138 Ga0105251_10002711 3300009011 Bacteria 13586
139 Ga0105251_10042268 3300009011 Bacteria 2214
140 Ga0105250_10106744 3300009092 Bacteria 1145
141 Ga0105240_10405704 3300009093 Bacteria 1534
142 Ga0105240_10764126 3300009093 Bacteria 1050
143 Ga0111539_10022280 3300009094 Bacteria 7786
144 Ga0111539_11369744 3300009094 Bacteria 821
145 Ga0105245_10081861 3300009098 Bacteria 2952
146 Ga0105245_10180791 3300009098 Bacteria 2015
147 Ga0105245_10308804 3300009098 Bacteria 1554
148 Ga0105245_10420739 3300009098 Bacteria 1339
149 Ga0105245_10536253 3300009098 Bacteria 1191
150 Ga0105245_10552067 3300009098 Bacteria 1174
151 Ga0105247_10079130 3300009101 Bacteria 2068
152 Ga0105247_10163775 3300009101 Bacteria 1474
153 Ga0105247_10196810 3300009101 Bacteria 1352
154 Ga0105243_10032005 3300009148 Bacteria 4059
155 Ga0105243_10041316 3300009148 Bacteria 3606
156 Ga0105243_10053369 3300009148 Bacteria 3206
157 Ga0105243_10212057 3300009148 Bacteria 1706
158 Ga0105243_10238083 3300009148 Bacteria 1618
159 Ga0105243_10482206 3300009148 Bacteria 1171
160 Ga0105243_10949626 3300009148 Bacteria 859
161 Ga0105241_10001516 3300009174 Bacteria 17800
162 Ga0105241_10021777 3300009174 Bacteria 4742
163 Ga0105241_10250503 3300009174 Bacteria 1501
164 Ga0105242_10026552 3300009176 Bacteria 4591
165 Ga0105248_10948456 3300009177 Bacteria 972
166 Ga0105237_10290933 3300009545 Bacteria 1636
167 Ga0105238_10025614 3300009551 Bacteria 6012
168 Ga0105238_10651005 3300009551 Bacteria 1064
169 Ga0105238_10665431 3300009551 Bacteria 1052
170 Ga0105238_11000445 3300009551 Bacteria 857
171 Ga0105238_11105928 3300009551 Bacteria 815
172 Ga0105249_10043660 3300009553 Bacteria 4077
173 Ga0105249_11712209 3300009553 Bacteria 701
174 Ga0099796_10057731 3300010159 Bacteria 1366
175 Ga0105239_10116763 3300010375 Bacteria 2961
176 Ga0105239_11116202 3300010375 Bacteria 908
177 Ga0105246_10024255 3300011119 Bacteria 3938
178 Ga0105246_10053473 3300011119 Bacteria 2779
179 Ga0105246_10151323 3300011119 Bacteria 1757
180 Ga0105246_10257881 3300011119 Bacteria 1387
181 Ga0157373_10036458 3300013100 Bacteria 3529
182 Ga0157373_10050425 3300013100 Bacteria 2964
183 Ga0157371_10202241 3300013102 Bacteria 1424
184 Ga0157370_10180073 3300013104 Bacteria 1964
185 Ga0157370_10299079 3300013104 Bacteria 1486
186 Ga0157369_10009094 3300013105 Bacteria 11369
187 Ga0157369_10025298 3300013105 Bacteria 6590
188 Ga0157369_10511941 3300013105 Bacteria 1242
189 Ga0157369_11264769 3300013105 Bacteria 752
190 Ga0157374_10025676 3300013296 Bacteria 5293
191 Ga0157374_10111998 3300013296 Bacteria 2626
192 Ga0157374_10212197 3300013296 Bacteria 1898
193 Ga0157374_10600126 3300013296 Bacteria 1111
194 Ga0157374_10990797 3300013296 Bacteria 859
195 Ga0157378_10322895 3300013297 Bacteria 1500
196 Ga0163162_10025354 3300013306 Bacteria 5859
197 Ga0163162_10684745 3300013306 Bacteria 1148
198 Ga0157372_10054181 3300013307 Bacteria 4473
199 Ga0157372_10082622 3300013307 Bacteria 3637
200 Ga0157372_10226054 3300013307 Bacteria 2170
201 Ga0157375_10000139 3300013308 Bacteria 72260
202 Ga0157375_10009593 3300013308 Bacteria 8502
203 Ga0157375_10091421 3300013308 Bacteria 3105
204 Ga0157375_10248066 3300013308 Bacteria 1941
205 Ga0157375_10403073 3300013308 Bacteria 1534
206 Ga0157375_10418417 3300013308 Bacteria 1506
207 Ga0157375_10437429 3300013308 Bacteria 1474
208 Ga0157375_10761508 3300013308 Bacteria 1119
209 Ga0163163_10061357 3300014325 Bacteria 3725
210 Ga0163163_10071420 3300014325 Bacteria 3459
211 Ga0163163_10188387 3300014325 Bacteria 2111
212 Ga0163163_11131011 3300014325 Bacteria 846
213 Ga0157380_10034329 3300014326 Bacteria 3912
214 Ga0182008_10001091 3300014497 Bacteria 18705
215 Ga0157377_10119932 3300014745 Bacteria 1593
216 Ga0157377_10123745 3300014745 Bacteria 1571
217 Ga0157377_10147822 3300014745 Bacteria 1450
218 Ga0157376_10004053 3300014969 Bacteria 10135
219 Ga0157376_10194349 3300014969 Bacteria 1863
220 Ga0157376_10411302 3300014969 Bacteria 1310
221 Ga0157376_10598159 3300014969 Bacteria 1097
222 Ga0157376_10892061 3300014969 Bacteria 907
223 Ga0163161_10040510 3300017792 Bacteria 3346
224 Ga0163161_10099418 3300017792 Bacteria 2163
225 Ga0163161_10246831 3300017792 Bacteria 1390
226 Ga0197907_10123416 3300020069 Bacteria 974
227 Ga0206356_11242399 3300020070 Bacteria 911
228 Ga0206356_11261807 3300020070 Bacteria 851
229 Ga0206355_1365040 3300020076 Bacteria 928
230 Ga0213876_10046238 3300021384 Bacteria 2302
231 Ga0213875_10037107 3300021388 Bacteria 2297
232 Ga0209758_1001136 3300025297 Bacteria 34152
233 Ga0207656_10001091 3300025321 Bacteria 8891
234 Ga0207655_1023884 3300025728 Bacteria 3014
235 Ga0207692_10051527 3300025898 Bacteria 2087
236 Ga0207642_10019105 3300025899 Bacteria 2646
237 Ga0207642_10030433 3300025899 Bacteria 2249
238 Ga0207642_10151379 3300025899 Bacteria 1235
239 Ga0207710_10039593 3300025900 Bacteria 2086
240 Ga0207710_10170152 3300025900 Bacteria 1065
241 Ga0207688_10011004 3300025901 Bacteria 4922
242 Ga0207688_10019702 3300025901 Bacteria 3677
243 Ga0207688_10314422 3300025901 Bacteria 960
244 Ga0207680_10098031 3300025903 Bacteria 1878
245 Ga0207647_10037399 3300025904 Bacteria 3078
246 Ga0207647_10129385 3300025904 Bacteria 1484
247 Ga0207685_10175573 3300025905 Bacteria 989
248 Ga0207699_10139687 3300025906 Bacteria 1591
249 Ga0207699_10213508 3300025906 Bacteria 1313
250 Ga0207699_10440944 3300025906 Unclassified 933
251 Ga0207645_10434682 3300025907 Bacteria 885
252 Ga0207684_10013675 3300025910 Bacteria 7013
253 Ga0207684_10073596 3300025910 Bacteria 2902
254 Ga0207654_10024079 3300025911 Bacteria 3269
255 Ga0207654_10075641 3300025911 Bacteria 2013
256 Ga0207654_10150206 3300025911 Bacteria 1494
257 Ga0207695_10020330 3300025913 Bacteria 7608
258 Ga0207695_10062164 3300025913 Bacteria 3857
259 Ga0207671_10000044 3300025914 Bacteria 205065
260 Ga0207671_10355635 3300025914 Bacteria 1162
261 Ga0207693_10001475 3300025915 Bacteria 20788
262 Ga0207663_10154981 3300025916 Bacteria 1610
263 Ga0207657_10060910 3300025919 Bacteria 3238
264 Ga0207646_10049932 3300025922 Unclassified 3745
265 Ga0207681_10011045 3300025923 Bacteria 5545
266 Ga0207681_10185699 3300025923 Bacteria 1587
267 Ga0207694_10102829 3300025924 Bacteria 2265
268 Ga0207694_10584985 3300025924 Bacteria 938
269 Ga0207694_10705759 3300025924 Bacteria 851
270 Ga0207650_10002606 3300025925 Bacteria 12484
271 Ga0207659_10260392 3300025926 Bacteria 1411
272 Ga0207687_10054532 3300025927 Bacteria 2797
273 Ga0207687_10095966 3300025927 Bacteria 2172
274 Ga0207687_10131835 3300025927 Bacteria 1885
275 Ga0207687_10165819 3300025927 Bacteria 1699
276 Ga0207687_10449295 3300025927 Bacteria 1069
277 Ga0207687_10843598 3300025927 Bacteria 783
278 Ga0207664_11029972 3300025929 Bacteria 737
279 Ga0207644_10109082 3300025931 Bacteria 2091
280 Ga0207690_10136066 3300025932 Bacteria 1804
281 Ga0207706_10006235 3300025933 Bacteria 11083
282 Ga0207706_10009695 3300025933 Bacteria 8837
283 Ga0207706_10010344 3300025933 Bacteria 8528
284 Ga0207706_10042556 3300025933 Bacteria 4026
285 Ga0207686_10218999 3300025934 Bacteria 1373
286 Ga0207709_10208048 3300025935 Bacteria 1402
287 Ga0207709_10482785 3300025935 Bacteria 964
288 Ga0207709_10494168 3300025935 Bacteria 954
289 Ga0207709_10952960 3300025935 Bacteria 700
290 Ga0207709_11113896 3300025935 Bacteria 648
291 Ga0207669_10223466 3300025937 Bacteria 1384
292 Ga0207669_10293597 3300025937 Bacteria 1232
293 Ga0207669_10569944 3300025937 Bacteria 916
294 Ga0207704_10312305 3300025938 Bacteria 1209
295 Ga0207704_10517882 3300025938 Bacteria 964
296 Ga0207665_10000441 3300025939 Bacteria 28540
297 Ga0207691_10091793 3300025940 Bacteria 2720
298 Ga0207711_10357777 3300025941 Bacteria 1352
299 Ga0207689_10042384 3300025942 Bacteria 3765
300 Ga0207689_10084366 3300025942 Bacteria 2611
301 Ga0207661_10001324 3300025944 Bacteria 16580
302 Ga0207661_10095653 3300025944 Bacteria 2484
303 Ga0207661_10132725 3300025944 Bacteria 2135
304 Ga0207661_10352145 3300025944 Bacteria 1329
305 Ga0207679_10142311 3300025945 Bacteria 1940
306 Ga0207679_10161181 3300025945 Bacteria 1836
307 Ga0207679_10815761 3300025945 Bacteria 851
308 Ga0207667_10188829 3300025949 Bacteria 2114
309 Ga0207667_10507164 3300025949 Bacteria 1223
310 Ga0207651_10644781 3300025960 Bacteria 929
311 Ga0207712_10376676 3300025961 Bacteria 1187
312 Ga0207712_10667101 3300025961 Bacteria 905
313 Ga0207668_10256356 3300025972 Bacteria 1423
314 Ga0207640_10036122 3300025981 Bacteria 3099
315 Ga0207640_10064173 3300025981 Bacteria 2444
316 Ga0207640_10074400 3300025981 Bacteria 2299
317 Ga0207677_10029955 3300026023 Bacteria 3466
318 Ga0207677_10104899 3300026023 Bacteria 2090
319 Ga0207677_10426933 3300026023 Bacteria 1130
320 Ga0207677_10766455 3300026023 Bacteria 861
321 Ga0207703_10021353 3300026035 Bacteria 5069
322 Ga0207639_10439740 3300026041 Bacteria 1182
323 Ga0207639_11413593 3300026041 Bacteria 653
324 Ga0207678_10032116 3300026067 Bacteria 4577
325 Ga0207678_10125524 3300026067 Bacteria 2189
326 Ga0207708_10037099 3300026075 Bacteria 3712
327 Ga0207708_10038381 3300026075 Bacteria 3648
328 Ga0207708_10179014 3300026075 Bacteria 1683
329 Ga0207702_10081632 3300026078 Bacteria 2808
330 Ga0207702_10345813 3300026078 Bacteria 1422
331 Ga0207641_10038482 3300026088 Bacteria 3999
332 Ga0207648_10461605 3300026089 Bacteria 1158
333 Ga0207648_10676670 3300026089 Bacteria 955
334 Ga0207674_10023193 3300026116 Bacteria 6651
335 Ga0207674_10495791 3300026116 Bacteria 1180
336 Ga0207674_10510877 3300026116 Bacteria 1161
337 Ga0207675_100042583 3300026118 Bacteria 4239
338 Ga0207675_100063530 3300026118 Bacteria 3450
339 Ga0207675_100464454 3300026118 Bacteria 1256
340 Ga0207683_10050465 3300026121 Bacteria 3644
341 Ga0207698_10120392 3300026142 Bacteria 2220
342 Ga0207698_10347793 3300026142 Bacteria 1399
343 Ga0209813_10068842 3300027866 Bacteria 1146
344 Ga0268266_10127380 3300028379 Bacteria 2274
345 Ga0268266_10144118 3300028379 Bacteria 2140
346 Ga0268265_11007130 3300028380 Bacteria 823
347 Ga0268264_10007255 3300028381 Bacteria 9277
348 Ga0268264_10039819 3300028381 Bacteria 3882
349 Ga0307517_10033956 3300028786 Bacteria 5831
350 Ga0307515_10026892 3300028794 Bacteria 9868
351 Ga0307515_10028603 3300028794 Bacteria 9470
352 Ga0307515_10200839 3300028794 Bacteria 1870
353 Ga0307515_10402063 3300028794 Bacteria 995
354 Ga0307512_10044335 3300030522 Bacteria 3657
355 Ga0265330_10181343 3300031235 Bacteria 892
356 Ga0265325_10052549 3300031241 Bacteria 2091
357 Ga0265340_10000449 3300031247 Bacteria 22252
358 Ga0265340_10238243 3300031247 Bacteria 812
359 Ga0265327_10204791 3300031251 Bacteria 892
360 Ga0307513_10027532 3300031456 Bacteria 6526
361 Ga0265313_10001975 3300031595 Bacteria 18534
362 Ga0265313_10040387 3300031595 Bacteria 2307
363 Ga0307508_10006234 3300031616 Bacteria 11235
364 Ga0307514_10022626 3300031649 Bacteria 5106
365 Ga0307516_10000451 3300031730 Bacteria 54345
366 Ga0326468_10001070 3300031889 Bacteria 2562
367 Ga0307406_10072218 3300031901 Bacteria 2265
368 Ga0307407_10015548 3300031903 Bacteria 3766
369 Ga0307407_10146463 3300031903 Bacteria 1530
370 Ga0307412_10045369 3300031911 Bacteria 2873
371 Ga0307412_10064113 3300031911 Bacteria 2482
372 Ga0307409_100012166 3300031995 Bacteria 5469
373 Ga0307409_100255280 3300031995 Bacteria 1605
374 Ga0307416_100689943 3300032002 Bacteria 1109
375 Ga0307510_10105760 3300033180 Bacteria 2581
376 Ga0316215_1005246 3300033544 Bacteria 1246
377 Ga0373948_0026188 3300034817 Bacteria 1148
378 Ga0373940_0078804 3300035088 Bacteria 971
379 Ga0373944_0168596 3300035089 Bacteria 780
380 Ga0373960_0019776 3300035121 Bacteria 1773
381 Ga0373924_0018917 3300035410 Bacteria 2663
382 Ga0373931_0051936 3300035691 Bacteria 2184
383 Ga0373935_0045320 3300035692 Bacteria 2775
384 Ga0373947_0032263 3300035725 Bacteria 3086
385 Ga0373947_0592212 3300035725 Bacteria 756
386 Ga0395898_0031671 3300037466 Bacteria 5282
387 Ga0395898_0045421 3300037466 Bacteria 4318
388 Ga0436364_0474317 3300037853 Bacteria 27860
389 Ga0436364_1202828 3300037853 Bacteria 2570
390 Ga0395901_0039062 3300038443 Bacteria 4911
391 Ga0395901_0095418 3300038443 Bacteria 3117
392 Ga0436365_0246154 3300039437 Bacteria 5299
393 Ga0436365_0447627 3300039437 Bacteria 1836
394 Ga0436365_0619481 3300039437 Unclassified 1669
395 Ga0436360_0128955 3300039438 Unclassified 3449
396 Ga0436360_0225610 3300039438 Bacteria 2488
397 Ga0436360_1160694 3300039438 Bacteria 3899
398 Ga0436361_0453034 3300039447 Bacteria 1978
399 Ga0436361_0935941 3300039447 Bacteria 2323
400 Ga0436361_0940302 3300039447 Bacteria 6436
401 Ga0436363_0892539 3300039450 Bacteria 11930
402 Ga0436363_1015480 3300039450 Bacteria 15225
403 Ga0436363_1170539 3300039450 Bacteria 847
404 Ga0436363_1185087 3300039450 Bacteria 3070
405 Ga0436362_0771073 3300039453 Unclassified 1006
406 Ga0451795_0559981 3300041456 Bacteria 1076
407 Ga0451843_0205484 3300041509 Bacteria 781
408 Ga0439463_003476 3300042016 Bacteria 3983
409 Ga0450905_027385 3300042142 Bacteria 865
410 Ga0451577_0642778 3300042876 Bacteria 962
411 Ga0466966_0047835 3300044684 Bacteria 2726
412 Ga0466963_0051419 3300044694 Bacteria 2731
413 Ga0466968_0032199 3300044735 Bacteria 2180
414 Ga0466957_0224145 3300044842 Bacteria 1242
415 Ga0466967_0030419 3300045976 Bacteria 4531
416 Ga0466967_0076257 3300045976 Bacteria 3015
417 Ga0466967_0273088 3300045976 Bacteria 1620
418 Ga0495603_0084372 3300046455 Bacteria 1860
419 Ga0495591_009291 3300046458 Bacteria 3921
420 Ga0495638_0100020 3300046460 Bacteria 1735
421 Ga0495653_0208547 3300046463 Bacteria 1321
422 Ga0495650_0000121 3300046471 Bacteria 183055
423 Ga0495582_0158328 3300046473 Bacteria 1287
424 Ga0495639_0354888 3300046475 Bacteria 736
425 Ga0495664_0011049 3300046477 Bacteria 5080
426 Ga0495664_0020457 3300046477 Bacteria 3817
427 Ga0495585_0056761 3300046492 Bacteria 2162
428 Ga0495594_0387050 3300046499 Bacteria 796
429 Ga0495608_0202317 3300046511 Bacteria 1251
430 Ga0495610_0007691 3300046512 Bacteria 7114
431 Ga0495630_0119006 3300046517 Bacteria 2003
432 Ga0495630_0235804 3300046517 Bacteria 1398
433 Ga0495637_0159854 3300046520 Bacteria 846
434 Ga0495654_0030346 3300046530 Bacteria 2751
435 Ga0495665_0128016 3300046531 Bacteria 1330
436 Ga0495640_0333130 3300046533 Bacteria 939
437 Ga0495586_0009136 3300046535 Bacteria 5272
438 Ga0495587_0001136 3300046536 Bacteria 17422
439 Ga0495587_0190333 3300046536 Bacteria 1162
440 Ga0495645_0010212 3300046543 Bacteria 6577
441 Ga0495667_0036387 3300046559 Bacteria 3286
442 Ga0495668_0000293 3300046616 Bacteria 68641
443 Ga0495668_0330703 3300046616 Bacteria 836
444 Ga0495634_0242037 3300046642 Bacteria 1106
445 Ga0495635_0048424 3300046663 Bacteria 2930
446 Ga0495635_0164920 3300046663 Bacteria 1507
447 Ga0495588_0395284 3300046674 Bacteria 726
448 Ga0495657_0069810 3300046675 Bacteria 2298
449 Ga0495647_0148085 3300046681 Bacteria 1005
450 Ga0495613_0099231 3300046689 Bacteria 2104
451 Ga0495613_0148615 3300046689 Bacteria 1672
452 Ga0495624_0078543 3300046690 Bacteria 2047
453 Ga0495649_0013103 3300046694 Bacteria 4791
454 Ga0495600_0008144 3300046809 Bacteria 6432
455 Ga0495581_0006278 3300047315 Bacteria 6891
456 Ga0495604_0034442 3300047317 Bacteria 4006
457 Ga0495604_0197726 3300047317 Bacteria 1397
458 Ga0495604_0338073 3300047317 Bacteria 1003
459 Ga0495674_0045857 3300047319 Bacteria 3881
460 Ga0495672_0170334 3300047320 Bacteria 1111
461 Ga0495676_0018257 3300047321 Bacteria 6185
462 Ga0495684_0280738 3300047471 Bacteria 1202
463 Ga0495593_0149639 3300047673 Bacteria 1181
464 Ga0495602_0331356 3300048088 Bacteria 1104
465 Ga0496100_0025325 3300048903 Bacteria 3628
466 Ga0496100_0153462 3300048903 Bacteria 1645
467 Ga0496100_0468340 3300048903 Bacteria 968
468 Ga0496100_0569394 3300048903 Bacteria 878
469 Ga0496101_0247305 3300048904 Bacteria 1389
470 Ga0496101_0526676 3300048904 Bacteria 934
471 Ga0496102_0007196 3300048905 Bacteria 9503
472 Ga0496102_0331339 3300048905 Bacteria 1434
473 Ga0496102_0461344 3300048905 Bacteria 1191
474 Ga0496102_0702658 3300048905 Bacteria 934
475 Ga0496104_0003480 3300048907 Bacteria 13582
476 Ga0496104_0128635 3300048907 Bacteria 2432
477 Ga0496104_0314942 3300048907 Bacteria 1478
478 Ga0496104_0337092 3300048907 Bacteria 1421
479 Ga0496104_0663049 3300048907 Bacteria 952
480 Ga0496105_0098448 3300048908 Bacteria 2415
481 Ga0496105_0184899 3300048908 Bacteria 1705
482 Ga0496105_0233163 3300048908 Bacteria 1495
483 Ga0496106_0045904 3300048909 Bacteria 3283
484 Ga0496106_0140513 3300048909 Bacteria 1899
485 Ga0496107_0045802 3300048910 Bacteria 3147
486 Ga0496107_0355148 3300048910 Bacteria 1091
487 Ga0496108_0002418 3300048911 Bacteria 14917
488 Ga0496108_0006638 3300048911 Bacteria 9377
489 Ga0496108_0011248 3300048911 Bacteria 7270
490 Ga0496108_0020467 3300048911 Bacteria 5440
491 Ga0496108_0050723 3300048911 Bacteria 3474
492 Ga0496109_0003363 3300048912 Bacteria 13377
493 Ga0496109_0092147 3300048912 Bacteria 2803
494 Ga0496109_0283485 3300048912 Bacteria 1561
495 Ga0496110_0010978 3300048913 Bacteria 7389
496 Ga0496110_0028371 3300048913 Bacteria 4807
497 Ga0496110_0060929 3300048913 Bacteria 3329
498 Ga0496110_0078879 3300048913 Bacteria 2931
499 Ga0496110_0091664 3300048913 Bacteria 2719
500 Ga0496110_0145057 3300048913 Bacteria 2147
501 Ga0496110_0409014 3300048913 Bacteria 1237
502 Ga0496111_0001350 3300048914 Bacteria 13873
503 Ga0496112_0015213 3300048915 Bacteria 7171
504 Ga0496112_0107555 3300048915 Bacteria 2759
505 Ga0496112_0204089 3300048915 Bacteria 1935
506 Ga0496112_0587328 3300048915 Bacteria 1046
507 Ga0496113_0014580 3300048916 Bacteria 5367
508 Ga0496113_0041193 3300048916 Bacteria 3407
509 Ga0496113_0187749 3300048916 Bacteria 1640
510 Ga0496113_0408618 3300048916 Bacteria 1090
511 Ga0496114_0009743 3300048917 Bacteria 7634
512 Ga0496114_0027069 3300048917 Bacteria 4697
513 Ga0496114_0046630 3300048917 Bacteria 3602
514 Ga0496114_0050486 3300048917 Bacteria 3462
515 Ga0496114_0056936 3300048917 Bacteria 3263
516 Ga0496114_0077757 3300048917 Bacteria 2798
517 Ga0496114_0133649 3300048917 Bacteria 2144
518 Ga0496114_0260518 3300048917 Bacteria 1527
519 Ga0496114_0427424 3300048917 Bacteria 1173
520 Ga0496115_0070513 3300048918 Bacteria 2833
521 Ga0496115_0200943 3300048918 Bacteria 1647
522 Ga0496115_0302314 3300048918 Bacteria 1311
523 Ga0496117_0004239 3300048920 Bacteria 16004
524 Ga0496119_0015677 3300048922 Bacteria 5811
525 Ga0496119_0046961 3300048922 Bacteria 2691
526 Ga0496120_0011567 3300048923 Bacteria 6060
527 Ga0496122_0012146 3300048925 Bacteria 8620
528 Ga0496122_0086789 3300048925 Bacteria 2152
529 Ga0496122_0286951 3300048925 Unclassified 896
530 Ga0496123_0017566 3300048926 Bacteria 5747
531 Ga0496124_0133536 3300048927 Bacteria 1968
532 Ga0496125_0004838 3300048928 Bacteria 15297
533 Ga0496125_0099447 3300048928 Bacteria 2148
534 Ga0496126_0008512 3300048929 Bacteria 11056
535 Ga0496126_0008668 3300048929 Bacteria 10924
536 Ga0496126_0728330 3300048929 Bacteria 768
537 Ga0501032_0007314 3300049569 Bacteria 8078
538 Ga0501032_0015123 3300049569 Bacteria 5450
539 Ga0501033_0067225 3300049570 Bacteria 2635
540 Ga0501034_0021998 3300049571 Bacteria 6496
541 Ga0501034_0048977 3300049571 Bacteria 4264
542 Ga0501036_0017359 3300049572 Bacteria 6016
543 Ga0501036_0095629 3300049572 Bacteria 2511
544 Ga0501036_0334615 3300049572 Bacteria 1265
545 Ga0501037_0015286 3300049573 Bacteria 5647
546 Ga0501037_0042481 3300049573 Bacteria 3340
547 Ga0501037_0075714 3300049573 Bacteria 2444
548 Ga0501038_0000465 3300049574 Bacteria 35557
549 Ga0501038_0265012 3300049574 Bacteria 1356
550 Ga0501039_0097271 3300049575 Bacteria 2295
551 Ga0501039_0140849 3300049575 Bacteria 1894
552 Ga0501039_0540831 3300049575 Bacteria 914
553 Ga0501040_0001238 3300049576 Bacteria 16213
554 Ga0501040_0038554 3300049576 Bacteria 3248
555 Ga0501041_0003180 3300049577 Bacteria 9443
556 Ga0501042_0026864 3300049578 Bacteria 4045
557 Ga0501042_0115783 3300049578 Bacteria 1930
558 Ga0501043_0000228 3300049579 Bacteria 51127
559 Ga0501043_0007995 3300049579 Bacteria 8349
560 Ga0501043_0044879 3300049579 Bacteria 3476
561 Ga0501043_0688675 3300049579 Bacteria 748
562 Ga0501046_0008866 3300049580 Bacteria 8739
563 Ga0501046_0014366 3300049580 Bacteria 6685
564 Ga0501047_0013222 3300049581 Bacteria 7816
565 Ga0501048_0002319 3300049582 Bacteria 14514
566 Ga0501048_0010376 3300049582 Bacteria 6956
567 Ga0501067_0292686 3300049583 Bacteria 907
568 Ga0501068_0015627 3300049584 Bacteria 4363
569 Ga0501068_0124239 3300049584 Bacteria 1611
570 Ga0501068_0285393 3300049584 Bacteria 1055
571 Ga0501070_0001699 3300049586 Bacteria 19501
572 Ga0501070_0006438 3300049586 Bacteria 9997
573 Ga0501070_0178560 3300049586 Bacteria 1748
574 Ga0501070_0799017 3300049586 Bacteria 741
575 Ga0501071_0110160 3300049587 Bacteria 2034
576 Ga0501072_0006961 3300049588 Bacteria 8582
577 Ga0501072_0038709 3300049588 Bacteria 3743
578 Ga0501073_0019507 3300049589 Bacteria 4894
579 Ga0501074_0503056 3300049590 Bacteria 858
580 Ga0501075_0027723 3300049591 Bacteria 4175
581 Ga0501075_0211984 3300049591 Bacteria 1477
582 Ga0501076_0042360 3300049592 Bacteria 3583
583 Ga0501077_0068873 3300049593 Bacteria 2243
584 Ga0501079_0031029 3300049741 Bacteria 4107
585 Ga0501080_0133064 3300049742 Bacteria 2302
586 Ga0501081_0251070 3300049743 Bacteria 1291
587 Ga0501083_0150446 3300049744 Bacteria 1524
588 Ga0501035_0164593 3300049822 Bacteria 1918
589 Ga0501035_0195118 3300049822 Bacteria 1739
590 Ga0501044_0146159 3300049823 Bacteria 2349
591 Ga0501044_0763659 3300049823 Bacteria 848
592 Ga0501044_0778855 3300049823 Bacteria 837
593 Ga0501045_0004285 3300049824 Bacteria 9837
594 Ga0501045_0074701 3300049824 Bacteria 2496
595 Ga0501045_0451738 3300049824 Bacteria 955
596 nmdc:mga00v17_322792_c1 3300050491 Bacteria 1003
597 nmdc:mga0yw44_21582_c1 3300050492 Bacteria 3595
598 nmdc:mga0yw44_228705_c1 3300050492 Bacteria 1234
599 nmdc:mga04h51_82321_c1 3300050495 Bacteria 1144
600 nmdc:mga0qj67_268588_c1 3300050509 Bacteria 1383
601 nmdc:mga08y16_964479_c1 3300050511 Bacteria 835
602 nmdc:mga0n895_161177_c1 3300050512 Bacteria 2275
603 nmdc:mga08x19_76240_c1 3300050514 Bacteria 2194
604 nmdc:mga0a205_9434_c1 3300050515 Bacteria 8921
605 nmdc:mga0sz30_102040_c1 3300050516 Bacteria 1254
606 Ga0495601_0002325 3300053077 Bacteria 10749
607 Ga0495601_0011493 3300053077 Bacteria 5299
608 Ga0495612_0004263 3300053078 Bacteria 5939
609 Ga0495595_0017118 3300053084 Bacteria 3115
610 Ga0495595_0122499 3300053084 Bacteria 1267
611 Ga0495619_0009747 3300053085 Bacteria 6055
612 Ga0500578_0224343 3300053086 Bacteria 1141
613 Ga0500643_040650 3300053087 Bacteria 1369
614 Ga0500644_0071089 3300053088 Bacteria 1254
615 Ga0500583_0175921 3300053092 Bacteria 1066
616 Ga0500651_0070555 3300053093 Bacteria 2175
617 Ga0500640_001756 3300053095 Bacteria 6789
618 Ga0500641_0185389 3300053096 Bacteria 892
619 Ga0500650_0173913 3300053098 Bacteria 989
620 Ga0500554_000250 3300053102 Bacteria 11616
621 Ga0500554_137068 3300053102 Bacteria 827
622 Ga0500562_048985 3300053108 Bacteria 1129
623 Ga0500594_0047412 3300053118 Bacteria 1198
624 Ga0500595_000091 3300053119 Bacteria 62164
625 Ga0500614_000380 3300053123 Bacteria 11570
626 Ga0500652_057441 3300053131 Bacteria 1597
627 Ga0500652_074183 3300053131 Bacteria 1412
628 Ga0500658_0000136 3300053134 Bacteria 34704
629 Ga0500658_0082310 3300053134 Bacteria 1379
630 Ga0500559_0005348 3300053136 Bacteria 5914
631 Ga0500559_0222729 3300053136 Bacteria 889
632 Ga0500579_169750 3300053143 Bacteria 892
633 Ga0500600_0178385 3300053149 Bacteria 1025
634 Ga0500603_001607 3300053150 Bacteria 5103
635 Ga0500616_0000535 3300053153 Bacteria 47523
636 Ga0500622_0027616 3300053156 Bacteria 2992
637 Ga0500627_0098881 3300053158 Bacteria 1309
638 Ga0500639_017670 3300053163 Bacteria 3765
639 Ga0500637_0172432 3300053178 Bacteria 1243
640 Ga0500645_000032 3300053730 Bacteria 119506
641 Ga0500645_007613 3300053730 Bacteria 3756
642 Ga0500601_006951 3300053737 Bacteria 1253
643 Ga0501084_0037045 3300054114 Bacteria 4075
644 Ga0501084_0167866 3300054114 Bacteria 1852
645 Ga0590075_005439 3300059424 Bacteria 3006
646 Ga0501082_0021243 3300060353 Bacteria 5600
647 Ga0501082_0123075 3300060353 Bacteria 2249
648 Ga0530510_0006594 3300061734 Bacteria 8096
649 2566997415 2565956761 Bacteria 6601618
650 2599398446 2599185167 Bacteria 6353609
651 2599450449 2599185179 Bacteria 6611171
652 2599512931 2599185190 Bacteria 6285678
653 2599521700 2599185191 Bacteria 6297582
654 2599891608 2599185290 Bacteria 6289611
655 2643929257 2643221584 Bacteria 5511711
656 2677896265 2675903420 Bacteria 6247433
657 2734970685 2734482000 Bacteria 5525167
658 2738705641 2738541274 Bacteria 6909446
659 2738892594 2738541308 Bacteria 7020677
660 2739332438 2738543028 Bacteria 6917070
661 2808872566 2808606365 Bacteria 4301966
662 2819668104 2818991458 Bacteria 4794049
663 2842309050 2842304105 Bacteria 7023636
664 2887446970 2887443736 Bacteria 4426037
665 2904538345 2904535858 Bacteria 6308016
666 2908449532 2908446538 Bacteria 6829095
667 2922557536 2922554459 Bacteria 6683962
668 2931393822 2931390751 Bacteria 6273349
669 2933575541 2933570622 Bacteria 7023390
670 2946009650 2946006987 Bacteria 6705746
671 2952255989 2952252522 Bacteria 4171745
672 2966602437 2966598605 Bacteria 7676064
673 8006932845 8006926726 Bacteria 6749210
674 8054291421 8054285046 Bacteria 6919322
675 Ga0099795_10129105
676 JGI24743J22301_10056078
677 JGI25153J46596_10000851
678 Ga0058863_11309610
679 Ga0070658_10515093
680 Ga0070683_100000288
681 Ga0070683_100108167
682 Ga0070683_100324769
683 Ga0070683_101263880
684 Ga0070670_100000837
685 Ga0070670_100836744
686 Ga0068869_100105228
687 Ga0068869_100112821
688 Ga0070666_10031447
689 Ga0070682_100013283
690 Ga0070682_100871263
691 Ga0068868_100013934
692 Ga0068868_100372279
693 Ga0068868_100589609
694 Ga0070660_100233543
695 Ga0070689_100091303
696 Ga0070689_100653702
697 Ga0070687_100353096
698 Ga0070661_100384070
699 Ga0070661_100429219
700 Ga0070669_100040436
701 Ga0070669_100177833
702 Ga0070675_100058722
703 Ga0070671_100060034
704 Ga0070674_100013315
705 Ga0070674_100252468
706 Ga0070674_100290903
707 Ga0070673_100114051
708 Ga0070688_100100413
709 Ga0070659_100042563
710 Ga0070659_100216322
711 Ga0070667_100939008
712 Ga0070703_10076463
713 Ga0070709_10050700
714 Ga0070714_100317379
715 Ga0070710_10216062
716 Ga0070710_10263349
717 Ga0070701_10056806
718 Ga0070711_100027443
719 Ga0070700_100021693
720 Ga0070700_100111998
721 Ga0070700_100173475
722 Ga0070694_100555736
723 Ga0070708_100277002
724 Ga0070708_100375508
725 Ga0070663_100031372
726 Ga0070663_100098123
727 Ga0070678_100052206
728 Ga0070678_100950298
729 Ga0070662_100005528
730 Ga0070662_100033462
731 Ga0070662_100050720
732 Ga0070681_10001465
733 Ga0068867_100851346
734 Ga0070706_101197298
735 Ga0070707_100022560
736 Ga0070707_100720782
737 Ga0070698_100003457
738 Ga0070698_100278927
739 Ga0070699_100036931
740 Ga0070699_100483761
741 Ga0070684_100000368
742 Ga0070697_100328292
743 Ga0068853_100047811
744 Ga0068853_100447109
745 Ga0070672_100594207
746 Ga0070686_100039657
747 Ga0070695_100049482
748 Ga0070696_100367515
749 Ga0070693_100026018
750 Ga0070665_100091733
751 Ga0070665_100632900
752 Ga0070665_100846256
753 Ga0070665_101161696
754 Ga0070704_100186031
755 Ga0068855_100025515
756 Ga0068855_100160857
757 Ga0070664_100093798
758 Ga0070664_100751476
759 Ga0068857_100015624
760 Ga0068854_100008193
761 Ga0068854_100070346
762 Ga0068856_100037793
763 Ga0068856_100076530
764 Ga0068856_100502125
765 Ga0070702_100019199
766 Ga0070702_100118369
767 Ga0068852_100182062
768 Ga0068852_100203656
769 Ga0068852_100209418
770 Ga0068852_101046176
771 Ga0068859_100133746
772 Ga0068859_100185047
773 Ga0068859_100650759
774 Ga0068866_10007833
775 Ga0068866_10043531
776 Ga0068861_100132373
777 Ga0068861_100437798
778 Ga0068861_100809992
779 Ga0068851_10000640
780 Ga0068851_10051419
781 Ga0068863_100075493
782 Ga0068858_100031244
783 Ga0068858_100100394
784 Ga0068860_100008433
785 Ga0068860_100047500
786 Ga0068860_100566437
787 Ga0068862_100679413
788 Ga0081455_10000072
789 Ga0081540_1002791
790 Ga0081540_1091255
791 Ga0081539_10036091
792 Ga0070717_10027092
793 Ga0070717_10520141
794 Ga0075365_10491862
795 Ga0075432_10030625
796 Ga0070716_100309949
797 Ga0070712_100271111
798 Ga0075367_10165513
799 Ga0075369_10000521
800 Ga0097621_100061893
801 Ga0068871_100245339
802 Ga0075428_100312147
803 Ga0075430_100243081
804 Ga0075433_10003948
805 Ga0075434_100116714
806 Ga0068865_100144055
807 Ga0075436_100044129
808 Ga0097620_100133749
809 Ga0097620_100185046
810 Ga0097620_100650771
811 Ga0075435_100061390
812 Ga0105251_10002711
813 Ga0105251_10042268
814 Ga0105250_10106744
815 Ga0105240_10405704
816 Ga0105240_10764126
817 Ga0111539_10022280
818 Ga0111539_11369744
819 Ga0105245_10081861
820 Ga0105245_10180791
821 Ga0105245_10308804
822 Ga0105245_10420739
823 Ga0105245_10536253
824 Ga0105245_10552067
825 Ga0105247_10079130
826 Ga0105247_10163775
827 Ga0105247_10196810
828 Ga0105243_10032005
829 Ga0105243_10041316
830 Ga0105243_10053369
831 Ga0105243_10212057
832 Ga0105243_10238083
833 Ga0105243_10482206
834 Ga0105243_10949626
835 Ga0105241_10001516
836 Ga0105241_10021777
837 Ga0105241_10250503
838 Ga0105242_10026552
839 Ga0105248_10948456
840 Ga0105237_10290933
841 Ga0105238_10025614
842 Ga0105238_10651005
843 Ga0105238_10665431
844 Ga0105238_11000445
845 Ga0105238_11105928
846 Ga0105249_10043660
847 Ga0105249_11712209
848 Ga0099796_10057731
849 Ga0105239_10116763
850 Ga0105239_11116202
851 Ga0105246_10024255
852 Ga0105246_10053473
853 Ga0105246_10151323
854 Ga0105246_10257881
855 Ga0157373_10036458
856 Ga0157373_10050425
857 Ga0157371_10202241
858 Ga0157370_10180073
859 Ga0157370_10299079
860 Ga0157369_10009094
861 Ga0157369_10025298
862 Ga0157369_10511941
863 Ga0157369_11264769
864 Ga0157374_10025676
865 Ga0157374_10111998
866 Ga0157374_10212197
867 Ga0157374_10600126
868 Ga0157374_10990797
869 Ga0157378_10322895
870 Ga0163162_10025354
871 Ga0163162_10684745
872 Ga0157372_10054181
873 Ga0157372_10082622
874 Ga0157372_10226054
875 Ga0157375_10000139
876 Ga0157375_10009593
877 Ga0157375_10091421
878 Ga0157375_10248066
879 Ga0157375_10403073
880 Ga0157375_10418417
881 Ga0157375_10437429
882 Ga0157375_10761508
883 Ga0163163_10061357
884 Ga0163163_10071420
885 Ga0163163_10188387
886 Ga0163163_11131011
887 Ga0157380_10034329
888 Ga0182008_10001091
889 Ga0157377_10119932
890 Ga0157377_10123745
891 Ga0157377_10147822
892 Ga0157376_10004053
893 Ga0157376_10194349
894 Ga0157376_10411302
895 Ga0157376_10598159
896 Ga0157376_10892061
897 Ga0163161_10040510
898 Ga0163161_10099418
899 Ga0163161_10246831
900 Ga0197907_10123416
901 Ga0206356_11242399
902 Ga0206356_11261807
903 Ga0206355_1365040
904 Ga0213876_10046238
905 Ga0213875_10037107
906 Ga0209758_1001136
907 Ga0207656_10001091
908 Ga0207655_1023884
909 Ga0207692_10051527
910 Ga0207642_10019105
911 Ga0207642_10030433
912 Ga0207642_10151379
913 Ga0207710_10039593
914 Ga0207710_10170152
915 Ga0207688_10011004
916 Ga0207688_10019702
917 Ga0207688_10314422
918 Ga0207680_10098031
919 Ga0207647_10037399
920 Ga0207647_10129385
921 Ga0207685_10175573
922 Ga0207699_10139687
923 Ga0207699_10213508
924 Ga0207699_10440944
925 Ga0207645_10434682
926 Ga0207684_10013675
927 Ga0207684_10073596
928 Ga0207654_10024079
929 Ga0207654_10075641
930 Ga0207654_10150206
931 Ga0207695_10020330
932 Ga0207695_10062164
933 Ga0207671_10000044
934 Ga0207671_10355635
935 Ga0207693_10001475
936 Ga0207663_10154981
937 Ga0207657_10060910
938 Ga0207646_10049932
939 Ga0207681_10011045
940 Ga0207681_10185699
941 Ga0207694_10102829
942 Ga0207694_10584985
943 Ga0207694_10705759
944 Ga0207650_10002606
945 Ga0207659_10260392
946 Ga0207687_10054532
947 Ga0207687_10095966
948 Ga0207687_10131835
949 Ga0207687_10165819
950 Ga0207687_10449295
951 Ga0207687_10843598
952 Ga0207664_11029972
953 Ga0207644_10109082
954 Ga0207690_10136066
955 Ga0207706_10006235
956 Ga0207706_10009695
957 Ga0207706_10010344
958 Ga0207706_10042556
959 Ga0207686_10218999
960 Ga0207709_10208048
961 Ga0207709_10482785
962 Ga0207709_10494168
963 Ga0207709_10952960
964 Ga0207709_11113896
965 Ga0207669_10223466
966 Ga0207669_10293597
967 Ga0207669_10569944
968 Ga0207704_10312305
969 Ga0207704_10517882
970 Ga0207665_10000441
971 Ga0207691_10091793
972 Ga0207711_10357777
973 Ga0207689_10042384
974 Ga0207689_10084366
975 Ga0207661_10001324
976 Ga0207661_10095653
977 Ga0207661_10132725
978 Ga0207661_10352145
979 Ga0207679_10142311
980 Ga0207679_10161181
981 Ga0207679_10815761
982 Ga0207667_10188829
983 Ga0207667_10507164
984 Ga0207651_10644781
985 Ga0207712_10376676
986 Ga0207712_10667101
987 Ga0207668_10256356
988 Ga0207640_10036122
989 Ga0207640_10064173
990 Ga0207640_10074400
991 Ga0207677_10029955
992 Ga0207677_10104899
993 Ga0207677_10426933
994 Ga0207677_10766455
995 Ga0207703_10021353
996 Ga0207639_10439740
997 Ga0207639_11413593
998 Ga0207678_10032116
999 Ga0207678_10125524
1000 Ga0207708_10037099
1001 Ga0207708_10038381
1002 Ga0207708_10179014
1003 Ga0207702_10081632
1004 Ga0207702_10345813
1005 Ga0207641_10038482
1006 Ga0207648_10461605
1007 Ga0207648_10676670
1008 Ga0207674_10023193
1009 Ga0207674_10495791
1010 Ga0207674_10510877
1011 Ga0207675_100042583
1012 Ga0207675_100063530
1013 Ga0207675_100464454
1014 Ga0207683_10050465
1015 Ga0207698_10120392
1016 Ga0207698_10347793
1017 Ga0209813_10068842
1018 Ga0268266_10127380
1019 Ga0268266_10144118
1020 Ga0268265_11007130
1021 Ga0268264_10007255
1022 Ga0268264_10039819
1023 Ga0307517_10033956
1024 Ga0307515_10026892
1025 Ga0307515_10028603
1026 Ga0307515_10200839
1027 Ga0307515_10402063
1028 Ga0307512_10044335
1029 Ga0265330_10181343
1030 Ga0265325_10052549
1031 Ga0265340_10000449
1032 Ga0265340_10238243
1033 Ga0265327_10204791
1034 Ga0307513_10027532
1035 Ga0265313_10001975
1036 Ga0265313_10040387
1037 Ga0307508_10006234
1038 Ga0307514_10022626
1039 Ga0307516_10000451
1040 Ga0326468_10001070
1041 Ga0307406_10072218
1042 Ga0307407_10015548
1043 Ga0307407_10146463
1044 Ga0307412_10045369
1045 Ga0307412_10064113
1046 Ga0307409_100012166
1047 Ga0307409_100255280
1048 Ga0307416_100689943
1049 Ga0307510_10105760
1050 Ga0316215_1005246
1051 Ga0373948_0026188
1052 Ga0373940_0078804
1053 Ga0373944_0168596
1054 Ga0373960_0019776
1055 Ga0373924_0018917
1056 Ga0373931_0051936
1057 Ga0373935_0045320
1058 Ga0373947_0032263
1059 Ga0373947_0592212
1060 Ga0395898_0031671
1061 Ga0395898_0045421
1062 Ga0436364_0474317
1063 Ga0436364_1202828
1064 Ga0395901_0039062
1065 Ga0395901_0095418
1066 Ga0436365_0246154
1067 Ga0436365_0447627
1068 Ga0436365_0619481
1069 Ga0436360_0128955
1070 Ga0436360_0225610
1071 Ga0436360_1160694
1072 Ga0436361_0453034
1073 Ga0436361_0935941
1074 Ga0436361_0940302
1075 Ga0436363_0892539
1076 Ga0436363_1015480
1077 Ga0436363_1170539
1078 Ga0436363_1185087
1079 Ga0436362_0771073
1080 Ga0451795_0559981
1081 Ga0451843_0205484
1082 Ga0439463_003476
1083 Ga0450905_027385
1084 Ga0451577_0642778
1085 Ga0466966_0047835
1086 Ga0466963_0051419
1087 Ga0466968_0032199
1088 Ga0466957_0224145
1089 Ga0466967_0030419
1090 Ga0466967_0076257
1091 Ga0466967_0273088
1092 Ga0495603_0084372
1093 Ga0495591_009291
1094 Ga0495638_0100020
1095 Ga0495653_0208547
1096 Ga0495650_0000121
1097 Ga0495582_0158328
1098 Ga0495639_0354888
1099 Ga0495664_0011049
1100 Ga0495664_0020457
1101 Ga0495585_0056761
1102 Ga0495594_0387050
1103 Ga0495608_0202317
1104 Ga0495610_0007691
1105 Ga0495630_0119006
1106 Ga0495630_0235804
1107 Ga0495637_0159854
1108 Ga0495654_0030346
1109 Ga0495665_0128016
1110 Ga0495640_0333130
1111 Ga0495586_0009136
1112 Ga0495587_0001136
1113 Ga0495587_0190333
1114 Ga0495645_0010212
1115 Ga0495667_0036387
1116 Ga0495668_0000293
1117 Ga0495668_0330703
1118 Ga0495634_0242037
1119 Ga0495635_0048424
1120 Ga0495635_0164920
1121 Ga0495588_0395284
1122 Ga0495657_0069810
1123 Ga0495647_0148085
1124 Ga0495613_0099231
1125 Ga0495613_0148615
1126 Ga0495624_0078543
1127 Ga0495649_0013103
1128 Ga0495600_0008144
1129 Ga0495581_0006278
1130 Ga0495604_0034442
1131 Ga0495604_0197726
1132 Ga0495604_0338073
1133 Ga0495674_0045857
1134 Ga0495672_0170334
1135 Ga0495676_0018257
1136 Ga0495684_0280738
1137 Ga0495593_0149639
1138 Ga0495602_0331356
1139 Ga0496100_0025325
1140 Ga0496100_0153462
1141 Ga0496100_0468340
1142 Ga0496100_0569394
1143 Ga0496101_0247305
1144 Ga0496101_0526676
1145 Ga0496102_0007196
1146 Ga0496102_0331339
1147 Ga0496102_0461344
1148 Ga0496102_0702658
1149 Ga0496104_0003480
1150 Ga0496104_0128635
1151 Ga0496104_0314942
1152 Ga0496104_0337092
1153 Ga0496104_0663049
1154 Ga0496105_0098448
1155 Ga0496105_0184899
1156 Ga0496105_0233163
1157 Ga0496106_0045904
1158 Ga0496106_0140513
1159 Ga0496107_0045802
1160 Ga0496107_0355148
1161 Ga0496108_0002418
1162 Ga0496108_0006638
1163 Ga0496108_0011248
1164 Ga0496108_0020467
1165 Ga0496108_0050723
1166 Ga0496109_0003363
1167 Ga0496109_0092147
1168 Ga0496109_0283485
1169 Ga0496110_0010978
1170 Ga0496110_0028371
1171 Ga0496110_0060929
1172 Ga0496110_0078879
1173 Ga0496110_0091664
1174 Ga0496110_0145057
1175 Ga0496110_0409014
1176 Ga0496111_0001350
1177 Ga0496112_0015213
1178 Ga0496112_0107555
1179 Ga0496112_0204089
1180 Ga0496112_0587328
1181 Ga0496113_0014580
1182 Ga0496113_0041193
1183 Ga0496113_0187749
1184 Ga0496113_0408618
1185 Ga0496114_0009743
1186 Ga0496114_0027069
1187 Ga0496114_0046630
1188 Ga0496114_0050486
1189 Ga0496114_0056936
1190 Ga0496114_0077757
1191 Ga0496114_0133649
1192 Ga0496114_0260518
1193 Ga0496114_0427424
1194 Ga0496115_0070513
1195 Ga0496115_0200943
1196 Ga0496115_0302314
1197 Ga0496117_0004239
1198 Ga0496119_0015677
1199 Ga0496119_0046961
1200 Ga0496120_0011567
1201 Ga0496122_0012146
1202 Ga0496122_0086789
1203 Ga0496122_0286951
1204 Ga0496123_0017566
1205 Ga0496124_0133536
1206 Ga0496125_0004838
1207 Ga0496125_0099447
1208 Ga0496126_0008512
1209 Ga0496126_0008668
1210 Ga0496126_0728330
1211 Ga0501032_0007314
1212 Ga0501032_0015123
1213 Ga0501033_0067225
1214 Ga0501034_0021998
1215 Ga0501034_0048977
1216 Ga0501036_0017359
1217 Ga0501036_0095629
1218 Ga0501036_0334615
1219 Ga0501037_0015286
1220 Ga0501037_0042481
1221 Ga0501037_0075714
1222 Ga0501038_0000465
1223 Ga0501038_0265012
1224 Ga0501039_0097271
1225 Ga0501039_0140849
1226 Ga0501039_0540831
1227 Ga0501040_0001238
1228 Ga0501040_0038554
1229 Ga0501041_0003180
1230 Ga0501042_0026864
1231 Ga0501042_0115783
1232 Ga0501043_0000228
1233 Ga0501043_0007995
1234 Ga0501043_0044879
1235 Ga0501043_0688675
1236 Ga0501046_0008866
1237 Ga0501046_0014366
1238 Ga0501047_0013222
1239 Ga0501048_0002319
1240 Ga0501048_0010376
1241 Ga0501067_0292686
1242 Ga0501068_0015627
1243 Ga0501068_0124239
1244 Ga0501068_0285393
1245 Ga0501070_0001699
1246 Ga0501070_0006438
1247 Ga0501070_0178560
1248 Ga0501070_0799017
1249 Ga0501071_0110160
1250 Ga0501072_0006961
1251 Ga0501072_0038709
1252 Ga0501073_0019507
1253 Ga0501074_0503056
1254 Ga0501075_0027723
1255 Ga0501075_0211984
1256 Ga0501076_0042360
1257 Ga0501077_0068873
1258 Ga0501079_0031029
1259 Ga0501080_0133064
1260 Ga0501081_0251070
1261 Ga0501083_0150446
1262 Ga0501035_0164593
1263 Ga0501035_0195118
1264 Ga0501044_0146159
1265 Ga0501044_0763659
1266 Ga0501044_0778855
1267 Ga0501045_0004285
1268 Ga0501045_0074701
1269 Ga0501045_0451738
1270 nmdc:mga00v17_322792_c1
1271 nmdc:mga0yw44_21582_c1
1272 nmdc:mga0yw44_228705_c1
1273 nmdc:mga04h51_82321_c1
1274 nmdc:mga0qj67_268588_c1
1275 nmdc:mga08y16_964479_c1
1276 nmdc:mga0n895_161177_c1
1277 nmdc:mga08x19_76240_c1
1278 nmdc:mga0a205_9434_c1
1279 nmdc:mga0sz30_102040_c1
1280 Ga0495601_0002325
1281 Ga0495601_0011493
1282 Ga0495612_0004263
1283 Ga0495595_0017118
1284 Ga0495595_0122499
1285 Ga0495619_0009747
1286 Ga0500578_0224343
1287 Ga0500643_040650
1288 Ga0500644_0071089
1289 Ga0500583_0175921
1290 Ga0500651_0070555
1291 Ga0500640_001756
1292 Ga0500641_0185389
1293 Ga0500650_0173913
1294 Ga0500554_000250
1295 Ga0500554_137068
1296 Ga0500562_048985
1297 Ga0500594_0047412
1298 Ga0500595_000091
1299 Ga0500614_000380
1300 Ga0500652_057441
1301 Ga0500652_074183
1302 Ga0500658_0000136
1303 Ga0500658_0082310
1304 Ga0500559_0005348
1305 Ga0500559_0222729
1306 Ga0500579_169750
1307 Ga0500600_0178385
1308 Ga0500603_001607
1309 Ga0500616_0000535
1310 Ga0500622_0027616
1311 Ga0500627_0098881
1312 Ga0500639_017670
1313 Ga0500637_0172432
1314 Ga0500645_000032
1315 Ga0500645_007613
1316 Ga0500601_006951
1317 Ga0501084_0037045
1318 Ga0501084_0167866
1319 Ga0590075_005439
1320 Ga0501082_0021243
1321 Ga0501082_0123075
1322 Ga0530510_0006594
1323 2566997415
1324 2599398446
1325 2599450449
1326 2599512931
1327 2599521700
1328 2599891608
1329 2643929257
1330 2677896265
1331 2734970685
1332 2738705641
1333 2738892594
1334 2739332438
1335 2808872566
1336 2819668104
1337 2842309050
1338 2887446970
1339 2904538345
1340 2908449532
1341 2922557536
1342 2931393822
1343 2933575541
1344 2946009650
1345 2952255989
1346 2966602437
1347 8006932845
1348 8054291421

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00857

Isochorismatase

Isochorismatase family

6

192

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3kl2-assembly2.cif.gz_E crystal structure of a putative isochorismatase from streptomyces avermitilis 0.9806 1 202
3kl2-assembly2.cif.gz_E crystal structure of a putative isochorismatase from streptomyces avermitilis 0.9758 1 202
3hb7-assembly4.cif.gz_H the crystal structure of an isochorismatase-like hydrolase from alkaliphilus metalliredigens to 2.3a 0.9401 7 198
3hb7-assembly1.cif.gz_E the crystal structure of an isochorismatase-like hydrolase from alkaliphilus metalliredigens to 2.3a 0.9201 7 198
3hb7-assembly4.cif.gz_H the crystal structure of an isochorismatase-like hydrolase from alkaliphilus metalliredigens to 2.3a 0.9138 7 198
ID Description Score Start End Superfamily
3kl2C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.9833 3 200 3.40.50.850
3kl2C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.9688 3 200 3.40.50.850
3hb7H00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.9243 7 198 3.40.50.850
af_Q2G220_1_186_3.40.50.850 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.9023 7 198 3.40.50.850
3hb7H00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.898 7 198 3.40.50.850
ID Description Score Start End GO Terms
AF-A0A2V7JLX3-F1-model_v4 Isochorismatase 0.991 59 202 GO:0016810
AF-A0A037UU02-F1-model_v4 deleted 0.9881 3 192
AF-A0A5B9PG29-F1-model_v4 Isochorismatase family protein YecD (EC 3.-.-.-) 0.9869 1 199 GO:0016810
AF-A0A1Z5JMZ3-F1-model_v4 Isochorismatase-like domain-containing protein 0.9868 2 200 GO:0016810
AF-A0A3A8Q0G1-F1-model_v4 Cysteine hydrolase 0.9865 1 199 GO:0016810

Map