F474321
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 673 | 341 | 1346 | 148 |
Family's Representative Sequence
| Representative Sequence | 3300031733|Ga0316577_10149906|Ga0316577_101499061 |
| Length | 176 |
| Sequence | LPTHVPHGAIALGSLARPSCSIPGQQVMTMLKQRLQSDMKAAMKAGDKRRLGVIRLINAAVKQREVDERIELDDSQVLAVLDKMVKQRRDSIAQYDQAGRNDLAEQERFEIEVCQDYLPQPLSADEIASLIDGAIAETGAAGMKDMGKVMGILKPRVQGRGDXXAISAEVKRRLAG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 5 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 6 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 7 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 8 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 9 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 10 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 11 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 12 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 13 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 14 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 22 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 24 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 25 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 26 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 27 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 28 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 29 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 30 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 31 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 32 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 35 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 36 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009987 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG | Metagenome | Rhizosphere |
| 41 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Metagenome | Rhizosphere |
| 44 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300013874 | Rhizosphere microbial communities from switchgrass harvested rhizosphere in Austin, TX, USA - RS_213 | Metagenome | Rhizosphere |
| 48 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 50 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 51 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 52 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 53 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 54 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 55 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 56 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 57 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 58 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 59 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 60 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 61 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 62 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 63 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 65 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 66 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 99 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 100 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 101 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 102 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 103 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 104 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 105 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 106 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 107 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 108 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 109 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 110 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 111 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 112 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 113 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 114 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 115 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 116 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 117 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 118 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 119 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 120 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 121 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 122 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 123 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 124 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 125 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 126 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 127 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 128 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 129 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 130 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 131 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 132 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 133 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 134 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 135 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 136 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 137 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 138 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 139 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 140 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 141 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 142 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 143 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 144 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 145 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 146 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 147 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 148 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 149 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 150 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 151 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 152 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 153 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 154 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 155 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 156 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 231 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 232 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 233 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 234 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 235 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 236 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 237 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 238 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 239 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 240 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 241 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 242 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 243 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 244 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 245 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 246 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 247 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 248 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 249 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 250 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 251 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 252 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 253 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 254 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 255 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 256 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 257 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 272 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 277 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 279 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 282 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 284 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 285 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 287 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 288 | 2501025501 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 289 | 2501025502 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 290 | 2501025504 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 291 | 2508501125 | Burkholderia sp. WSM2232 | Isolate | Nodule |
| 292 | 2510065045 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 293 | 2510917013 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 294 | 2510917014 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 295 | 2510917015 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 296 | 2512047030 | Paraburkholderia tuberum STM678 | Isolate | Nodule |
| 297 | 2513237083 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 298 | 2513237151 | Burkholderia sp. WSM2230 | Isolate | Nodule |
| 299 | 2515154122 | Paraburkholderia atlantica JPY251 | Isolate | Nodule |
| 300 | 2593339238 | Luteibacter sp. UNCMF366Tsu5.1 | Isolate | Unclassified |
| 301 | 2593339239 | Luteibacter sp. UNCMF331Sha3.1 | Isolate | Unclassified |
| 302 | 2599185178 | Ralstonia sp. NFACC01 | Isolate | Rhizoplane |
| 303 | 2600255067 | Paraburkholderia kururiensis thiooxydans NBRC 107107 | Isolate | Unclassified |
| 304 | 2718217991 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 305 | 2738541296 | Paraburkholderia sp. GV073 | Isolate | Unclassified |
| 306 | 2738541298 | Paraburkholderia sp. GV068 | Isolate | Unclassified |
| 307 | 2738541306 | Paraburkholderia sp. GV052 | Isolate | Unclassified |
| 308 | 2738543002 | Paraburkholderia sp. GV072 | Isolate | Unclassified |
| 309 | 2738543008 | Paraburkholderia sp. GV060 | Isolate | Unclassified |
| 310 | 2744054900 | Paraburkholderia ginsengiterrae DCY85-1 | Isolate | Unclassified |
| 311 | 2744054901 | Paraburkholderia ginsengiterrae DCY85 | Isolate | Unclassified |
| 312 | 2751185846 | Paraburkholderia ribeironis STM 7296 | Isolate | Unclassified |
| 313 | 2818991450 | Burkholderia sp. 604 | Isolate | Unclassified |
| 314 | 2842324504 | Paraburkholderia fungorum SEMIA 4007 | Isolate | Nodule |
| 315 | 2842348783 | Paraburkholderia fungorum SEMIA 4013 | Isolate | Nodule |
| 316 | 2842454564 | Paraburkholderia fungorum SEMIA 4056 | Isolate | Nodule |
| 317 | 2842918807 | Luteibacter sp. R-73110 | Isolate | Unclassified |
| 318 | 2856287931 | Paraburkholderia bannensis BE22 | Isolate | Rhizosphere |
| 319 | 2857357740 | Paraburkholderia tropica BE15 | Isolate | Rhizosphere |
| 320 | 2883087390 | Paraburkholderia guartelaensis CNPSo 3008 | Isolate | Unclassified |
| 321 | 2884338543 | Luteibacter pinisoli MAH-14 | Isolate | Rhizosphere |
| 322 | 2885266251 | Ralstonia sp. SET104 | Isolate | Nodule |
| 323 | 2885270888 | Paraburkholderia sp. UYCPa14C | Isolate | Unclassified |
| 324 | 2900577576 | Ralstonia sp. TCR112 | Isolate | Rhizosphere |
| 325 | 2900634093 | Paraburkholderia dipogonis ICMP 19430 | Isolate | Unclassified |
| 326 | 2902682994 | Paraburkholderia atlantica CNPSo 3155 | Isolate | Unclassified |
| 327 | 2904463128 | Luteibacter yeojuensis 3191 | Isolate | Unclassified |
| 328 | 2904483920 | Paraburkholderia caledonica 575 | Isolate | Unclassified |
| 329 | 2919527303 | Paraburkholderia strydomiana 3827 | Isolate | Unclassified |
| 330 | 2928058823 | Ralstonia sp. 1138 | Isolate | Unclassified |
| 331 | 2928108538 | Paraburkholderia terricola 1595 | Isolate | Rhizosphere |
| 332 | 2928135762 | Paraburkholderia terricola 1988 | Isolate | Unclassified |
| 333 | 2928503688 | Paraburkholderia terricola 1263 | Isolate | Rhizosphere |
| 334 | 2941471342 | Luteibacter sp. 621 | Isolate | Unclassified |
| 335 | 2945934425 | Paraburkholderia graminis W1I13 | Isolate | Rhizosphere |
| 336 | 2953994433 | Luteibacter sp. W1I16 | Isolate | Rhizosphere |
| 337 | 2990703756 | Paraburkholderia graminis SLBN-33 | Isolate | Rhizosphere |
| 338 | 641736151 | Paraburkholderia graminis C4D1M | Isolate | Rhizoplane |
| 339 | 642555113 | Paraburkholderia phytofirmans PsJN | Isolate | Unclassified |
| 340 | 8003955200 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 341 | 8055301274 | Paraburkholderia kirstenboschensis LMG 28727 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 83.06 |
| Metatranscriptomes | 8.92 |
| Isolates | 8.02 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.31 |
| Nodule | 1.93 |
| Rhizoplane | 3.86 |
| Rhizosphere | 79.35 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0316577_10149906 | 3300031733 | Bacteria | 1314 |
| 2 | JGI24739J22299_10019453 | 3300001989 | Bacteria | 2431 |
| 3 | JGI24739J22299_10025854 | 3300001989 | Bacteria | 2063 |
| 4 | JGI24739J22299_10034556 | 3300001989 | Bacteria | 1722 |
| 5 | JGI24739J22299_10044176 | 3300001989 | Bacteria | 1468 |
| 6 | JGI24737J22298_10025977 | 3300001990 | Bacteria | 1850 |
| 7 | JGI24737J22298_10045316 | 3300001990 | Bacteria | 1343 |
| 8 | JGI24735J21928_10000766 | 3300002067 | Bacteria | 11437 |
| 9 | JGI25156J39149_1000706 | 3300002705 | Bacteria | 17840 |
| 10 | JGI25156J39149_1001898 | 3300002705 | Bacteria | 8138 |
| 11 | JGI25156J39149_1025763 | 3300002705 | Bacteria | 940 |
| 12 | Ga0006562J51391_1019684 | 3300003578 | Bacteria | 3330 |
| 13 | Ga0055533_1001608 | 3300003756 | Bacteria | 5833 |
| 14 | Ga0055533_1003315 | 3300003756 | Bacteria | 3276 |
| 15 | Ga0055532_1000069 | 3300003758 | Bacteria | 138614 |
| 16 | Ga0055525_1007649 | 3300003759 | Bacteria | 912 |
| 17 | Ga0055527_1000034 | 3300003760 | Bacteria | 138614 |
| 18 | Ga0055535_1000049 | 3300003761 | Bacteria | 138835 |
| 19 | Ga0055542_1000077 | 3300003762 | Bacteria | 138614 |
| 20 | Ga0055529_1000090 | 3300003763 | Bacteria | 138416 |
| 21 | Ga0065707_10571690 | 3300005295 | Bacteria | 707 |
| 22 | Ga0070682_100604001 | 3300005337 | Bacteria | 867 |
| 23 | Ga0070669_100082322 | 3300005353 | Bacteria | 2399 |
| 24 | Ga0070675_100018953 | 3300005354 | Bacteria | 5480 |
| 25 | Ga0070667_100349101 | 3300005367 | Bacteria | 1339 |
| 26 | Ga0070714_100000857 | 3300005435 | Bacteria | 21561 |
| 27 | Ga0070663_100551299 | 3300005455 | Bacteria | 964 |
| 28 | Ga0068867_100200082 | 3300005459 | Bacteria | 1599 |
| 29 | Ga0070696_100107803 | 3300005546 | Bacteria | 2003 |
| 30 | Ga0068852_101190884 | 3300005616 | Bacteria | 783 |
| 31 | Ga0068861_101093762 | 3300005719 | Bacteria | 766 |
| 32 | Ga0068862_100221500 | 3300005844 | Bacteria | 1713 |
| 33 | Ga0075366_10434716 | 3300006195 | Bacteria | 809 |
| 34 | Ga0075428_100023245 | 3300006844 | Bacteria | 6856 |
| 35 | Ga0075433_10025113 | 3300006852 | Bacteria | 5036 |
| 36 | Ga0075434_100043881 | 3300006871 | Bacteria | 4435 |
| 37 | Ga0068865_100366035 | 3300006881 | Bacteria | 1172 |
| 38 | Ga0105251_10000300 | 3300009011 | Bacteria | 49582 |
| 39 | Ga0105251_10000428 | 3300009011 | Bacteria | 40780 |
| 40 | Ga0105244_10072592 | 3300009036 | Bacteria | 1714 |
| 41 | Ga0105244_10320906 | 3300009036 | Bacteria | 715 |
| 42 | Ga0105240_10534599 | 3300009093 | Bacteria | 1299 |
| 43 | Ga0111539_10003634 | 3300009094 | Bacteria | 20318 |
| 44 | Ga0111539_11276021 | 3300009094 | Bacteria | 853 |
| 45 | Ga0114129_10082449 | 3300009147 | Bacteria | 4468 |
| 46 | Ga0105241_10039710 | 3300009174 | Bacteria | 3551 |
| 47 | Ga0105248_10060495 | 3300009177 | Bacteria | 4252 |
| 48 | Ga0105248_10548812 | 3300009177 | Bacteria | 1304 |
| 49 | Ga0105248_10565169 | 3300009177 | Bacteria | 1283 |
| 50 | Ga0105238_10196121 | 3300009551 | Bacteria | 1995 |
| 51 | Ga0105238_10466128 | 3300009551 | Bacteria | 1261 |
| 52 | Ga0105249_10839570 | 3300009553 | Bacteria | 984 |
| 53 | Ga0105030_100177 | 3300009987 | Bacteria | 5345 |
| 54 | Ga0105239_12185314 | 3300010375 | Bacteria | 643 |
| 55 | Ga0105246_10293126 | 3300011119 | Bacteria | 1310 |
| 56 | Ga0105246_10467414 | 3300011119 | Bacteria | 1064 |
| 57 | Ga0157316_1010787 | 3300012510 | Bacteria | 845 |
| 58 | Ga0157369_10039579 | 3300013105 | Bacteria | 5151 |
| 59 | Ga0157369_10140179 | 3300013105 | Bacteria | 2559 |
| 60 | Ga0157369_10642835 | 3300013105 | Bacteria | 1094 |
| 61 | Ga0157369_10769095 | 3300013105 | Bacteria | 990 |
| 62 | Ga0157374_10226513 | 3300013296 | Bacteria | 1836 |
| 63 | Ga0157375_11634092 | 3300013308 | Bacteria | 762 |
| 64 | Ga0157514_117819 | 3300013874 | Bacteria | 1399 |
| 65 | Ga0157380_10180557 | 3300014326 | Bacteria | 1854 |
| 66 | Ga0182008_10010132 | 3300014497 | Bacteria | 5054 |
| 67 | Ga0182008_10037263 | 3300014497 | Bacteria | 2433 |
| 68 | Ga0182007_10000180 | 3300015262 | Bacteria | 43031 |
| 69 | Ga0209566_103562 | 3300025225 | Bacteria | 2346 |
| 70 | Ga0209674_100333 | 3300025226 | Bacteria | 28581 |
| 71 | Ga0209674_100469 | 3300025226 | Bacteria | 17786 |
| 72 | Ga0209674_100599 | 3300025226 | Bacteria | 13793 |
| 73 | Ga0209672_100002 | 3300025228 | Bacteria | 1733325 |
| 74 | Ga0209147_100003 | 3300025229 | Bacteria | 1733325 |
| 75 | Ga0209563_104319 | 3300025230 | Bacteria | 2734 |
| 76 | Ga0209437_100597 | 3300025233 | Bacteria | 22628 |
| 77 | Ga0209258_100077 | 3300025242 | Bacteria | 264510 |
| 78 | Ga0209677_110815 | 3300025253 | Bacteria | 1483 |
| 79 | Ga0209148_1000006 | 3300025254 | Bacteria | 1733325 |
| 80 | Ga0209148_1001576 | 3300025254 | Bacteria | 10867 |
| 81 | Ga0209759_1000334 | 3300025256 | Bacteria | 62007 |
| 82 | Ga0209759_1001068 | 3300025256 | Bacteria | 17992 |
| 83 | Ga0209759_1001076 | 3300025256 | Bacteria | 17873 |
| 84 | Ga0209759_1025028 | 3300025256 | Bacteria | 1279 |
| 85 | Ga0209129_1006837 | 3300025258 | Bacteria | 3562 |
| 86 | Ga0209455_1000140 | 3300025272 | Bacteria | 138610 |
| 87 | Ga0209758_1018942 | 3300025297 | Bacteria | 3346 |
| 88 | Ga0209256_1013248 | 3300025299 | Bacteria | 3072 |
| 89 | Ga0207426_1005772 | 3300025302 | Bacteria | 5561 |
| 90 | Ga0207713_1000628 | 3300025735 | Bacteria | 34442 |
| 91 | Ga0207680_10059276 | 3300025903 | Bacteria | 2324 |
| 92 | Ga0207647_10024880 | 3300025904 | Bacteria | 3942 |
| 93 | Ga0207647_10046253 | 3300025904 | Bacteria | 2712 |
| 94 | Ga0207647_10129787 | 3300025904 | Bacteria | 1482 |
| 95 | Ga0207647_10290832 | 3300025904 | Bacteria | 931 |
| 96 | Ga0207645_10355900 | 3300025907 | Bacteria | 980 |
| 97 | Ga0207654_11035345 | 3300025911 | Bacteria | 597 |
| 98 | Ga0207695_10193775 | 3300025913 | Bacteria | 1949 |
| 99 | Ga0207695_10314040 | 3300025913 | Bacteria | 1457 |
| 100 | Ga0207671_10068528 | 3300025914 | Bacteria | 2644 |
| 101 | Ga0207681_10133915 | 3300025923 | Bacteria | 1836 |
| 102 | Ga0207694_10694717 | 3300025924 | Bacteria | 858 |
| 103 | Ga0207659_10070286 | 3300025926 | Bacteria | 2553 |
| 104 | Ga0207664_10000873 | 3300025929 | Bacteria | 20374 |
| 105 | Ga0207669_10371206 | 3300025937 | Bacteria | 1112 |
| 106 | Ga0207691_10116662 | 3300025940 | Bacteria | 2369 |
| 107 | Ga0207711_10030987 | 3300025941 | Bacteria | 4512 |
| 108 | Ga0207689_10218836 | 3300025942 | Bacteria | 1573 |
| 109 | Ga0207667_10431145 | 3300025949 | Bacteria | 1341 |
| 110 | Ga0207651_10434605 | 3300025960 | Bacteria | 1123 |
| 111 | Ga0207712_10483190 | 3300025961 | Bacteria | 1056 |
| 112 | Ga0207658_10132919 | 3300025986 | Bacteria | 2002 |
| 113 | Ga0207678_10014361 | 3300026067 | Bacteria | 6963 |
| 114 | Ga0207648_10140887 | 3300026089 | Bacteria | 2125 |
| 115 | Ga0207675_101506143 | 3300026118 | Bacteria | 693 |
| 116 | Ga0207683_11820831 | 3300026121 | Bacteria | 558 |
| 117 | Ga0209371_1022274 | 3300027312 | Bacteria | 1517 |
| 118 | Ga0209984_1022039 | 3300027424 | Bacteria | 876 |
| 119 | Ga0210000_1009739 | 3300027462 | Bacteria | 1417 |
| 120 | Ga0209982_1030888 | 3300027552 | Bacteria | 842 |
| 121 | Ga0209970_1002881 | 3300027614 | Bacteria | 2901 |
| 122 | Ga0209971_1124722 | 3300027682 | Bacteria | 633 |
| 123 | Ga0209998_10028465 | 3300027717 | Bacteria | 1229 |
| 124 | Ga0209974_10037382 | 3300027876 | Bacteria | 1612 |
| 125 | Ga0268265_10542367 | 3300028380 | Bacteria | 1103 |
| 126 | Ga0265338_10039962 | 3300028800 | Bacteria | 4414 |
| 127 | Ga0268256_1015121 | 3300030500 | Bacteria | 2265 |
| 128 | Ga0265340_10005801 | 3300031247 | Bacteria | 6834 |
| 129 | Ga0307408_100016801 | 3300031548 | Bacteria | 4891 |
| 130 | Ga0307408_100064093 | 3300031548 | Bacteria | 2690 |
| 131 | Ga0316575_10018865 | 3300031665 | Bacteria | 2633 |
| 132 | Ga0316579_10051431 | 3300031691 | Bacteria | 1928 |
| 133 | Ga0316579_10055585 | 3300031691 | Bacteria | 1856 |
| 134 | Ga0316576_10031593 | 3300031727 | Bacteria | 3758 |
| 135 | Ga0316576_10050696 | 3300031727 | Bacteria | 3019 |
| 136 | Ga0316576_10244876 | 3300031727 | Bacteria | 1346 |
| 137 | Ga0316576_10791591 | 3300031727 | Bacteria | 683 |
| 138 | Ga0316578_10010404 | 3300031728 | Bacteria | 4828 |
| 139 | Ga0316578_10053861 | 3300031728 | Bacteria | 2358 |
| 140 | Ga0316578_10303381 | 3300031728 | Bacteria | 954 |
| 141 | Ga0307405_10005460 | 3300031731 | Bacteria | 6133 |
| 142 | Ga0307405_10010532 | 3300031731 | Bacteria | 4799 |
| 143 | Ga0307405_10023496 | 3300031731 | Bacteria | 3505 |
| 144 | Ga0316577_10014054 | 3300031733 | Bacteria | 4393 |
| 145 | Ga0316577_10017001 | 3300031733 | Bacteria | 4014 |
| 146 | Ga0316577_10029415 | 3300031733 | Bacteria | 3066 |
| 147 | Ga0316577_10089183 | 3300031733 | Bacteria | 1726 |
| 148 | Ga0307413_10237618 | 3300031824 | Bacteria | 1343 |
| 149 | Ga0307410_10123941 | 3300031852 | Bacteria | 1888 |
| 150 | Ga0307406_10086940 | 3300031901 | Bacteria | 2094 |
| 151 | Ga0307407_10082493 | 3300031903 | Bacteria | 1948 |
| 152 | Ga0307412_10000064 | 3300031911 | Bacteria | 125607 |
| 153 | Ga0307412_10006577 | 3300031911 | Bacteria | 6582 |
| 154 | Ga0307412_10075653 | 3300031911 | Bacteria | 2310 |
| 155 | Ga0307412_11439240 | 3300031911 | Bacteria | 625 |
| 156 | Ga0307416_100019961 | 3300032002 | Bacteria | 4767 |
| 157 | Ga0307416_100051884 | 3300032002 | Bacteria | 3280 |
| 158 | Ga0307414_10258977 | 3300032004 | Bacteria | 1450 |
| 159 | Ga0307414_10415844 | 3300032004 | Bacteria | 1171 |
| 160 | Ga0307411_10125024 | 3300032005 | Bacteria | 1868 |
| 161 | Ga0307411_10126842 | 3300032005 | Bacteria | 1857 |
| 162 | Ga0307415_100001747 | 3300032126 | Bacteria | 10595 |
| 163 | Ga0307415_100677458 | 3300032126 | Bacteria | 928 |
| 164 | Ga0316583_10018761 | 3300032133 | Bacteria | 2484 |
| 165 | Ga0316585_10004582 | 3300032137 | Bacteria | 3858 |
| 166 | Ga0316585_10005209 | 3300032137 | Bacteria | 3663 |
| 167 | Ga0316580_10001248 | 3300032139 | Bacteria | 6541 |
| 168 | Ga0316580_10015502 | 3300032139 | Bacteria | 2332 |
| 169 | Ga0316580_10071492 | 3300032139 | Bacteria | 1062 |
| 170 | Ga0316593_10000036 | 3300032168 | Bacteria | 14338 |
| 171 | Ga0316593_10000166 | 3300032168 | Bacteria | 9684 |
| 172 | Ga0316593_10000428 | 3300032168 | Bacteria | 7633 |
| 173 | Ga0316593_10001061 | 3300032168 | Bacteria | 5745 |
| 174 | Ga0316593_10001853 | 3300032168 | Bacteria | 4838 |
| 175 | Ga0316593_10002299 | 3300032168 | Bacteria | 4486 |
| 176 | Ga0316593_10013143 | 3300032168 | Bacteria | 2445 |
| 177 | Ga0316593_10018380 | 3300032168 | Bacteria | 2148 |
| 178 | Ga0316593_10028013 | 3300032168 | Bacteria | 1812 |
| 179 | Ga0316593_10041269 | 3300032168 | Bacteria | 1535 |
| 180 | Ga0316593_10060618 | 3300032168 | Bacteria | 1293 |
| 181 | Ga0316593_10101092 | 3300032168 | Bacteria | 1023 |
| 182 | Ga0316593_10101348 | 3300032168 | Bacteria | 1022 |
| 183 | Ga0316593_10101553 | 3300032168 | Bacteria | 1021 |
| 184 | Ga0316593_10126086 | 3300032168 | Bacteria | 922 |
| 185 | Ga0316593_10145910 | 3300032168 | Bacteria | 859 |
| 186 | Ga0316592_1004383 | 3300033524 | Bacteria | 2620 |
| 187 | Ga0316592_1010303 | 3300033524 | Bacteria | 1883 |
| 188 | Ga0316592_1017787 | 3300033524 | Bacteria | 1494 |
| 189 | Ga0316592_1018691 | 3300033524 | Bacteria | 1462 |
| 190 | Ga0316592_1019050 | 3300033524 | Bacteria | 1450 |
| 191 | Ga0316592_1042763 | 3300033524 | Bacteria | 1005 |
| 192 | Ga0316592_1065393 | 3300033524 | Bacteria | 819 |
| 193 | Ga0316592_1083041 | 3300033524 | Bacteria | 729 |
| 194 | Ga0316586_1003794 | 3300033527 | Bacteria | 2014 |
| 195 | Ga0316586_1028806 | 3300033527 | Bacteria | 945 |
| 196 | Ga0316586_1031625 | 3300033527 | Bacteria | 909 |
| 197 | Ga0316588_1000170 | 3300033528 | Bacteria | 7304 |
| 198 | Ga0316588_1006820 | 3300033528 | Bacteria | 2298 |
| 199 | Ga0316588_1008204 | 3300033528 | Bacteria | 2143 |
| 200 | Ga0316588_1015670 | 3300033528 | Bacteria | 1672 |
| 201 | Ga0316588_1020814 | 3300033528 | Bacteria | 1488 |
| 202 | Ga0316588_1045526 | 3300033528 | Bacteria | 1056 |
| 203 | Ga0316588_1050277 | 3300033528 | Bacteria | 1010 |
| 204 | Ga0316588_1051689 | 3300033528 | Bacteria | 997 |
| 205 | Ga0316588_1062796 | 3300033528 | Bacteria | 907 |
| 206 | Ga0316588_1080922 | 3300033528 | Bacteria | 804 |
| 207 | Ga0316587_1007532 | 3300033529 | Bacteria | 1692 |
| 208 | Ga0316587_1012997 | 3300033529 | Bacteria | 1360 |
| 209 | Ga0316587_1024877 | 3300033529 | Bacteria | 1038 |
| 210 | Ga0316587_1032087 | 3300033529 | Bacteria | 930 |
| 211 | Ga0316587_1035227 | 3300033529 | Bacteria | 894 |
| 212 | Ga0316587_1049563 | 3300033529 | Bacteria | 768 |
| 213 | Ga0316587_1052161 | 3300033529 | Bacteria | 750 |
| 214 | Ga0316587_1056584 | 3300033529 | Bacteria | 723 |
| 215 | Ga0316596_1001022 | 3300033541 | Bacteria | 5394 |
| 216 | Ga0316596_1009154 | 3300033541 | Bacteria | 2373 |
| 217 | Ga0316596_1009280 | 3300033541 | Bacteria | 2359 |
| 218 | Ga0316596_1016897 | 3300033541 | Bacteria | 1830 |
| 219 | Ga0316596_1017677 | 3300033541 | Bacteria | 1796 |
| 220 | Ga0316596_1018177 | 3300033541 | Bacteria | 1775 |
| 221 | Ga0316596_1021480 | 3300033541 | Bacteria | 1646 |
| 222 | Ga0316596_1032508 | 3300033541 | Bacteria | 1358 |
| 223 | Ga0316596_1053009 | 3300033541 | Bacteria | 1075 |
| 224 | Ga0316596_1054693 | 3300033541 | Bacteria | 1059 |
| 225 | Ga0316596_1060954 | 3300033541 | Bacteria | 1006 |
| 226 | Ga0316596_1068858 | 3300033541 | Bacteria | 947 |
| 227 | Ga0316596_1080436 | 3300033541 | Bacteria | 876 |
| 228 | Ga0316574_0003222 | 3300035398 | Bacteria | 8368 |
| 229 | Ga0316574_0011720 | 3300035398 | Bacteria | 4992 |
| 230 | Ga0316574_0027946 | 3300035398 | Bacteria | 3399 |
| 231 | Ga0316574_0224679 | 3300035398 | Bacteria | 1202 |
| 232 | Ga0316582_0019712 | 3300036647 | Bacteria | 3954 |
| 233 | Ga0316582_0040487 | 3300036647 | Bacteria | 2908 |
| 234 | Ga0316582_0059380 | 3300036647 | Bacteria | 2449 |
| 235 | Ga0316582_0126090 | 3300036647 | Bacteria | 1716 |
| 236 | Ga0316582_0133634 | 3300036647 | Bacteria | 1668 |
| 237 | Ga0316582_0232341 | 3300036647 | Bacteria | 1262 |
| 238 | Ga0316582_0422295 | 3300036647 | Bacteria | 919 |
| 239 | Ga0316584_0001168 | 3300036712 | Bacteria | 15495 |
| 240 | Ga0316584_0006670 | 3300036712 | Bacteria | 7828 |
| 241 | Ga0316584_0013338 | 3300036712 | Bacteria | 5813 |
| 242 | Ga0316584_0051944 | 3300036712 | Bacteria | 3066 |
| 243 | Ga0316584_0100719 | 3300036712 | Bacteria | 2163 |
| 244 | Ga0316584_0174021 | 3300036712 | Bacteria | 1595 |
| 245 | Ga0316584_0195445 | 3300036712 | Bacteria | 1494 |
| 246 | Ga0316584_0467720 | 3300036712 | Bacteria | 890 |
| 247 | Ga0316584_0728493 | 3300036712 | Bacteria | 678 |
| 248 | Ga0395905_0151404 | 3300037471 | Bacteria | 2182 |
| 249 | Ga0316581_0013037 | 3300037588 | Bacteria | 2351 |
| 250 | Ga0400490_14152 | 3300038726 | Bacteria | 6864 |
| 251 | Ga0400488_11009 | 3300038741 | Bacteria | 2891 |
| 252 | Ga0400486_04519 | 3300038742 | Bacteria | 1770 |
| 253 | Ga0400483_107409 | 3300039062 | Bacteria | 1368 |
| 254 | Ga0400483_204317 | 3300039062 | Bacteria | 1309 |
| 255 | Ga0400487_34970 | 3300039110 | Bacteria | 222491 |
| 256 | Ga0439439_0272691 | 3300041406 | Bacteria | 505 |
| 257 | Ga0439461_0019101 | 3300041410 | Bacteria | 1347 |
| 258 | Ga0439461_0071214 | 3300041410 | Bacteria | 806 |
| 259 | Ga0439465_0000414 | 3300041413 | Bacteria | 12468 |
| 260 | Ga0439442_043722 | 3300042002 | Bacteria | 944 |
| 261 | Ga0439443_003261 | 3300042003 | Bacteria | 2030 |
| 262 | Ga0439445_0024733 | 3300042004 | Bacteria | 1528 |
| 263 | Ga0439445_0092726 | 3300042004 | Bacteria | 852 |
| 264 | Ga0450894_009961 | 3300042131 | Bacteria | 1231 |
| 265 | Ga0450896_001169 | 3300042133 | Bacteria | 3140 |
| 266 | Ga0450900_031413 | 3300042136 | Bacteria | 773 |
| 267 | Ga0439446_0016865 | 3300042156 | Bacteria | 2037 |
| 268 | Ga0439446_0123013 | 3300042156 | Bacteria | 836 |
| 269 | Ga0450908_000002 | 3300042184 | Bacteria | 94473 |
| 270 | Ga0439434_0007927 | 3300042435 | Bacteria | 3114 |
| 271 | Ga0439435_0001735 | 3300042436 | Bacteria | 4132 |
| 272 | Ga0439444_0000070 | 3300042437 | Bacteria | 7673 |
| 273 | Ga0450916_006818 | 3300042530 | Bacteria | 1355 |
| 274 | Ga0466965_0180237 | 3300044683 | Bacteria | 1114 |
| 275 | Ga0466966_0083446 | 3300044684 | Bacteria | 1988 |
| 276 | Ga0466961_0094054 | 3300044693 | Bacteria | 1891 |
| 277 | Ga0466968_0000604 | 3300044735 | Bacteria | 12238 |
| 278 | Ga0466970_0009954 | 3300044765 | Bacteria | 4815 |
| 279 | Ga0466958_0030002 | 3300045836 | Bacteria | 3227 |
| 280 | Ga0495592_0008428 | 3300046454 | Bacteria | 7735 |
| 281 | Ga0495592_0059018 | 3300046454 | Bacteria | 2827 |
| 282 | Ga0495603_0000767 | 3300046455 | Bacteria | 18339 |
| 283 | Ga0495603_0001742 | 3300046455 | Bacteria | 12820 |
| 284 | Ga0495590_0000614 | 3300046457 | Bacteria | 16642 |
| 285 | Ga0495590_0001128 | 3300046457 | Bacteria | 11707 |
| 286 | Ga0495591_000607 | 3300046458 | Bacteria | 27108 |
| 287 | Ga0495629_0000045 | 3300046459 | Bacteria | 110283 |
| 288 | Ga0495629_0004690 | 3300046459 | Bacteria | 10240 |
| 289 | Ga0495629_0005302 | 3300046459 | Bacteria | 9639 |
| 290 | Ga0495629_0006169 | 3300046459 | Bacteria | 8900 |
| 291 | Ga0495629_0008588 | 3300046459 | Bacteria | 7522 |
| 292 | Ga0495629_0011857 | 3300046459 | Bacteria | 6322 |
| 293 | Ga0495629_0134533 | 3300046459 | Bacteria | 1721 |
| 294 | Ga0495638_0051809 | 3300046460 | Bacteria | 2559 |
| 295 | Ga0495641_0251615 | 3300046461 | Bacteria | 794 |
| 296 | Ga0495651_0065596 | 3300046462 | Bacteria | 2772 |
| 297 | Ga0495653_0001533 | 3300046463 | Bacteria | 18072 |
| 298 | Ga0495653_0016003 | 3300046463 | Bacteria | 6113 |
| 299 | Ga0495653_0018058 | 3300046463 | Bacteria | 5734 |
| 300 | Ga0495653_0054921 | 3300046463 | Bacteria | 3041 |
| 301 | Ga0495653_0510281 | 3300046463 | Bacteria | 748 |
| 302 | Ga0495653_0610638 | 3300046463 | Bacteria | 669 |
| 303 | Ga0495650_0002521 | 3300046471 | Bacteria | 14653 |
| 304 | Ga0495650_0008063 | 3300046471 | Bacteria | 6219 |
| 305 | Ga0495650_0018276 | 3300046471 | Bacteria | 3487 |
| 306 | Ga0495650_0028832 | 3300046471 | Bacteria | 2539 |
| 307 | Ga0495580_0000231 | 3300046472 | Bacteria | 43751 |
| 308 | Ga0495580_0005593 | 3300046472 | Bacteria | 10357 |
| 309 | Ga0495580_0005923 | 3300046472 | Bacteria | 10026 |
| 310 | Ga0495580_0021772 | 3300046472 | Bacteria | 4727 |
| 311 | Ga0495580_0050635 | 3300046472 | Bacteria | 2936 |
| 312 | Ga0495580_0177543 | 3300046472 | Bacteria | 1471 |
| 313 | Ga0495580_0532077 | 3300046472 | Bacteria | 782 |
| 314 | Ga0495580_0837377 | 3300046472 | Bacteria | 594 |
| 315 | Ga0495582_0010185 | 3300046473 | Bacteria | 5177 |
| 316 | Ga0495582_0016867 | 3300046473 | Bacteria | 3999 |
| 317 | Ga0495582_0059153 | 3300046473 | Bacteria | 2114 |
| 318 | Ga0495582_0082762 | 3300046473 | Bacteria | 1783 |
| 319 | Ga0495582_0233086 | 3300046473 | Bacteria | 1054 |
| 320 | Ga0495605_0013991 | 3300046474 | Bacteria | 4404 |
| 321 | Ga0495605_0021178 | 3300046474 | Bacteria | 3446 |
| 322 | Ga0495605_0146089 | 3300046474 | Bacteria | 1058 |
| 323 | Ga0495639_0124785 | 3300046475 | Bacteria | 1230 |
| 324 | Ga0495662_0050471 | 3300046476 | Bacteria | 2008 |
| 325 | Ga0495662_0136610 | 3300046476 | Bacteria | 1206 |
| 326 | Ga0495664_0001765 | 3300046477 | Bacteria | 11485 |
| 327 | Ga0495664_0580966 | 3300046477 | Bacteria | 666 |
| 328 | Ga0495594_0032109 | 3300046499 | Bacteria | 2849 |
| 329 | Ga0495596_0029805 | 3300046500 | Bacteria | 2186 |
| 330 | Ga0495596_0030050 | 3300046500 | Bacteria | 2176 |
| 331 | Ga0495583_0006155 | 3300046506 | Bacteria | 7903 |
| 332 | Ga0495606_0001070 | 3300046507 | Bacteria | 39542 |
| 333 | Ga0495606_0016826 | 3300046507 | Bacteria | 5556 |
| 334 | Ga0495606_0039677 | 3300046507 | Bacteria | 3169 |
| 335 | Ga0495606_0101472 | 3300046507 | Bacteria | 1751 |
| 336 | Ga0495606_0184856 | 3300046507 | Bacteria | 1199 |
| 337 | Ga0495606_0406992 | 3300046507 | Bacteria | 707 |
| 338 | Ga0495606_0474299 | 3300046507 | Bacteria | 636 |
| 339 | Ga0495608_0017269 | 3300046511 | Bacteria | 4994 |
| 340 | Ga0495608_0211743 | 3300046511 | Bacteria | 1218 |
| 341 | Ga0495610_0003016 | 3300046512 | Bacteria | 13494 |
| 342 | Ga0495618_0002418 | 3300046514 | Bacteria | 11998 |
| 343 | Ga0495618_0041159 | 3300046514 | Bacteria | 2909 |
| 344 | Ga0495618_0261154 | 3300046514 | Bacteria | 1084 |
| 345 | Ga0495620_0003652 | 3300046515 | Bacteria | 8783 |
| 346 | Ga0495620_0078984 | 3300046515 | Bacteria | 1333 |
| 347 | Ga0495620_0088123 | 3300046515 | Bacteria | 1248 |
| 348 | Ga0495620_0088768 | 3300046515 | Bacteria | 1242 |
| 349 | Ga0495628_0008148 | 3300046516 | Bacteria | 9015 |
| 350 | Ga0495628_0008543 | 3300046516 | Bacteria | 8773 |
| 351 | Ga0495628_0011126 | 3300046516 | Bacteria | 7616 |
| 352 | Ga0495628_0016295 | 3300046516 | Bacteria | 6200 |
| 353 | Ga0495628_0044380 | 3300046516 | Bacteria | 3537 |
| 354 | Ga0495628_0083525 | 3300046516 | Bacteria | 2479 |
| 355 | Ga0495630_0002357 | 3300046517 | Bacteria | 13104 |
| 356 | Ga0495630_0005311 | 3300046517 | Bacteria | 9091 |
| 357 | Ga0495630_0005866 | 3300046517 | Bacteria | 8686 |
| 358 | Ga0495630_0009245 | 3300046517 | Bacteria | 7086 |
| 359 | Ga0495630_0618345 | 3300046517 | Bacteria | 830 |
| 360 | Ga0495632_0215410 | 3300046519 | Bacteria | 870 |
| 361 | Ga0495632_0330890 | 3300046519 | Bacteria | 672 |
| 362 | Ga0495643_0051537 | 3300046522 | Bacteria | 2213 |
| 363 | Ga0495643_0148452 | 3300046522 | Bacteria | 1163 |
| 364 | Ga0495648_0024321 | 3300046524 | Bacteria | 4127 |
| 365 | Ga0495648_0034978 | 3300046524 | Bacteria | 3261 |
| 366 | Ga0495666_0001867 | 3300046526 | Bacteria | 10396 |
| 367 | Ga0495666_0004660 | 3300046526 | Bacteria | 6940 |
| 368 | Ga0495666_0009108 | 3300046526 | Bacteria | 4965 |
| 369 | Ga0495666_0030423 | 3300046526 | Bacteria | 2649 |
| 370 | Ga0495666_0200897 | 3300046526 | Bacteria | 916 |
| 371 | Ga0495642_0024460 | 3300046528 | Bacteria | 2389 |
| 372 | Ga0495642_0033445 | 3300046528 | Bacteria | 2067 |
| 373 | Ga0495642_0036355 | 3300046528 | Bacteria | 1990 |
| 374 | Ga0495642_0099392 | 3300046528 | Bacteria | 1237 |
| 375 | Ga0495652_0002695 | 3300046529 | Bacteria | 18044 |
| 376 | Ga0495652_0011258 | 3300046529 | Bacteria | 8097 |
| 377 | Ga0495652_0032981 | 3300046529 | Bacteria | 4525 |
| 378 | Ga0495652_0060083 | 3300046529 | Bacteria | 3213 |
| 379 | Ga0495652_0312890 | 3300046529 | Bacteria | 1137 |
| 380 | Ga0495665_0002458 | 3300046531 | Bacteria | 10006 |
| 381 | Ga0495665_0003172 | 3300046531 | Bacteria | 8899 |
| 382 | Ga0495665_0009913 | 3300046531 | Bacteria | 5158 |
| 383 | Ga0495665_0124153 | 3300046531 | Bacteria | 1352 |
| 384 | Ga0495665_0144908 | 3300046531 | Bacteria | 1240 |
| 385 | Ga0495640_0003609 | 3300046533 | Bacteria | 12435 |
| 386 | Ga0495586_0001671 | 3300046535 | Bacteria | 12171 |
| 387 | Ga0495586_0064690 | 3300046535 | Bacteria | 1993 |
| 388 | Ga0495587_0017869 | 3300046536 | Bacteria | 4399 |
| 389 | Ga0495587_0834327 | 3300046536 | Bacteria | 503 |
| 390 | Ga0495597_0010233 | 3300046542 | Bacteria | 4594 |
| 391 | Ga0495597_0028805 | 3300046542 | Bacteria | 2539 |
| 392 | Ga0495645_0000412 | 3300046543 | Bacteria | 29424 |
| 393 | Ga0495645_0001252 | 3300046543 | Bacteria | 17318 |
| 394 | Ga0495645_0027455 | 3300046543 | Bacteria | 4136 |
| 395 | Ga0495622_0000151 | 3300046557 | Bacteria | 59707 |
| 396 | Ga0495667_0075534 | 3300046559 | Bacteria | 2193 |
| 397 | Ga0495667_0110373 | 3300046559 | Bacteria | 1777 |
| 398 | Ga0495667_0189391 | 3300046559 | Bacteria | 1319 |
| 399 | Ga0495634_0005426 | 3300046642 | Bacteria | 9819 |
| 400 | Ga0495611_0053855 | 3300046648 | Bacteria | 1817 |
| 401 | Ga0495625_0292178 | 3300046660 | Bacteria | 1045 |
| 402 | Ga0495635_0001381 | 3300046663 | Bacteria | 16190 |
| 403 | Ga0495635_0007918 | 3300046663 | Bacteria | 7422 |
| 404 | Ga0495635_0088407 | 3300046663 | Bacteria | 2120 |
| 405 | Ga0495635_0824093 | 3300046663 | Bacteria | 597 |
| 406 | Ga0495661_0006407 | 3300046665 | Bacteria | 8272 |
| 407 | Ga0495661_0038378 | 3300046665 | Bacteria | 2984 |
| 408 | Ga0495661_0047422 | 3300046665 | Bacteria | 2616 |
| 409 | Ga0495599_0030602 | 3300046678 | Bacteria | 3378 |
| 410 | Ga0495599_0434370 | 3300046678 | Bacteria | 779 |
| 411 | Ga0495623_0002339 | 3300046679 | Bacteria | 12639 |
| 412 | Ga0495623_0010339 | 3300046679 | Bacteria | 6040 |
| 413 | Ga0495623_0013698 | 3300046679 | Bacteria | 5257 |
| 414 | Ga0495623_0046948 | 3300046679 | Bacteria | 2741 |
| 415 | Ga0495646_0001216 | 3300046680 | Bacteria | 15098 |
| 416 | Ga0495646_0002389 | 3300046680 | Bacteria | 11510 |
| 417 | Ga0495646_0009128 | 3300046680 | Bacteria | 6289 |
| 418 | Ga0495646_0079366 | 3300046680 | Bacteria | 1916 |
| 419 | Ga0495646_0196532 | 3300046680 | Bacteria | 1100 |
| 420 | Ga0495646_0338779 | 3300046680 | Bacteria | 789 |
| 421 | Ga0495669_0113595 | 3300046684 | Bacteria | 1266 |
| 422 | Ga0495669_0159440 | 3300046684 | Bacteria | 1070 |
| 423 | Ga0495613_0002519 | 3300046689 | Bacteria | 13804 |
| 424 | Ga0495613_0003618 | 3300046689 | Bacteria | 11581 |
| 425 | Ga0495613_0400487 | 3300046689 | Bacteria | 936 |
| 426 | Ga0495613_0498261 | 3300046689 | Bacteria | 820 |
| 427 | Ga0495624_0001106 | 3300046690 | Bacteria | 21331 |
| 428 | Ga0495624_0002864 | 3300046690 | Bacteria | 12924 |
| 429 | Ga0495624_0006417 | 3300046690 | Bacteria | 8345 |
| 430 | Ga0495624_0023343 | 3300046690 | Bacteria | 4079 |
| 431 | Ga0495624_0166231 | 3300046690 | Bacteria | 1346 |
| 432 | Ga0495671_0006759 | 3300046692 | Bacteria | 6600 |
| 433 | Ga0495671_0126449 | 3300046692 | Bacteria | 1246 |
| 434 | Ga0495649_0003622 | 3300046694 | Bacteria | 10316 |
| 435 | Ga0495649_0015609 | 3300046694 | Bacteria | 4318 |
| 436 | Ga0495649_0023616 | 3300046694 | Bacteria | 3435 |
| 437 | Ga0495649_0042089 | 3300046694 | Bacteria | 2496 |
| 438 | Ga0495589_0000923 | 3300046794 | Bacteria | 18039 |
| 439 | Ga0495589_0095508 | 3300046794 | Bacteria | 1442 |
| 440 | Ga0495589_0128772 | 3300046794 | Bacteria | 1216 |
| 441 | Ga0495589_0314625 | 3300046794 | Bacteria | 724 |
| 442 | Ga0495600_0003633 | 3300046809 | Bacteria | 9097 |
| 443 | Ga0495600_0063572 | 3300046809 | Bacteria | 2412 |
| 444 | Ga0495600_0090896 | 3300046809 | Bacteria | 1991 |
| 445 | Ga0495600_0155355 | 3300046809 | Bacteria | 1480 |
| 446 | Ga0495660_0076466 | 3300046810 | Bacteria | 1764 |
| 447 | Ga0495660_0125538 | 3300046810 | Bacteria | 1293 |
| 448 | Ga0495660_0129614 | 3300046810 | Bacteria | 1267 |
| 449 | Ga0495660_0180129 | 3300046810 | Bacteria | 1023 |
| 450 | Ga0495581_0002085 | 3300047315 | Bacteria | 11256 |
| 451 | Ga0495581_0012192 | 3300047315 | Bacteria | 4977 |
| 452 | Ga0495581_0750296 | 3300047315 | Bacteria | 561 |
| 453 | Ga0495604_0003581 | 3300047317 | Bacteria | 12380 |
| 454 | Ga0495604_0006389 | 3300047317 | Bacteria | 9348 |
| 455 | Ga0495604_0013157 | 3300047317 | Bacteria | 6588 |
| 456 | Ga0495604_0048178 | 3300047317 | Bacteria | 3315 |
| 457 | Ga0495604_0059605 | 3300047317 | Bacteria | 2925 |
| 458 | Ga0495604_0091956 | 3300047317 | Bacteria | 2248 |
| 459 | Ga0495604_0492696 | 3300047317 | Bacteria | 796 |
| 460 | Ga0495674_0008505 | 3300047319 | Bacteria | 9771 |
| 461 | Ga0495674_0015605 | 3300047319 | Bacteria | 7094 |
| 462 | Ga0495674_0024605 | 3300047319 | Bacteria | 5529 |
| 463 | Ga0495674_0061154 | 3300047319 | Bacteria | 3283 |
| 464 | Ga0495674_0141992 | 3300047319 | Bacteria | 2018 |
| 465 | Ga0495674_0170961 | 3300047319 | Bacteria | 1813 |
| 466 | Ga0495674_0313450 | 3300047319 | Bacteria | 1279 |
| 467 | Ga0495674_0427805 | 3300047319 | Bacteria | 1066 |
| 468 | Ga0495672_0065919 | 3300047320 | Bacteria | 2068 |
| 469 | Ga0495672_0167543 | 3300047320 | Bacteria | 1123 |
| 470 | Ga0495672_0175985 | 3300047320 | Bacteria | 1087 |
| 471 | Ga0495676_0001018 | 3300047321 | Bacteria | 23664 |
| 472 | Ga0495676_0435191 | 3300047321 | Bacteria | 866 |
| 473 | Ga0495676_0598133 | 3300047321 | Bacteria | 718 |
| 474 | Ga0495680_0005679 | 3300047322 | Bacteria | 11677 |
| 475 | Ga0495680_0011282 | 3300047322 | Bacteria | 7922 |
| 476 | Ga0495680_0018585 | 3300047322 | Bacteria | 5893 |
| 477 | Ga0495680_0054262 | 3300047322 | Bacteria | 3113 |
| 478 | Ga0495680_0234183 | 3300047322 | Bacteria | 1307 |
| 479 | Ga0495680_0400162 | 3300047322 | Bacteria | 948 |
| 480 | Ga0495683_0000993 | 3300047323 | Bacteria | 19836 |
| 481 | Ga0495683_0006479 | 3300047323 | Bacteria | 6396 |
| 482 | Ga0495683_0007249 | 3300047323 | Bacteria | 6018 |
| 483 | Ga0495683_0009669 | 3300047323 | Bacteria | 5132 |
| 484 | Ga0495683_0019559 | 3300047323 | Bacteria | 3494 |
| 485 | Ga0495683_0080823 | 3300047323 | Bacteria | 1585 |
| 486 | Ga0495683_0198550 | 3300047323 | Bacteria | 906 |
| 487 | Ga0495687_005606 | 3300047443 | Bacteria | 7938 |
| 488 | Ga0495687_072025 | 3300047443 | Bacteria | 1382 |
| 489 | Ga0495687_107493 | 3300047443 | Bacteria | 1033 |
| 490 | Ga0495675_0000909 | 3300047444 | Bacteria | 18029 |
| 491 | Ga0495675_0007250 | 3300047444 | Bacteria | 6830 |
| 492 | Ga0495675_0022731 | 3300047444 | Bacteria | 3998 |
| 493 | Ga0495675_0166254 | 3300047444 | Bacteria | 1356 |
| 494 | Ga0495675_0336964 | 3300047444 | Bacteria | 889 |
| 495 | Ga0495679_000065 | 3300047446 | Bacteria | 101084 |
| 496 | Ga0495679_001439 | 3300047446 | Bacteria | 13511 |
| 497 | Ga0495679_003664 | 3300047446 | Bacteria | 7330 |
| 498 | Ga0495679_157730 | 3300047446 | Bacteria | 607 |
| 499 | Ga0495673_0036653 | 3300047469 | Bacteria | 2246 |
| 500 | Ga0495681_0055629 | 3300047470 | Bacteria | 1844 |
| 501 | Ga0495681_0215444 | 3300047470 | Bacteria | 772 |
| 502 | Ga0495684_0005872 | 3300047471 | Bacteria | 9537 |
| 503 | Ga0495684_0039217 | 3300047471 | Bacteria | 3631 |
| 504 | Ga0495684_0135921 | 3300047471 | Bacteria | 1845 |
| 505 | Ga0495686_0013432 | 3300047472 | Bacteria | 5680 |
| 506 | Ga0495686_0048027 | 3300047472 | Bacteria | 2693 |
| 507 | Ga0495593_0005302 | 3300047673 | Bacteria | 7617 |
| 508 | Ga0495593_0019568 | 3300047673 | Bacteria | 3795 |
| 509 | Ga0495593_0037455 | 3300047673 | Bacteria | 2623 |
| 510 | Ga0495593_0038541 | 3300047673 | Bacteria | 2581 |
| 511 | Ga0495593_0080351 | 3300047673 | Bacteria | 1687 |
| 512 | Ga0495593_0113352 | 3300047673 | Bacteria | 1383 |
| 513 | Ga0495602_0003204 | 3300048088 | Bacteria | 16886 |
| 514 | Ga0495602_0011731 | 3300048088 | Bacteria | 9051 |
| 515 | Ga0495602_0012129 | 3300048088 | Bacteria | 8879 |
| 516 | Ga0495602_0031369 | 3300048088 | Bacteria | 5025 |
| 517 | Ga0495602_0076227 | 3300048088 | Bacteria | 2842 |
| 518 | Ga0495602_0160199 | 3300048088 | Bacteria | 1758 |
| 519 | Ga0495614_0002052 | 3300048089 | Bacteria | 8862 |
| 520 | Ga0495614_0003001 | 3300048089 | Bacteria | 7519 |
| 521 | Ga0495614_0037939 | 3300048089 | Bacteria | 2068 |
| 522 | Ga0495626_0022934 | 3300048091 | Bacteria | 3079 |
| 523 | Ga0495626_0106563 | 3300048091 | Bacteria | 1217 |
| 524 | Ga0496100_0001524 | 3300048903 | Bacteria | 11360 |
| 525 | Ga0496100_0443268 | 3300048903 | Bacteria | 994 |
| 526 | Ga0496101_0006725 | 3300048904 | Bacteria | 7416 |
| 527 | Ga0496101_0012663 | 3300048904 | Bacteria | 5636 |
| 528 | Ga0496102_0024645 | 3300048905 | Bacteria | 5349 |
| 529 | Ga0496102_0144151 | 3300048905 | Bacteria | 2234 |
| 530 | Ga0496102_0428989 | 3300048905 | Bacteria | 1241 |
| 531 | Ga0496103_0004707 | 3300048906 | Bacteria | 8255 |
| 532 | Ga0496103_0056007 | 3300048906 | Bacteria | 2446 |
| 533 | Ga0496104_0199928 | 3300048907 | Bacteria | 1910 |
| 534 | Ga0496105_0069881 | 3300048908 | Bacteria | 2902 |
| 535 | Ga0496106_0008851 | 3300048909 | Bacteria | 7440 |
| 536 | Ga0496106_0296609 | 3300048909 | Bacteria | 1296 |
| 537 | Ga0496107_0002718 | 3300048910 | Bacteria | 11601 |
| 538 | Ga0496107_0452778 | 3300048910 | Bacteria | 953 |
| 539 | Ga0496108_0145629 | 3300048911 | Bacteria | 2042 |
| 540 | Ga0496109_0109968 | 3300048912 | Bacteria | 2562 |
| 541 | Ga0496110_0004347 | 3300048913 | Bacteria | 10966 |
| 542 | Ga0496111_0019593 | 3300048914 | Bacteria | 4704 |
| 543 | Ga0496112_1358726 | 3300048915 | Bacteria | 625 |
| 544 | Ga0496113_0073902 | 3300048916 | Bacteria | 2598 |
| 545 | Ga0496114_0000585 | 3300048917 | Bacteria | 26943 |
| 546 | Ga0496115_0150191 | 3300048918 | Bacteria | 1923 |
| 547 | Ga0496115_1026258 | 3300048918 | Bacteria | 629 |
| 548 | Ga0496116_0001067 | 3300048919 | Bacteria | 33110 |
| 549 | Ga0496116_0012744 | 3300048919 | Bacteria | 6837 |
| 550 | Ga0496116_0040457 | 3300048919 | Bacteria | 3210 |
| 551 | Ga0496116_0061855 | 3300048919 | Bacteria | 2421 |
| 552 | Ga0496116_0201580 | 3300048919 | Bacteria | 1041 |
| 553 | Ga0496117_0005272 | 3300048920 | Bacteria | 13703 |
| 554 | Ga0496117_0009550 | 3300048920 | Bacteria | 8998 |
| 555 | Ga0496117_0099990 | 3300048920 | Bacteria | 1838 |
| 556 | Ga0496117_0216608 | 3300048920 | Bacteria | 1069 |
| 557 | Ga0496118_0001212 | 3300048921 | Bacteria | 39684 |
| 558 | Ga0496118_0012154 | 3300048921 | Bacteria | 8306 |
| 559 | Ga0496118_0082446 | 3300048921 | Bacteria | 2253 |
| 560 | Ga0496118_0124763 | 3300048921 | Bacteria | 1669 |
| 561 | Ga0496118_0129228 | 3300048921 | Bacteria | 1626 |
| 562 | Ga0496119_0011572 | 3300048922 | Bacteria | 7282 |
| 563 | Ga0496119_0115385 | 3300048922 | Bacteria | 1484 |
| 564 | Ga0496119_0319535 | 3300048922 | Bacteria | 760 |
| 565 | Ga0496120_0135289 | 3300048923 | Bacteria | 1257 |
| 566 | Ga0496121_0001094 | 3300048924 | Bacteria | 47846 |
| 567 | Ga0496121_0002638 | 3300048924 | Bacteria | 27015 |
| 568 | Ga0496121_0021589 | 3300048924 | Bacteria | 6299 |
| 569 | Ga0496121_0136331 | 3300048924 | Bacteria | 1828 |
| 570 | Ga0496122_0063393 | 3300048925 | Bacteria | 2698 |
| 571 | Ga0496123_0214510 | 3300048926 | Bacteria | 975 |
| 572 | Ga0496124_0010413 | 3300048927 | Bacteria | 9414 |
| 573 | Ga0496125_0021581 | 3300048928 | Bacteria | 6002 |
| 574 | Ga0496126_0000949 | 3300048929 | Bacteria | 49771 |
| 575 | Ga0496126_0002993 | 3300048929 | Bacteria | 21939 |
| 576 | Ga0496126_0428469 | 3300048929 | Bacteria | 1068 |
| 577 | Ga0495678_008802 | 3300049459 | Bacteria | 5054 |
| 578 | Ga0495682_0015837 | 3300049460 | Bacteria | 2855 |
| 579 | Ga0501032_0790008 | 3300049569 | Bacteria | 600 |
| 580 | Ga0501042_0236542 | 3300049578 | Bacteria | 1318 |
| 581 | Ga0501048_0425741 | 3300049582 | Bacteria | 950 |
| 582 | Ga0501067_0090396 | 3300049583 | Bacteria | 1699 |
| 583 | Ga0501068_0003148 | 3300049584 | Bacteria | 8838 |
| 584 | Ga0501068_0059770 | 3300049584 | Bacteria | 2314 |
| 585 | Ga0501069_0569393 | 3300049585 | Bacteria | 678 |
| 586 | Ga0501071_0042026 | 3300049587 | Bacteria | 3274 |
| 587 | Ga0501071_0082325 | 3300049587 | Bacteria | 2357 |
| 588 | Ga0501072_0764948 | 3300049588 | Bacteria | 757 |
| 589 | Ga0501072_1029588 | 3300049588 | Bacteria | 641 |
| 590 | Ga0501073_0018441 | 3300049589 | Bacteria | 5044 |
| 591 | Ga0501073_0501276 | 3300049589 | Bacteria | 839 |
| 592 | Ga0501075_0190961 | 3300049591 | Bacteria | 1562 |
| 593 | Ga0501076_0087720 | 3300049592 | Bacteria | 2501 |
| 594 | Ga0501076_0137405 | 3300049592 | Bacteria | 1985 |
| 595 | Ga0501077_0110055 | 3300049593 | Bacteria | 1745 |
| 596 | Ga0501238_005841 | 3300049671 | Bacteria | 1574 |
| 597 | Ga0501079_0069980 | 3300049741 | Bacteria | 2709 |
| 598 | Ga0501079_0351228 | 3300049741 | Bacteria | 1155 |
| 599 | Ga0501080_0001700 | 3300049742 | Bacteria | 18781 |
| 600 | Ga0501080_0643874 | 3300049742 | Bacteria | 938 |
| 601 | Ga0501081_0070240 | 3300049743 | Bacteria | 2440 |
| 602 | Ga0501083_0237425 | 3300049744 | Bacteria | 1187 |
| 603 | Ga0501241_025278 | 3300049758 | Bacteria | 1106 |
| 604 | Ga0501045_0319548 | 3300049824 | Bacteria | 1155 |
| 605 | Ga0501045_0703155 | 3300049824 | Bacteria | 746 |
| 606 | nmdc:mga0k408_773645_c1 | 3300050493 | Bacteria | 560 |
| 607 | nmdc:mga05p37_573969_c1 | 3300050507 | Bacteria | 1279 |
| 608 | nmdc:mga0n895_5285_c1 | 3300050512 | Bacteria | 10754 |
| 609 | nmdc:mga0rr50_18633_c1 | 3300050513 | Bacteria | 4667 |
| 610 | nmdc:mga0a205_3924_c1 | 3300050515 | Bacteria | 5308 |
| 611 | nmdc:mga0a205_823664_c1 | 3300050515 | Bacteria | 776 |
| 612 | Ga0500658_0550590 | 3300053134 | Bacteria | 519 |
| 613 | Ga0500616_0000421 | 3300053153 | Bacteria | 56739 |
| 614 | Ga0501084_0145072 | 3300054114 | Bacteria | 1999 |
| 615 | Ga0501084_0249015 | 3300054114 | Bacteria | 1500 |
| 616 | Ga0587106_084687 | 3300059605 | Bacteria | 623 |
| 617 | Ga0501082_0006793 | 3300060353 | Bacteria | 9887 |
| 618 | Ga0501082_0220886 | 3300060353 | Bacteria | 1649 |
| 619 | Ga0501082_1022120 | 3300060353 | Bacteria | 723 |
| 620 | 2501076502 | 2501025501 | Bacteria | 7768574 |
| 621 | 2501079947 | 2501025502 | Bacteria | 9641094 |
| 622 | 2501412163 | 2501025504 | Bacteria | 8008976 |
| 623 | 2509130875 | 2508501125 | Bacteria | 7208311 |
| 624 | 2510248135 | 2510065045 | Bacteria | 7761063 |
| 625 | 2511087833 | 2510917013 | Bacteria | 9951648 |
| 626 | 2511101683 | 2510917014 | Bacteria | 8296963 |
| 627 | 2511107811 | 2510917015 | Bacteria | 7950052 |
| 628 | 2512349939 | 2512047030 | Bacteria | 9031815 |
| 629 | 2513559662 | 2513237083 | Bacteria | 8410967 |
| 630 | 2513962801 | 2513237151 | Bacteria | 6309801 |
| 631 | 2515684929 | 2515154122 | Bacteria | 8609520 |
| 632 | 2595447628 | 2593339238 | Bacteria | 4182970 |
| 633 | 2595450444 | 2593339239 | Bacteria | 4124669 |
| 634 | 2599443739 | 2599185178 | Bacteria | 5365746 |
| 635 | 2600814017 | 2600255067 | Bacteria | 6795583 |
| 636 | 2719643436 | 2718217991 | Bacteria | 7829542 |
| 637 | 2738823713 | 2738541296 | Bacteria | 7285013 |
| 638 | 2738836023 | 2738541298 | Bacteria | 7286732 |
| 639 | 2738877553 | 2738541306 | Bacteria | 7284992 |
| 640 | 2739189340 | 2738543002 | Bacteria | 7284546 |
| 641 | 2739224146 | 2738543008 | Bacteria | 7282815 |
| 642 | 2746090681 | 2744054900 | Bacteria | 8399525 |
| 643 | 2746092458 | 2744054901 | Bacteria | 8397047 |
| 644 | 2753570629 | 2751185846 | Bacteria | 7242164 |
| 645 | 2819623750 | 2818991450 | Bacteria | 6962147 |
| 646 | 2842326024 | 2842324504 | Bacteria | 9364110 |
| 647 | 2842351456 | 2842348783 | Bacteria | 9002918 |
| 648 | 2842455344 | 2842454564 | Bacteria | 8730687 |
| 649 | 2842922382 | 2842918807 | Bacteria | 4289178 |
| 650 | 2856289799 | 2856287931 | Bacteria | 7223934 |
| 651 | 2857363162 | 2857357740 | Bacteria | 9937880 |
| 652 | 2883090496 | 2883087390 | Bacteria | 9532701 |
| 653 | 2884342378 | 2884338543 | Bacteria | 4610696 |
| 654 | 2885267369 | 2885266251 | Bacteria | 4796748 |
| 655 | 2885277684 | 2885270888 | Bacteria | 9831543 |
| 656 | 2900582964 | 2900577576 | Bacteria | 5438534 |
| 657 | 2900639475 | 2900634093 | Bacteria | 10263517 |
| 658 | 2902683959 | 2902682994 | Bacteria | 8951596 |
| 659 | 2904465523 | 2904463128 | Bacteria | 4775606 |
| 660 | 2904490364 | 2904483920 | Bacteria | 7545285 |
| 661 | 2919533534 | 2919527303 | Bacteria | 7718827 |
| 662 | 2928062001 | 2928058823 | Bacteria | 5520022 |
| 663 | 2928112858 | 2928108538 | Bacteria | 7360024 |
| 664 | 2928139787 | 2928135762 | Bacteria | 7259641 |
| 665 | 2928507049 | 2928503688 | Bacteria | 7268108 |
| 666 | 2941474935 | 2941471342 | Bacteria | 5018624 |
| 667 | 2945941090 | 2945934425 | Bacteria | 7444609 |
| 668 | 2953996846 | 2953994433 | Bacteria | 4303959 |
| 669 | 2990708137 | 2990703756 | Bacteria | 7715990 |
| 670 | 642421953 | 641736151 | Bacteria | 7477263 |
| 671 | 642617805 | 642555113 | Bacteria | 8214658 |
| 672 | 8003956495 | 8003955200 | Bacteria | 8601927 |
| 673 | 8055307264 | 8055301274 | Bacteria | 8587385 |
| 674 | Ga0316577_10149906 | |||
| 675 | JGI24739J22299_10019453 | |||
| 676 | JGI24739J22299_10025854 | |||
| 677 | JGI24739J22299_10034556 | |||
| 678 | JGI24739J22299_10044176 | |||
| 679 | JGI24737J22298_10025977 | |||
| 680 | JGI24737J22298_10045316 | |||
| 681 | JGI24735J21928_10000766 | |||
| 682 | JGI25156J39149_1000706 | |||
| 683 | JGI25156J39149_1001898 | |||
| 684 | JGI25156J39149_1025763 | |||
| 685 | Ga0006562J51391_1019684 | |||
| 686 | Ga0055533_1001608 | |||
| 687 | Ga0055533_1003315 | |||
| 688 | Ga0055532_1000069 | |||
| 689 | Ga0055525_1007649 | |||
| 690 | Ga0055527_1000034 | |||
| 691 | Ga0055535_1000049 | |||
| 692 | Ga0055542_1000077 | |||
| 693 | Ga0055529_1000090 | |||
| 694 | Ga0065707_10571690 | |||
| 695 | Ga0070682_100604001 | |||
| 696 | Ga0070669_100082322 | |||
| 697 | Ga0070675_100018953 | |||
| 698 | Ga0070667_100349101 | |||
| 699 | Ga0070714_100000857 | |||
| 700 | Ga0070663_100551299 | |||
| 701 | Ga0068867_100200082 | |||
| 702 | Ga0070696_100107803 | |||
| 703 | Ga0068852_101190884 | |||
| 704 | Ga0068861_101093762 | |||
| 705 | Ga0068862_100221500 | |||
| 706 | Ga0075366_10434716 | |||
| 707 | Ga0075428_100023245 | |||
| 708 | Ga0075433_10025113 | |||
| 709 | Ga0075434_100043881 | |||
| 710 | Ga0068865_100366035 | |||
| 711 | Ga0105251_10000300 | |||
| 712 | Ga0105251_10000428 | |||
| 713 | Ga0105244_10072592 | |||
| 714 | Ga0105244_10320906 | |||
| 715 | Ga0105240_10534599 | |||
| 716 | Ga0111539_10003634 | |||
| 717 | Ga0111539_11276021 | |||
| 718 | Ga0114129_10082449 | |||
| 719 | Ga0105241_10039710 | |||
| 720 | Ga0105248_10060495 | |||
| 721 | Ga0105248_10548812 | |||
| 722 | Ga0105248_10565169 | |||
| 723 | Ga0105238_10196121 | |||
| 724 | Ga0105238_10466128 | |||
| 725 | Ga0105249_10839570 | |||
| 726 | Ga0105030_100177 | |||
| 727 | Ga0105239_12185314 | |||
| 728 | Ga0105246_10293126 | |||
| 729 | Ga0105246_10467414 | |||
| 730 | Ga0157316_1010787 | |||
| 731 | Ga0157369_10039579 | |||
| 732 | Ga0157369_10140179 | |||
| 733 | Ga0157369_10642835 | |||
| 734 | Ga0157369_10769095 | |||
| 735 | Ga0157374_10226513 | |||
| 736 | Ga0157375_11634092 | |||
| 737 | Ga0157514_117819 | |||
| 738 | Ga0157380_10180557 | |||
| 739 | Ga0182008_10010132 | |||
| 740 | Ga0182008_10037263 | |||
| 741 | Ga0182007_10000180 | |||
| 742 | Ga0209566_103562 | |||
| 743 | Ga0209674_100333 | |||
| 744 | Ga0209674_100469 | |||
| 745 | Ga0209674_100599 | |||
| 746 | Ga0209672_100002 | |||
| 747 | Ga0209147_100003 | |||
| 748 | Ga0209563_104319 | |||
| 749 | Ga0209437_100597 | |||
| 750 | Ga0209258_100077 | |||
| 751 | Ga0209677_110815 | |||
| 752 | Ga0209148_1000006 | |||
| 753 | Ga0209148_1001576 | |||
| 754 | Ga0209759_1000334 | |||
| 755 | Ga0209759_1001068 | |||
| 756 | Ga0209759_1001076 | |||
| 757 | Ga0209759_1025028 | |||
| 758 | Ga0209129_1006837 | |||
| 759 | Ga0209455_1000140 | |||
| 760 | Ga0209758_1018942 | |||
| 761 | Ga0209256_1013248 | |||
| 762 | Ga0207426_1005772 | |||
| 763 | Ga0207713_1000628 | |||
| 764 | Ga0207680_10059276 | |||
| 765 | Ga0207647_10024880 | |||
| 766 | Ga0207647_10046253 | |||
| 767 | Ga0207647_10129787 | |||
| 768 | Ga0207647_10290832 | |||
| 769 | Ga0207645_10355900 | |||
| 770 | Ga0207654_11035345 | |||
| 771 | Ga0207695_10193775 | |||
| 772 | Ga0207695_10314040 | |||
| 773 | Ga0207671_10068528 | |||
| 774 | Ga0207681_10133915 | |||
| 775 | Ga0207694_10694717 | |||
| 776 | Ga0207659_10070286 | |||
| 777 | Ga0207664_10000873 | |||
| 778 | Ga0207669_10371206 | |||
| 779 | Ga0207691_10116662 | |||
| 780 | Ga0207711_10030987 | |||
| 781 | Ga0207689_10218836 | |||
| 782 | Ga0207667_10431145 | |||
| 783 | Ga0207651_10434605 | |||
| 784 | Ga0207712_10483190 | |||
| 785 | Ga0207658_10132919 | |||
| 786 | Ga0207678_10014361 | |||
| 787 | Ga0207648_10140887 | |||
| 788 | Ga0207675_101506143 | |||
| 789 | Ga0207683_11820831 | |||
| 790 | Ga0209371_1022274 | |||
| 791 | Ga0209984_1022039 | |||
| 792 | Ga0210000_1009739 | |||
| 793 | Ga0209982_1030888 | |||
| 794 | Ga0209970_1002881 | |||
| 795 | Ga0209971_1124722 | |||
| 796 | Ga0209998_10028465 | |||
| 797 | Ga0209974_10037382 | |||
| 798 | Ga0268265_10542367 | |||
| 799 | Ga0265338_10039962 | |||
| 800 | Ga0268256_1015121 | |||
| 801 | Ga0265340_10005801 | |||
| 802 | Ga0307408_100016801 | |||
| 803 | Ga0307408_100064093 | |||
| 804 | Ga0316575_10018865 | |||
| 805 | Ga0316579_10051431 | |||
| 806 | Ga0316579_10055585 | |||
| 807 | Ga0316576_10031593 | |||
| 808 | Ga0316576_10050696 | |||
| 809 | Ga0316576_10244876 | |||
| 810 | Ga0316576_10791591 | |||
| 811 | Ga0316578_10010404 | |||
| 812 | Ga0316578_10053861 | |||
| 813 | Ga0316578_10303381 | |||
| 814 | Ga0307405_10005460 | |||
| 815 | Ga0307405_10010532 | |||
| 816 | Ga0307405_10023496 | |||
| 817 | Ga0316577_10014054 | |||
| 818 | Ga0316577_10017001 | |||
| 819 | Ga0316577_10029415 | |||
| 820 | Ga0316577_10089183 | |||
| 821 | Ga0307413_10237618 | |||
| 822 | Ga0307410_10123941 | |||
| 823 | Ga0307406_10086940 | |||
| 824 | Ga0307407_10082493 | |||
| 825 | Ga0307412_10000064 | |||
| 826 | Ga0307412_10006577 | |||
| 827 | Ga0307412_10075653 | |||
| 828 | Ga0307412_11439240 | |||
| 829 | Ga0307416_100019961 | |||
| 830 | Ga0307416_100051884 | |||
| 831 | Ga0307414_10258977 | |||
| 832 | Ga0307414_10415844 | |||
| 833 | Ga0307411_10125024 | |||
| 834 | Ga0307411_10126842 | |||
| 835 | Ga0307415_100001747 | |||
| 836 | Ga0307415_100677458 | |||
| 837 | Ga0316583_10018761 | |||
| 838 | Ga0316585_10004582 | |||
| 839 | Ga0316585_10005209 | |||
| 840 | Ga0316580_10001248 | |||
| 841 | Ga0316580_10015502 | |||
| 842 | Ga0316580_10071492 | |||
| 843 | Ga0316593_10000036 | |||
| 844 | Ga0316593_10000166 | |||
| 845 | Ga0316593_10000428 | |||
| 846 | Ga0316593_10001061 | |||
| 847 | Ga0316593_10001853 | |||
| 848 | Ga0316593_10002299 | |||
| 849 | Ga0316593_10013143 | |||
| 850 | Ga0316593_10018380 | |||
| 851 | Ga0316593_10028013 | |||
| 852 | Ga0316593_10041269 | |||
| 853 | Ga0316593_10060618 | |||
| 854 | Ga0316593_10101092 | |||
| 855 | Ga0316593_10101348 | |||
| 856 | Ga0316593_10101553 | |||
| 857 | Ga0316593_10126086 | |||
| 858 | Ga0316593_10145910 | |||
| 859 | Ga0316592_1004383 | |||
| 860 | Ga0316592_1010303 | |||
| 861 | Ga0316592_1017787 | |||
| 862 | Ga0316592_1018691 | |||
| 863 | Ga0316592_1019050 | |||
| 864 | Ga0316592_1042763 | |||
| 865 | Ga0316592_1065393 | |||
| 866 | Ga0316592_1083041 | |||
| 867 | Ga0316586_1003794 | |||
| 868 | Ga0316586_1028806 | |||
| 869 | Ga0316586_1031625 | |||
| 870 | Ga0316588_1000170 | |||
| 871 | Ga0316588_1006820 | |||
| 872 | Ga0316588_1008204 | |||
| 873 | Ga0316588_1015670 | |||
| 874 | Ga0316588_1020814 | |||
| 875 | Ga0316588_1045526 | |||
| 876 | Ga0316588_1050277 | |||
| 877 | Ga0316588_1051689 | |||
| 878 | Ga0316588_1062796 | |||
| 879 | Ga0316588_1080922 | |||
| 880 | Ga0316587_1007532 | |||
| 881 | Ga0316587_1012997 | |||
| 882 | Ga0316587_1024877 | |||
| 883 | Ga0316587_1032087 | |||
| 884 | Ga0316587_1035227 | |||
| 885 | Ga0316587_1049563 | |||
| 886 | Ga0316587_1052161 | |||
| 887 | Ga0316587_1056584 | |||
| 888 | Ga0316596_1001022 | |||
| 889 | Ga0316596_1009154 | |||
| 890 | Ga0316596_1009280 | |||
| 891 | Ga0316596_1016897 | |||
| 892 | Ga0316596_1017677 | |||
| 893 | Ga0316596_1018177 | |||
| 894 | Ga0316596_1021480 | |||
| 895 | Ga0316596_1032508 | |||
| 896 | Ga0316596_1053009 | |||
| 897 | Ga0316596_1054693 | |||
| 898 | Ga0316596_1060954 | |||
| 899 | Ga0316596_1068858 | |||
| 900 | Ga0316596_1080436 | |||
| 901 | Ga0316574_0003222 | |||
| 902 | Ga0316574_0011720 | |||
| 903 | Ga0316574_0027946 | |||
| 904 | Ga0316574_0224679 | |||
| 905 | Ga0316582_0019712 | |||
| 906 | Ga0316582_0040487 | |||
| 907 | Ga0316582_0059380 | |||
| 908 | Ga0316582_0126090 | |||
| 909 | Ga0316582_0133634 | |||
| 910 | Ga0316582_0232341 | |||
| 911 | Ga0316582_0422295 | |||
| 912 | Ga0316584_0001168 | |||
| 913 | Ga0316584_0006670 | |||
| 914 | Ga0316584_0013338 | |||
| 915 | Ga0316584_0051944 | |||
| 916 | Ga0316584_0100719 | |||
| 917 | Ga0316584_0174021 | |||
| 918 | Ga0316584_0195445 | |||
| 919 | Ga0316584_0467720 | |||
| 920 | Ga0316584_0728493 | |||
| 921 | Ga0395905_0151404 | |||
| 922 | Ga0316581_0013037 | |||
| 923 | Ga0400490_14152 | |||
| 924 | Ga0400488_11009 | |||
| 925 | Ga0400486_04519 | |||
| 926 | Ga0400483_107409 | |||
| 927 | Ga0400483_204317 | |||
| 928 | Ga0400487_34970 | |||
| 929 | Ga0439439_0272691 | |||
| 930 | Ga0439461_0019101 | |||
| 931 | Ga0439461_0071214 | |||
| 932 | Ga0439465_0000414 | |||
| 933 | Ga0439442_043722 | |||
| 934 | Ga0439443_003261 | |||
| 935 | Ga0439445_0024733 | |||
| 936 | Ga0439445_0092726 | |||
| 937 | Ga0450894_009961 | |||
| 938 | Ga0450896_001169 | |||
| 939 | Ga0450900_031413 | |||
| 940 | Ga0439446_0016865 | |||
| 941 | Ga0439446_0123013 | |||
| 942 | Ga0450908_000002 | |||
| 943 | Ga0439434_0007927 | |||
| 944 | Ga0439435_0001735 | |||
| 945 | Ga0439444_0000070 | |||
| 946 | Ga0450916_006818 | |||
| 947 | Ga0466965_0180237 | |||
| 948 | Ga0466966_0083446 | |||
| 949 | Ga0466961_0094054 | |||
| 950 | Ga0466968_0000604 | |||
| 951 | Ga0466970_0009954 | |||
| 952 | Ga0466958_0030002 | |||
| 953 | Ga0495592_0008428 | |||
| 954 | Ga0495592_0059018 | |||
| 955 | Ga0495603_0000767 | |||
| 956 | Ga0495603_0001742 | |||
| 957 | Ga0495590_0000614 | |||
| 958 | Ga0495590_0001128 | |||
| 959 | Ga0495591_000607 | |||
| 960 | Ga0495629_0000045 | |||
| 961 | Ga0495629_0004690 | |||
| 962 | Ga0495629_0005302 | |||
| 963 | Ga0495629_0006169 | |||
| 964 | Ga0495629_0008588 | |||
| 965 | Ga0495629_0011857 | |||
| 966 | Ga0495629_0134533 | |||
| 967 | Ga0495638_0051809 | |||
| 968 | Ga0495641_0251615 | |||
| 969 | Ga0495651_0065596 | |||
| 970 | Ga0495653_0001533 | |||
| 971 | Ga0495653_0016003 | |||
| 972 | Ga0495653_0018058 | |||
| 973 | Ga0495653_0054921 | |||
| 974 | Ga0495653_0510281 | |||
| 975 | Ga0495653_0610638 | |||
| 976 | Ga0495650_0002521 | |||
| 977 | Ga0495650_0008063 | |||
| 978 | Ga0495650_0018276 | |||
| 979 | Ga0495650_0028832 | |||
| 980 | Ga0495580_0000231 | |||
| 981 | Ga0495580_0005593 | |||
| 982 | Ga0495580_0005923 | |||
| 983 | Ga0495580_0021772 | |||
| 984 | Ga0495580_0050635 | |||
| 985 | Ga0495580_0177543 | |||
| 986 | Ga0495580_0532077 | |||
| 987 | Ga0495580_0837377 | |||
| 988 | Ga0495582_0010185 | |||
| 989 | Ga0495582_0016867 | |||
| 990 | Ga0495582_0059153 | |||
| 991 | Ga0495582_0082762 | |||
| 992 | Ga0495582_0233086 | |||
| 993 | Ga0495605_0013991 | |||
| 994 | Ga0495605_0021178 | |||
| 995 | Ga0495605_0146089 | |||
| 996 | Ga0495639_0124785 | |||
| 997 | Ga0495662_0050471 | |||
| 998 | Ga0495662_0136610 | |||
| 999 | Ga0495664_0001765 | |||
| 1000 | Ga0495664_0580966 | |||
| 1001 | Ga0495594_0032109 | |||
| 1002 | Ga0495596_0029805 | |||
| 1003 | Ga0495596_0030050 | |||
| 1004 | Ga0495583_0006155 | |||
| 1005 | Ga0495606_0001070 | |||
| 1006 | Ga0495606_0016826 | |||
| 1007 | Ga0495606_0039677 | |||
| 1008 | Ga0495606_0101472 | |||
| 1009 | Ga0495606_0184856 | |||
| 1010 | Ga0495606_0406992 | |||
| 1011 | Ga0495606_0474299 | |||
| 1012 | Ga0495608_0017269 | |||
| 1013 | Ga0495608_0211743 | |||
| 1014 | Ga0495610_0003016 | |||
| 1015 | Ga0495618_0002418 | |||
| 1016 | Ga0495618_0041159 | |||
| 1017 | Ga0495618_0261154 | |||
| 1018 | Ga0495620_0003652 | |||
| 1019 | Ga0495620_0078984 | |||
| 1020 | Ga0495620_0088123 | |||
| 1021 | Ga0495620_0088768 | |||
| 1022 | Ga0495628_0008148 | |||
| 1023 | Ga0495628_0008543 | |||
| 1024 | Ga0495628_0011126 | |||
| 1025 | Ga0495628_0016295 | |||
| 1026 | Ga0495628_0044380 | |||
| 1027 | Ga0495628_0083525 | |||
| 1028 | Ga0495630_0002357 | |||
| 1029 | Ga0495630_0005311 | |||
| 1030 | Ga0495630_0005866 | |||
| 1031 | Ga0495630_0009245 | |||
| 1032 | Ga0495630_0618345 | |||
| 1033 | Ga0495632_0215410 | |||
| 1034 | Ga0495632_0330890 | |||
| 1035 | Ga0495643_0051537 | |||
| 1036 | Ga0495643_0148452 | |||
| 1037 | Ga0495648_0024321 | |||
| 1038 | Ga0495648_0034978 | |||
| 1039 | Ga0495666_0001867 | |||
| 1040 | Ga0495666_0004660 | |||
| 1041 | Ga0495666_0009108 | |||
| 1042 | Ga0495666_0030423 | |||
| 1043 | Ga0495666_0200897 | |||
| 1044 | Ga0495642_0024460 | |||
| 1045 | Ga0495642_0033445 | |||
| 1046 | Ga0495642_0036355 | |||
| 1047 | Ga0495642_0099392 | |||
| 1048 | Ga0495652_0002695 | |||
| 1049 | Ga0495652_0011258 | |||
| 1050 | Ga0495652_0032981 | |||
| 1051 | Ga0495652_0060083 | |||
| 1052 | Ga0495652_0312890 | |||
| 1053 | Ga0495665_0002458 | |||
| 1054 | Ga0495665_0003172 | |||
| 1055 | Ga0495665_0009913 | |||
| 1056 | Ga0495665_0124153 | |||
| 1057 | Ga0495665_0144908 | |||
| 1058 | Ga0495640_0003609 | |||
| 1059 | Ga0495586_0001671 | |||
| 1060 | Ga0495586_0064690 | |||
| 1061 | Ga0495587_0017869 | |||
| 1062 | Ga0495587_0834327 | |||
| 1063 | Ga0495597_0010233 | |||
| 1064 | Ga0495597_0028805 | |||
| 1065 | Ga0495645_0000412 | |||
| 1066 | Ga0495645_0001252 | |||
| 1067 | Ga0495645_0027455 | |||
| 1068 | Ga0495622_0000151 | |||
| 1069 | Ga0495667_0075534 | |||
| 1070 | Ga0495667_0110373 | |||
| 1071 | Ga0495667_0189391 | |||
| 1072 | Ga0495634_0005426 | |||
| 1073 | Ga0495611_0053855 | |||
| 1074 | Ga0495625_0292178 | |||
| 1075 | Ga0495635_0001381 | |||
| 1076 | Ga0495635_0007918 | |||
| 1077 | Ga0495635_0088407 | |||
| 1078 | Ga0495635_0824093 | |||
| 1079 | Ga0495661_0006407 | |||
| 1080 | Ga0495661_0038378 | |||
| 1081 | Ga0495661_0047422 | |||
| 1082 | Ga0495599_0030602 | |||
| 1083 | Ga0495599_0434370 | |||
| 1084 | Ga0495623_0002339 | |||
| 1085 | Ga0495623_0010339 | |||
| 1086 | Ga0495623_0013698 | |||
| 1087 | Ga0495623_0046948 | |||
| 1088 | Ga0495646_0001216 | |||
| 1089 | Ga0495646_0002389 | |||
| 1090 | Ga0495646_0009128 | |||
| 1091 | Ga0495646_0079366 | |||
| 1092 | Ga0495646_0196532 | |||
| 1093 | Ga0495646_0338779 | |||
| 1094 | Ga0495669_0113595 | |||
| 1095 | Ga0495669_0159440 | |||
| 1096 | Ga0495613_0002519 | |||
| 1097 | Ga0495613_0003618 | |||
| 1098 | Ga0495613_0400487 | |||
| 1099 | Ga0495613_0498261 | |||
| 1100 | Ga0495624_0001106 | |||
| 1101 | Ga0495624_0002864 | |||
| 1102 | Ga0495624_0006417 | |||
| 1103 | Ga0495624_0023343 | |||
| 1104 | Ga0495624_0166231 | |||
| 1105 | Ga0495671_0006759 | |||
| 1106 | Ga0495671_0126449 | |||
| 1107 | Ga0495649_0003622 | |||
| 1108 | Ga0495649_0015609 | |||
| 1109 | Ga0495649_0023616 | |||
| 1110 | Ga0495649_0042089 | |||
| 1111 | Ga0495589_0000923 | |||
| 1112 | Ga0495589_0095508 | |||
| 1113 | Ga0495589_0128772 | |||
| 1114 | Ga0495589_0314625 | |||
| 1115 | Ga0495600_0003633 | |||
| 1116 | Ga0495600_0063572 | |||
| 1117 | Ga0495600_0090896 | |||
| 1118 | Ga0495600_0155355 | |||
| 1119 | Ga0495660_0076466 | |||
| 1120 | Ga0495660_0125538 | |||
| 1121 | Ga0495660_0129614 | |||
| 1122 | Ga0495660_0180129 | |||
| 1123 | Ga0495581_0002085 | |||
| 1124 | Ga0495581_0012192 | |||
| 1125 | Ga0495581_0750296 | |||
| 1126 | Ga0495604_0003581 | |||
| 1127 | Ga0495604_0006389 | |||
| 1128 | Ga0495604_0013157 | |||
| 1129 | Ga0495604_0048178 | |||
| 1130 | Ga0495604_0059605 | |||
| 1131 | Ga0495604_0091956 | |||
| 1132 | Ga0495604_0492696 | |||
| 1133 | Ga0495674_0008505 | |||
| 1134 | Ga0495674_0015605 | |||
| 1135 | Ga0495674_0024605 | |||
| 1136 | Ga0495674_0061154 | |||
| 1137 | Ga0495674_0141992 | |||
| 1138 | Ga0495674_0170961 | |||
| 1139 | Ga0495674_0313450 | |||
| 1140 | Ga0495674_0427805 | |||
| 1141 | Ga0495672_0065919 | |||
| 1142 | Ga0495672_0167543 | |||
| 1143 | Ga0495672_0175985 | |||
| 1144 | Ga0495676_0001018 | |||
| 1145 | Ga0495676_0435191 | |||
| 1146 | Ga0495676_0598133 | |||
| 1147 | Ga0495680_0005679 | |||
| 1148 | Ga0495680_0011282 | |||
| 1149 | Ga0495680_0018585 | |||
| 1150 | Ga0495680_0054262 | |||
| 1151 | Ga0495680_0234183 | |||
| 1152 | Ga0495680_0400162 | |||
| 1153 | Ga0495683_0000993 | |||
| 1154 | Ga0495683_0006479 | |||
| 1155 | Ga0495683_0007249 | |||
| 1156 | Ga0495683_0009669 | |||
| 1157 | Ga0495683_0019559 | |||
| 1158 | Ga0495683_0080823 | |||
| 1159 | Ga0495683_0198550 | |||
| 1160 | Ga0495687_005606 | |||
| 1161 | Ga0495687_072025 | |||
| 1162 | Ga0495687_107493 | |||
| 1163 | Ga0495675_0000909 | |||
| 1164 | Ga0495675_0007250 | |||
| 1165 | Ga0495675_0022731 | |||
| 1166 | Ga0495675_0166254 | |||
| 1167 | Ga0495675_0336964 | |||
| 1168 | Ga0495679_000065 | |||
| 1169 | Ga0495679_001439 | |||
| 1170 | Ga0495679_003664 | |||
| 1171 | Ga0495679_157730 | |||
| 1172 | Ga0495673_0036653 | |||
| 1173 | Ga0495681_0055629 | |||
| 1174 | Ga0495681_0215444 | |||
| 1175 | Ga0495684_0005872 | |||
| 1176 | Ga0495684_0039217 | |||
| 1177 | Ga0495684_0135921 | |||
| 1178 | Ga0495686_0013432 | |||
| 1179 | Ga0495686_0048027 | |||
| 1180 | Ga0495593_0005302 | |||
| 1181 | Ga0495593_0019568 | |||
| 1182 | Ga0495593_0037455 | |||
| 1183 | Ga0495593_0038541 | |||
| 1184 | Ga0495593_0080351 | |||
| 1185 | Ga0495593_0113352 | |||
| 1186 | Ga0495602_0003204 | |||
| 1187 | Ga0495602_0011731 | |||
| 1188 | Ga0495602_0012129 | |||
| 1189 | Ga0495602_0031369 | |||
| 1190 | Ga0495602_0076227 | |||
| 1191 | Ga0495602_0160199 | |||
| 1192 | Ga0495614_0002052 | |||
| 1193 | Ga0495614_0003001 | |||
| 1194 | Ga0495614_0037939 | |||
| 1195 | Ga0495626_0022934 | |||
| 1196 | Ga0495626_0106563 | |||
| 1197 | Ga0496100_0001524 | |||
| 1198 | Ga0496100_0443268 | |||
| 1199 | Ga0496101_0006725 | |||
| 1200 | Ga0496101_0012663 | |||
| 1201 | Ga0496102_0024645 | |||
| 1202 | Ga0496102_0144151 | |||
| 1203 | Ga0496102_0428989 | |||
| 1204 | Ga0496103_0004707 | |||
| 1205 | Ga0496103_0056007 | |||
| 1206 | Ga0496104_0199928 | |||
| 1207 | Ga0496105_0069881 | |||
| 1208 | Ga0496106_0008851 | |||
| 1209 | Ga0496106_0296609 | |||
| 1210 | Ga0496107_0002718 | |||
| 1211 | Ga0496107_0452778 | |||
| 1212 | Ga0496108_0145629 | |||
| 1213 | Ga0496109_0109968 | |||
| 1214 | Ga0496110_0004347 | |||
| 1215 | Ga0496111_0019593 | |||
| 1216 | Ga0496112_1358726 | |||
| 1217 | Ga0496113_0073902 | |||
| 1218 | Ga0496114_0000585 | |||
| 1219 | Ga0496115_0150191 | |||
| 1220 | Ga0496115_1026258 | |||
| 1221 | Ga0496116_0001067 | |||
| 1222 | Ga0496116_0012744 | |||
| 1223 | Ga0496116_0040457 | |||
| 1224 | Ga0496116_0061855 | |||
| 1225 | Ga0496116_0201580 | |||
| 1226 | Ga0496117_0005272 | |||
| 1227 | Ga0496117_0009550 | |||
| 1228 | Ga0496117_0099990 | |||
| 1229 | Ga0496117_0216608 | |||
| 1230 | Ga0496118_0001212 | |||
| 1231 | Ga0496118_0012154 | |||
| 1232 | Ga0496118_0082446 | |||
| 1233 | Ga0496118_0124763 | |||
| 1234 | Ga0496118_0129228 | |||
| 1235 | Ga0496119_0011572 | |||
| 1236 | Ga0496119_0115385 | |||
| 1237 | Ga0496119_0319535 | |||
| 1238 | Ga0496120_0135289 | |||
| 1239 | Ga0496121_0001094 | |||
| 1240 | Ga0496121_0002638 | |||
| 1241 | Ga0496121_0021589 | |||
| 1242 | Ga0496121_0136331 | |||
| 1243 | Ga0496122_0063393 | |||
| 1244 | Ga0496123_0214510 | |||
| 1245 | Ga0496124_0010413 | |||
| 1246 | Ga0496125_0021581 | |||
| 1247 | Ga0496126_0000949 | |||
| 1248 | Ga0496126_0002993 | |||
| 1249 | Ga0496126_0428469 | |||
| 1250 | Ga0495678_008802 | |||
| 1251 | Ga0495682_0015837 | |||
| 1252 | Ga0501032_0790008 | |||
| 1253 | Ga0501042_0236542 | |||
| 1254 | Ga0501048_0425741 | |||
| 1255 | Ga0501067_0090396 | |||
| 1256 | Ga0501068_0003148 | |||
| 1257 | Ga0501068_0059770 | |||
| 1258 | Ga0501069_0569393 | |||
| 1259 | Ga0501071_0042026 | |||
| 1260 | Ga0501071_0082325 | |||
| 1261 | Ga0501072_0764948 | |||
| 1262 | Ga0501072_1029588 | |||
| 1263 | Ga0501073_0018441 | |||
| 1264 | Ga0501073_0501276 | |||
| 1265 | Ga0501075_0190961 | |||
| 1266 | Ga0501076_0087720 | |||
| 1267 | Ga0501076_0137405 | |||
| 1268 | Ga0501077_0110055 | |||
| 1269 | Ga0501238_005841 | |||
| 1270 | Ga0501079_0069980 | |||
| 1271 | Ga0501079_0351228 | |||
| 1272 | Ga0501080_0001700 | |||
| 1273 | Ga0501080_0643874 | |||
| 1274 | Ga0501081_0070240 | |||
| 1275 | Ga0501083_0237425 | |||
| 1276 | Ga0501241_025278 | |||
| 1277 | Ga0501045_0319548 | |||
| 1278 | Ga0501045_0703155 | |||
| 1279 | nmdc:mga0k408_773645_c1 | |||
| 1280 | nmdc:mga05p37_573969_c1 | |||
| 1281 | nmdc:mga0n895_5285_c1 | |||
| 1282 | nmdc:mga0rr50_18633_c1 | |||
| 1283 | nmdc:mga0a205_3924_c1 | |||
| 1284 | nmdc:mga0a205_823664_c1 | |||
| 1285 | Ga0500658_0550590 | |||
| 1286 | Ga0500616_0000421 | |||
| 1287 | Ga0501084_0145072 | |||
| 1288 | Ga0501084_0249015 | |||
| 1289 | Ga0587106_084687 | |||
| 1290 | Ga0501082_0006793 | |||
| 1291 | Ga0501082_0220886 | |||
| 1292 | Ga0501082_1022120 | |||
| 1293 | 2501076502 | |||
| 1294 | 2501079947 | |||
| 1295 | 2501412163 | |||
| 1296 | 2509130875 | |||
| 1297 | 2510248135 | |||
| 1298 | 2511087833 | |||
| 1299 | 2511101683 | |||
| 1300 | 2511107811 | |||
| 1301 | 2512349939 | |||
| 1302 | 2513559662 | |||
| 1303 | 2513962801 | |||
| 1304 | 2515684929 | |||
| 1305 | 2595447628 | |||
| 1306 | 2595450444 | |||
| 1307 | 2599443739 | |||
| 1308 | 2600814017 | |||
| 1309 | 2719643436 | |||
| 1310 | 2738823713 | |||
| 1311 | 2738836023 | |||
| 1312 | 2738877553 | |||
| 1313 | 2739189340 | |||
| 1314 | 2739224146 | |||
| 1315 | 2746090681 | |||
| 1316 | 2746092458 | |||
| 1317 | 2753570629 | |||
| 1318 | 2819623750 | |||
| 1319 | 2842326024 | |||
| 1320 | 2842351456 | |||
| 1321 | 2842455344 | |||
| 1322 | 2842922382 | |||
| 1323 | 2856289799 | |||
| 1324 | 2857363162 | |||
| 1325 | 2883090496 | |||
| 1326 | 2884342378 | |||
| 1327 | 2885267369 | |||
| 1328 | 2885277684 | |||
| 1329 | 2900582964 | |||
| 1330 | 2900639475 | |||
| 1331 | 2902683959 | |||
| 1332 | 2904465523 | |||
| 1333 | 2904490364 | |||
| 1334 | 2919533534 | |||
| 1335 | 2928062001 | |||
| 1336 | 2928112858 | |||
| 1337 | 2928139787 | |||
| 1338 | 2928507049 | |||
| 1339 | 2941474935 | |||
| 1340 | 2945941090 | |||
| 1341 | 2953996846 | |||
| 1342 | 2990708137 | |||
| 1343 | 642421953 | |||
| 1344 | 642617805 | |||
| 1345 | 8003956495 | |||
| 1346 | 8055307264 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3v1d-assembly1.cif.gz_A | crystal structure of de novo designed mid1-cobalt | 0.989 | 53 | 86 |
| 2c41-assembly1.cif.gz_C | x-ray structure of dps from thermosynechococcus elongatus | 0.9806 | 49 | 89 |
| 3v1f-assembly1.cif.gz_B | crystal structure of de novo designed mid1-zinc h35e mutant | 0.9623 | 53 | 86 |
| 1ng6-assembly1.cif.gz_A | structure of cytosolic protein of unknown function yqey from bacillus subtilis | 0.8923 | 1 | 148 |
| 3v1c-assembly1.cif.gz_A | crystal structure of de novo designed mid1-zinc | 0.8739 | 53 | 95 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2yxyA01 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Hypothetical protein YfhH domain | 0.9867 | 50 | 90 | 1.10.287.880 |
| af_I6X831_2_93_1.10.1510.10 | Mainly Alpha;Orthogonal Bundle;Hypothetical Protein Yqey; Chain: A; domain1;Uncharacterised protein YqeY/AIM41, N-terminal domain | 0.9826 | 3 | 90 | 1.10.1510.10 |
| 2c41C01 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.9806 | 49 | 89 | 1.20.1260.10 |
| af_C6Y4B8_28_116_1.10.1510.10 | Mainly Alpha;Orthogonal Bundle;Hypothetical Protein Yqey; Chain: A; domain1;Uncharacterised protein YqeY/AIM41, N-terminal domain | 0.959 | 3 | 90 | 1.10.1510.10 |
| 1ng6A01 | Mainly Alpha;Orthogonal Bundle;Hypothetical Protein Yqey; Chain: A; domain1;Uncharacterised protein YqeY/AIM41, N-terminal domain | 0.9556 | 1 | 90 | 1.10.1510.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A378ZBA9-F1-model_v4 | deleted | 1.001 | 1 | 146 |
|
| AF-A0A2H0T9C2-F1-model_v4 | Aspartyl-tRNA amidotransferase | 0.9965 | 1 | 146 |
GO:0016740
GO:0016884 |
| AF-A0A318JUC4-F1-model_v4 | Transamidase GatB domain protein | 0.9948 | 1 | 146 |
GO:0016884
|
| AF-A0A2M7IK86-F1-model_v4 | Aspartyl-tRNA amidotransferase | 0.9924 | 1 | 146 |
GO:0016740
GO:0016884 |
| AF-A0A1F1BK74-F1-model_v4 | deleted | 0.991 | 1 | 146 |
|