F474274
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 673 | 322 | 647 | 231 |
Family's Representative Sequence
| Representative Sequence | 3300001904|JGI24736J21556_1000668|JGI24736J21556_10006682 |
| Length | 269 |
| Sequence | MHAPNLTPFGMKGVDASASGGCPVAKEPSPLALRARSLRSALRAEGGSHEPGHLPLLVRHLGRQLYEPVWHAMQAFTDARGPDTPDELWLVEHDPVFTLGQAGKPEHVLAAGDIPVIHVDRGGQVTYHGPGQIVAYPLLDLRRLKIGVRELVRRIEQSIIDTLAEWNIVAARREGAPGVYAGEAKIAALGLRVRHGCTFHGLAFNVAMDLEPFHRINPCGYAGLQVAQMLDLGGPSRLADVEEVLVAELGRQFGLSPQDAEPALPRAAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2547132130 | Stenotrophomonas maltophilia RR-10 | Isolate | Unclassified |
| 3 | 2576861471 | Stenotrophomonas rhizophila DSM 14405 | Isolate | Rhizosphere |
| 4 | 2643221573 | Lysobacter sp. Root604 | Isolate | Unclassified |
| 5 | 2643221593 | Lysobacter sp. Root690 | Isolate | Unclassified |
| 6 | 2643221720 | Lysobacter sp. Root916 | Isolate | Unclassified |
| 7 | 2643221728 | Lysobacter sp. Root983 | Isolate | Unclassified |
| 8 | 2734482264 | Dyella sp. AD052 | Isolate | Unclassified |
| 9 | 2747842428 | Stenotrophomonas sp. WCS2014-113 | Isolate | Unclassified |
| 10 | 2765235840 | Stenotrophomonas maltophilia AA1 | Isolate | Unclassified |
| 11 | 2816332141 | Stenotrophomonas muris 1190 (v2) (version 2) | Isolate | Unclassified |
| 12 | 2818991457 | Xanthomonas translucens 569 | Isolate | Unclassified |
| 13 | 2842391507 | Stenotrophomonas maltophilia SEMIA 4027 | Isolate | Nodule |
| 14 | 2852684882 | Xanthomonas sp. JAI131 | Isolate | Rhizosphere |
| 15 | 2857442823 | Stenotrophomonas sp. R-74235 | Isolate | Unclassified |
| 16 | 2919130084 | Xanthomonas sp. 1678 | Isolate | Rhizosphere |
| 17 | 2919134579 | Stenotrophomonas geniculata 1733 | Isolate | Rhizosphere |
| 18 | 2929195423 | Xanthomonas sp. R-73098 Hybrid assembly | Isolate | Unclassified |
| 19 | 2939589442 | Stenotrophomonas rhizophila 716 | Isolate | Rhizosphere |
| 20 | 2939622612 | Stenotrophomonas sp. 2619 | Isolate | Rhizosphere |
| 21 | 2961064222 | Stenotrophomonas maltophilia EP13 | Isolate | Unclassified |
| 22 | 2974307012 | Stenotrophomonas sp. SORGH_AS_0282 | Isolate | Unclassified |
| 23 | 2977247770 | Stenotrophomonas rhizophila SORGH_AS 457 | Isolate | Unclassified |
| 24 | 2984514374 | Stenotrophomonas sp. SORGH_AS282 | Isolate | Aerial Root |
| 25 | 2987605356 | Stenotrophomonas sp. ATCM1_4 | Isolate | Unclassified |
| 26 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 27 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 28 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 29 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 30 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 31 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 32 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 33 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 34 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 35 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 36 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 37 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 38 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 39 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 40 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 41 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 42 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 43 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 44 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 45 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 46 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 47 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 48 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 49 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 50 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 57 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 69 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 70 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 71 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 72 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 74 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 78 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 80 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 81 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 82 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 83 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 84 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 85 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 86 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 87 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 88 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 89 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 90 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 92 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 93 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 116 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 119 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 120 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 122 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 123 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 124 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 129 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 130 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 133 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 134 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 136 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 138 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 141 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 144 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 199 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 200 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 201 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 202 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 203 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 204 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 205 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 206 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 207 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 208 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 209 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 210 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 211 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 212 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 213 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 214 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 215 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 216 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 217 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 218 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 219 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 220 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 221 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 222 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 223 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 224 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 225 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 226 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 227 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 228 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 229 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 230 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 231 | 3300044536 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E | Metagenome | Unclassified |
| 232 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 233 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 234 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 235 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 236 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 237 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 238 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 239 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 240 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 241 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 242 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 243 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 267 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 268 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 269 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 270 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 271 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 272 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 273 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 274 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 275 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 276 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 277 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 278 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 279 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 280 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 281 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 282 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 283 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 308 | 3300049772 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control | Metagenome | Rhizosphere |
| 309 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 313 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 314 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 315 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 316 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 317 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 318 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 321 | 8003014200 | Lysobacter changpingensis Cm-3-T8 | Isolate | Rhizosphere |
| 322 | 8021648035 | Xanthomonas sp. LMG 12461 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.39 |
| Metatranscriptomes | 0.74 |
| Isolates | 3.86 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.15 |
| Bulb | 0 |
| Endosphere | 9.51 |
| Nodule | 0.15 |
| Rhizoplane | 2.67 |
| Rhizosphere | 79.94 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.58 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1900888 | 2162886007 | Bacteria | 7548 |
| 2 | JGI24736J21556_1000668 | 3300001904 | Bacteria | 6283 |
| 3 | JGI24741J21665_1000513 | 3300001915 | Bacteria | 11829 |
| 4 | JGI24740J21852_10000733 | 3300001979 | Bacteria | 14284 |
| 5 | JGI24740J21852_10001041 | 3300001979 | Bacteria | 12448 |
| 6 | JGI25157J39369_1005706 | 3300002741 | Bacteria | 1985 |
| 7 | JGI25151J46595_10000102 | 3300003187 | Bacteria | 114881 |
| 8 | rootH1_10132375 | 3300003323 | Bacteria | 1213 |
| 9 | Ga0055539_1001541 | 3300003752 | Bacteria | 4192 |
| 10 | Ga0055533_1000809 | 3300003756 | Bacteria | 9692 |
| 11 | Ga0055525_1000138 | 3300003759 | Bacteria | 104087 |
| 12 | Ga0055527_1000281 | 3300003760 | Bacteria | 30006 |
| 13 | Ga0055527_1000330 | 3300003760 | Bacteria | 25414 |
| 14 | Ga0055535_1000843 | 3300003761 | Bacteria | 21891 |
| 15 | Ga0055542_1000835 | 3300003762 | Bacteria | 21895 |
| 16 | Ga0055542_1001160 | 3300003762 | Bacteria | 15324 |
| 17 | Ga0055529_1000717 | 3300003763 | Bacteria | 21895 |
| 18 | Ga0055529_1000943 | 3300003763 | Bacteria | 15407 |
| 19 | Ga0055526_1006479 | 3300003771 | Bacteria | 6343 |
| 20 | Ga0055537_1000059 | 3300003773 | Bacteria | 79628 |
| 21 | Ga0055537_1001365 | 3300003773 | Bacteria | 9847 |
| 22 | Ga0055524_1000019 | 3300003775 | Bacteria | 233561 |
| 23 | Ga0055536_1018818 | 3300003781 | Bacteria | 2197 |
| 24 | Ga0055534_1000012 | 3300003784 | Bacteria | 153530 |
| 25 | Ga0055534_1000112 | 3300003784 | Bacteria | 59920 |
| 26 | Ga0055528_1000007 | 3300003790 | Bacteria | 233327 |
| 27 | Ga0055528_1001337 | 3300003790 | Bacteria | 15339 |
| 28 | Ga0055530_10001674 | 3300003791 | Bacteria | 15731 |
| 29 | Ga0055530_10002094 | 3300003791 | Bacteria | 13328 |
| 30 | Ga0055531_10013881 | 3300003794 | Bacteria | 3678 |
| 31 | Ga0055531_10024818 | 3300003794 | Bacteria | 2197 |
| 32 | Ga0055531_10025507 | 3300003794 | Bacteria | 2143 |
| 33 | Ga0058861_11997967 | 3300004800 | Bacteria | 3815 |
| 34 | Ga0065714_10073865 | 3300005288 | Bacteria | 3115 |
| 35 | Ga0065715_10008446 | 3300005293 | Bacteria | 3910 |
| 36 | Ga0065715_10210857 | 3300005293 | Bacteria | 1310 |
| 37 | Ga0070658_10025096 | 3300005327 | Bacteria | 4778 |
| 38 | Ga0070683_100148995 | 3300005329 | Bacteria | 2218 |
| 39 | Ga0070670_100001962 | 3300005331 | Bacteria | 16837 |
| 40 | Ga0070670_100510566 | 3300005331 | Bacteria | 1070 |
| 41 | Ga0070666_10267594 | 3300005335 | Bacteria | 1213 |
| 42 | Ga0070680_100004327 | 3300005336 | Bacteria | 10676 |
| 43 | Ga0070682_100013741 | 3300005337 | Bacteria | 4667 |
| 44 | Ga0068868_100319978 | 3300005338 | Bacteria | 1321 |
| 45 | Ga0070691_10146967 | 3300005341 | Bacteria | 1206 |
| 46 | Ga0070691_10230441 | 3300005341 | Bacteria | 985 |
| 47 | Ga0070661_100009383 | 3300005344 | Bacteria | 6771 |
| 48 | Ga0070661_100063255 | 3300005344 | Bacteria | 2717 |
| 49 | Ga0070661_100122479 | 3300005344 | Bacteria | 1948 |
| 50 | Ga0070692_10014304 | 3300005345 | Bacteria | 3723 |
| 51 | Ga0070692_10150891 | 3300005345 | Bacteria | 1323 |
| 52 | Ga0070669_100064482 | 3300005353 | Bacteria | 2698 |
| 53 | Ga0070675_100043947 | 3300005354 | Bacteria | 3654 |
| 54 | Ga0070671_100045193 | 3300005355 | Bacteria | 3661 |
| 55 | Ga0070671_100069039 | 3300005355 | Bacteria | 2947 |
| 56 | Ga0070673_100408221 | 3300005364 | Bacteria | 1216 |
| 57 | Ga0070659_100187046 | 3300005366 | Bacteria | 1701 |
| 58 | Ga0070667_100005400 | 3300005367 | Bacteria | 10674 |
| 59 | Ga0070667_100041398 | 3300005367 | Bacteria | 3865 |
| 60 | Ga0070667_100050689 | 3300005367 | Bacteria | 3499 |
| 61 | Ga0070667_100121267 | 3300005367 | Bacteria | 2274 |
| 62 | Ga0070667_100187140 | 3300005367 | Bacteria | 1833 |
| 63 | Ga0070663_100000042 | 3300005455 | Bacteria | 57899 |
| 64 | Ga0070663_100060983 | 3300005455 | Bacteria | 2715 |
| 65 | Ga0070663_100136117 | 3300005455 | Bacteria | 1870 |
| 66 | Ga0070663_100216615 | 3300005455 | Bacteria | 1501 |
| 67 | Ga0070662_100014495 | 3300005457 | Bacteria | 5270 |
| 68 | Ga0070662_100041992 | 3300005457 | Bacteria | 3265 |
| 69 | Ga0070681_10001872 | 3300005458 | Bacteria | 18988 |
| 70 | Ga0070681_10009167 | 3300005458 | Bacteria | 9724 |
| 71 | Ga0070681_10177415 | 3300005458 | Bacteria | 2052 |
| 72 | Ga0070681_10191941 | 3300005458 | Bacteria | 1962 |
| 73 | Ga0070681_10300998 | 3300005458 | Bacteria | 1513 |
| 74 | Ga0070681_10754860 | 3300005458 | Bacteria | 889 |
| 75 | Ga0070679_100004396 | 3300005530 | Bacteria | 13033 |
| 76 | Ga0070679_100164520 | 3300005530 | Bacteria | 2192 |
| 77 | Ga0070679_100819986 | 3300005530 | Bacteria | 873 |
| 78 | Ga0070684_100024537 | 3300005535 | Bacteria | 5060 |
| 79 | Ga0070684_100048363 | 3300005535 | Bacteria | 3690 |
| 80 | Ga0070684_100152602 | 3300005535 | Bacteria | 2093 |
| 81 | Ga0070684_100585753 | 3300005535 | Bacteria | 1037 |
| 82 | Ga0068853_100004195 | 3300005539 | Bacteria | 11116 |
| 83 | Ga0068853_100007213 | 3300005539 | Bacteria | 8902 |
| 84 | Ga0068853_100011114 | 3300005539 | Bacteria | 7303 |
| 85 | Ga0068853_100020141 | 3300005539 | Bacteria | 5545 |
| 86 | Ga0068853_100028892 | 3300005539 | Bacteria | 4668 |
| 87 | Ga0068853_100033305 | 3300005539 | Bacteria | 4371 |
| 88 | Ga0068853_100047267 | 3300005539 | Bacteria | 3692 |
| 89 | Ga0070672_100003657 | 3300005543 | Bacteria | 9989 |
| 90 | Ga0070686_100167171 | 3300005544 | Bacteria | 1553 |
| 91 | Ga0070696_100002079 | 3300005546 | Bacteria | 13147 |
| 92 | Ga0070693_100005032 | 3300005547 | Bacteria | 6313 |
| 93 | Ga0070693_100012299 | 3300005547 | Bacteria | 4328 |
| 94 | Ga0070693_100025853 | 3300005547 | Bacteria | 3162 |
| 95 | Ga0070665_100000028 | 3300005548 | Bacteria | 351357 |
| 96 | Ga0070665_100008261 | 3300005548 | Bacteria | 10529 |
| 97 | Ga0070665_100027661 | 3300005548 | Bacteria | 5710 |
| 98 | Ga0070665_100050597 | 3300005548 | Bacteria | 4169 |
| 99 | Ga0070665_100084459 | 3300005548 | Bacteria | 3180 |
| 100 | Ga0070665_100168154 | 3300005548 | Bacteria | 2194 |
| 101 | Ga0070665_100219067 | 3300005548 | Bacteria | 1904 |
| 102 | Ga0070665_100412820 | 3300005548 | Bacteria | 1358 |
| 103 | Ga0070665_100832480 | 3300005548 | Bacteria | 936 |
| 104 | Ga0068855_100005951 | 3300005563 | Bacteria | 14870 |
| 105 | Ga0068855_100105650 | 3300005563 | Bacteria | 3237 |
| 106 | Ga0068855_100171818 | 3300005563 | Bacteria | 2454 |
| 107 | Ga0068855_100384484 | 3300005563 | Bacteria | 1540 |
| 108 | Ga0068855_100400853 | 3300005563 | Bacteria | 1503 |
| 109 | Ga0068855_100640412 | 3300005563 | Bacteria | 1143 |
| 110 | Ga0070664_100023351 | 3300005564 | Bacteria | 5107 |
| 111 | Ga0070664_100203877 | 3300005564 | Bacteria | 1766 |
| 112 | Ga0068857_100053558 | 3300005577 | Bacteria | 3579 |
| 113 | Ga0068857_100182944 | 3300005577 | Bacteria | 1907 |
| 114 | Ga0068857_100358917 | 3300005577 | Bacteria | 1351 |
| 115 | Ga0068854_100004688 | 3300005578 | Bacteria | 8616 |
| 116 | Ga0068854_100024611 | 3300005578 | Bacteria | 4125 |
| 117 | Ga0068854_100053357 | 3300005578 | Bacteria | 2903 |
| 118 | Ga0068854_100070907 | 3300005578 | Bacteria | 2547 |
| 119 | Ga0068854_100080020 | 3300005578 | Bacteria | 2411 |
| 120 | Ga0068854_100542130 | 3300005578 | Bacteria | 985 |
| 121 | Ga0068854_100546565 | 3300005578 | Bacteria | 982 |
| 122 | Ga0068856_100012643 | 3300005614 | Bacteria | 8173 |
| 123 | Ga0068856_100161736 | 3300005614 | Bacteria | 2249 |
| 124 | Ga0068856_100406692 | 3300005614 | Bacteria | 1381 |
| 125 | Ga0068856_100452062 | 3300005614 | Bacteria | 1305 |
| 126 | Ga0068852_100005973 | 3300005616 | Bacteria | 8769 |
| 127 | Ga0068852_100068716 | 3300005616 | Bacteria | 3102 |
| 128 | Ga0068852_100082660 | 3300005616 | Bacteria | 2854 |
| 129 | Ga0068852_100212373 | 3300005616 | Bacteria | 1836 |
| 130 | Ga0068852_100345615 | 3300005616 | Bacteria | 1451 |
| 131 | Ga0068852_100348820 | 3300005616 | Bacteria | 1445 |
| 132 | Ga0068859_100000280 | 3300005617 | Bacteria | 50848 |
| 133 | Ga0068851_10011937 | 3300005834 | Bacteria | 4084 |
| 134 | Ga0068851_10027186 | 3300005834 | Bacteria | 2818 |
| 135 | Ga0068851_10035589 | 3300005834 | Bacteria | 2489 |
| 136 | Ga0068870_10057938 | 3300005840 | Bacteria | 2073 |
| 137 | Ga0068863_100018882 | 3300005841 | Bacteria | 6597 |
| 138 | Ga0068863_100066084 | 3300005841 | Bacteria | 3421 |
| 139 | Ga0068863_100077761 | 3300005841 | Bacteria | 3140 |
| 140 | Ga0068863_100240960 | 3300005841 | Bacteria | 1745 |
| 141 | Ga0068860_100124956 | 3300005843 | Bacteria | 2466 |
| 142 | Ga0068862_100000215 | 3300005844 | Bacteria | 64251 |
| 143 | Ga0068862_100111847 | 3300005844 | Bacteria | 2398 |
| 144 | Ga0081539_10008186 | 3300005985 | Bacteria | 9212 |
| 145 | Ga0097621_100206800 | 3300006237 | Bacteria | 1706 |
| 146 | Ga0068871_100039983 | 3300006358 | Bacteria | 3755 |
| 147 | Ga0068871_100199111 | 3300006358 | Bacteria | 1728 |
| 148 | Ga0068871_100215267 | 3300006358 | Bacteria | 1663 |
| 149 | Ga0068865_100017143 | 3300006881 | Bacteria | 4652 |
| 150 | Ga0068865_100053746 | 3300006881 | Bacteria | 2795 |
| 151 | Ga0097620_100000280 | 3300006931 | Bacteria | 50848 |
| 152 | Ga0105251_10000205 | 3300009011 | Bacteria | 59437 |
| 153 | Ga0105240_10087720 | 3300009093 | Bacteria | 3809 |
| 154 | Ga0105240_10103888 | 3300009093 | Bacteria | 3451 |
| 155 | Ga0105240_10152371 | 3300009093 | Bacteria | 2752 |
| 156 | Ga0105245_10723360 | 3300009098 | Bacteria | 1030 |
| 157 | Ga0105247_10124470 | 3300009101 | Bacteria | 1674 |
| 158 | Ga0105241_10017637 | 3300009174 | Bacteria | 5249 |
| 159 | Ga0105241_10055846 | 3300009174 | Bacteria | 3026 |
| 160 | Ga0105241_10103439 | 3300009174 | Bacteria | 2268 |
| 161 | Ga0105242_10675965 | 3300009176 | Bacteria | 1007 |
| 162 | Ga0105248_10000120 | 3300009177 | Bacteria | 89960 |
| 163 | Ga0105248_10309656 | 3300009177 | Bacteria | 1778 |
| 164 | Ga0105237_10010356 | 3300009545 | Bacteria | 9929 |
| 165 | Ga0105237_10618370 | 3300009545 | Bacteria | 1090 |
| 166 | Ga0105238_10006626 | 3300009551 | Bacteria | 11543 |
| 167 | Ga0105238_10011965 | 3300009551 | Bacteria | 8742 |
| 168 | Ga0105238_10110821 | 3300009551 | Bacteria | 2725 |
| 169 | Ga0105238_10192207 | 3300009551 | Bacteria | 2017 |
| 170 | Ga0105249_10000898 | 3300009553 | Bacteria | 26273 |
| 171 | Ga0105249_11264596 | 3300009553 | Bacteria | 809 |
| 172 | Ga0105239_10005391 | 3300010375 | Bacteria | 15027 |
| 173 | Ga0105239_10033812 | 3300010375 | Bacteria | 5613 |
| 174 | Ga0105239_10107680 | 3300010375 | Bacteria | 3088 |
| 175 | Ga0157373_10012798 | 3300013100 | Bacteria | 6163 |
| 176 | Ga0157373_10042694 | 3300013100 | Bacteria | 3240 |
| 177 | Ga0157373_10055024 | 3300013100 | Bacteria | 2827 |
| 178 | Ga0157373_10084294 | 3300013100 | Bacteria | 2240 |
| 179 | Ga0157371_10057507 | 3300013102 | Bacteria | 2758 |
| 180 | Ga0157371_10190065 | 3300013102 | Bacteria | 1470 |
| 181 | Ga0157370_10033604 | 3300013104 | Bacteria | 5000 |
| 182 | Ga0157370_10144952 | 3300013104 | Bacteria | 2212 |
| 183 | Ga0157370_10663632 | 3300013104 | Bacteria | 953 |
| 184 | Ga0157369_10002250 | 3300013105 | Bacteria | 23203 |
| 185 | Ga0157369_10024352 | 3300013105 | Bacteria | 6735 |
| 186 | Ga0157369_10383664 | 3300013105 | Bacteria | 1458 |
| 187 | Ga0157374_10158927 | 3300013296 | Bacteria | 2201 |
| 188 | Ga0157374_10625115 | 3300013296 | Bacteria | 1088 |
| 189 | Ga0157378_10000536 | 3300013297 | Bacteria | 36043 |
| 190 | Ga0163162_10028377 | 3300013306 | Bacteria | 5537 |
| 191 | Ga0163162_11402870 | 3300013306 | Bacteria | 795 |
| 192 | Ga0157372_10000344 | 3300013307 | Bacteria | 51217 |
| 193 | Ga0157372_10013581 | 3300013307 | Bacteria | 8705 |
| 194 | Ga0157372_10036173 | 3300013307 | Bacteria | 5442 |
| 195 | Ga0157372_10037458 | 3300013307 | Bacteria | 5350 |
| 196 | Ga0157372_10051825 | 3300013307 | Bacteria | 4568 |
| 197 | Ga0157372_10057810 | 3300013307 | Bacteria | 4336 |
| 198 | Ga0157372_10586568 | 3300013307 | Bacteria | 1299 |
| 199 | Ga0157375_10584129 | 3300013308 | Bacteria | 1277 |
| 200 | Ga0163163_10000029 | 3300014325 | Bacteria | 174973 |
| 201 | Ga0163163_10672312 | 3300014325 | Bacteria | 1099 |
| 202 | Ga0182008_10020566 | 3300014497 | Bacteria | 3397 |
| 203 | Ga0182008_10029210 | 3300014497 | Bacteria | 2787 |
| 204 | Ga0157379_10001942 | 3300014968 | Bacteria | 17106 |
| 205 | Ga0157376_10002494 | 3300014969 | Bacteria | 12460 |
| 206 | Ga0157376_10005280 | 3300014969 | Bacteria | 9025 |
| 207 | Ga0182006_1053246 | 3300015261 | Bacteria | 1552 |
| 208 | Ga0182005_1002582 | 3300015265 | Bacteria | 6416 |
| 209 | Ga0163161_10073490 | 3300017792 | Bacteria | 2506 |
| 210 | Ga0206356_10496513 | 3300020070 | Bacteria | 3064 |
| 211 | Ga0206356_11576430 | 3300020070 | Bacteria | 2668 |
| 212 | Ga0206353_10732351 | 3300020082 | Bacteria | 1349 |
| 213 | Ga0224712_10096835 | 3300022467 | Bacteria | 1245 |
| 214 | Ga0209674_100149 | 3300025226 | Bacteria | 97879 |
| 215 | Ga0209672_100004 | 3300025228 | Bacteria | 1467504 |
| 216 | Ga0209672_100008 | 3300025228 | Bacteria | 946876 |
| 217 | Ga0209563_100036 | 3300025230 | Bacteria | 448275 |
| 218 | Ga0209258_100003 | 3300025242 | Bacteria | 1467504 |
| 219 | Ga0209258_100004 | 3300025242 | Bacteria | 1376422 |
| 220 | Ga0209258_100008 | 3300025242 | Bacteria | 1009355 |
| 221 | Ga0207425_1010986 | 3300025245 | Bacteria | 2182 |
| 222 | Ga0209026_1000045 | 3300025250 | Bacteria | 263431 |
| 223 | Ga0209677_100974 | 3300025253 | Bacteria | 13904 |
| 224 | Ga0209148_1000025 | 3300025254 | Bacteria | 663262 |
| 225 | Ga0209148_1000053 | 3300025254 | Bacteria | 373506 |
| 226 | Ga0209759_1000850 | 3300025256 | Bacteria | 23820 |
| 227 | Ga0209565_1000001 | 3300025263 | Bacteria | 2950419 |
| 228 | Ga0209565_1000060 | 3300025263 | Bacteria | 188543 |
| 229 | Ga0209455_1000004 | 3300025272 | Bacteria | 1467504 |
| 230 | Ga0209455_1000007 | 3300025272 | Bacteria | 1157983 |
| 231 | Ga0209673_1000001 | 3300025273 | Bacteria | 3176258 |
| 232 | Ga0209673_1000047 | 3300025273 | Bacteria | 289276 |
| 233 | Ga0209130_1014021 | 3300025284 | Bacteria | 2029 |
| 234 | Ga0209675_1000001 | 3300025291 | Bacteria | 2950293 |
| 235 | Ga0209675_1000007 | 3300025291 | Bacteria | 683430 |
| 236 | Ga0209676_1000052 | 3300025292 | Bacteria | 371539 |
| 237 | Ga0209025_1000006 | 3300025294 | Bacteria | 1153444 |
| 238 | Ga0209564_1000001 | 3300025295 | Bacteria | 3176258 |
| 239 | Ga0209564_1000252 | 3300025295 | Bacteria | 114416 |
| 240 | Ga0209758_1006577 | 3300025297 | Bacteria | 8257 |
| 241 | Ga0209050_1000146 | 3300025298 | Bacteria | 166930 |
| 242 | Ga0209256_1000006 | 3300025299 | Bacteria | 1250310 |
| 243 | Ga0209256_1005932 | 3300025299 | Bacteria | 6743 |
| 244 | Ga0209051_1005721 | 3300025303 | Bacteria | 7179 |
| 245 | Ga0209257_1010878 | 3300025304 | Bacteria | 4500 |
| 246 | Ga0207656_10003660 | 3300025321 | Bacteria | 5313 |
| 247 | Ga0207656_10021120 | 3300025321 | Bacteria | 2597 |
| 248 | Ga0207713_1000196 | 3300025735 | Bacteria | 84000 |
| 249 | Ga0207682_10063268 | 3300025893 | Bacteria | 1553 |
| 250 | Ga0207710_10054171 | 3300025900 | Bacteria | 1806 |
| 251 | Ga0207688_10169944 | 3300025901 | Bacteria | 1296 |
| 252 | Ga0207680_10139401 | 3300025903 | Bacteria | 1606 |
| 253 | Ga0207680_10180954 | 3300025903 | Bacteria | 1425 |
| 254 | Ga0207680_10323227 | 3300025903 | Bacteria | 1079 |
| 255 | Ga0207647_10000826 | 3300025904 | Bacteria | 24065 |
| 256 | Ga0207647_10001336 | 3300025904 | Bacteria | 18958 |
| 257 | Ga0207647_10003112 | 3300025904 | Bacteria | 12460 |
| 258 | Ga0207647_10138743 | 3300025904 | Bacteria | 1425 |
| 259 | Ga0207645_10026306 | 3300025907 | Bacteria | 3761 |
| 260 | Ga0207645_10106425 | 3300025907 | Bacteria | 1813 |
| 261 | Ga0207643_10041259 | 3300025908 | Bacteria | 2600 |
| 262 | Ga0207705_10000097 | 3300025909 | Bacteria | 105579 |
| 263 | Ga0207705_10000341 | 3300025909 | Bacteria | 42108 |
| 264 | Ga0207705_10000630 | 3300025909 | Bacteria | 29454 |
| 265 | Ga0207705_10002108 | 3300025909 | Bacteria | 15463 |
| 266 | Ga0207654_10000458 | 3300025911 | Bacteria | 23295 |
| 267 | Ga0207654_10031408 | 3300025911 | Bacteria | 2924 |
| 268 | Ga0207654_10063425 | 3300025911 | Bacteria | 2169 |
| 269 | Ga0207707_10000065 | 3300025912 | Bacteria | 106546 |
| 270 | Ga0207707_10000084 | 3300025912 | Bacteria | 95228 |
| 271 | Ga0207707_10000578 | 3300025912 | Bacteria | 37213 |
| 272 | Ga0207707_10001112 | 3300025912 | Bacteria | 25518 |
| 273 | Ga0207707_10002407 | 3300025912 | Bacteria | 16839 |
| 274 | Ga0207707_10054364 | 3300025912 | Bacteria | 3485 |
| 275 | Ga0207695_10000772 | 3300025913 | Bacteria | 60706 |
| 276 | Ga0207695_10002496 | 3300025913 | Bacteria | 27107 |
| 277 | Ga0207695_10006652 | 3300025913 | Bacteria | 14917 |
| 278 | Ga0207695_10015003 | 3300025913 | Bacteria | 9141 |
| 279 | Ga0207695_10595887 | 3300025913 | Bacteria | 986 |
| 280 | Ga0207671_10007551 | 3300025914 | Bacteria | 9414 |
| 281 | Ga0207671_10088892 | 3300025914 | Bacteria | 2324 |
| 282 | Ga0207671_10143283 | 3300025914 | Bacteria | 1842 |
| 283 | Ga0207671_10249251 | 3300025914 | Bacteria | 1396 |
| 284 | Ga0207660_10005551 | 3300025917 | Bacteria | 8192 |
| 285 | Ga0207660_10006903 | 3300025917 | Bacteria | 7349 |
| 286 | Ga0207660_10010377 | 3300025917 | Bacteria | 6043 |
| 287 | Ga0207660_10011546 | 3300025917 | Bacteria | 5755 |
| 288 | Ga0207660_10184679 | 3300025917 | Bacteria | 1621 |
| 289 | Ga0207657_10002465 | 3300025919 | Bacteria | 20016 |
| 290 | Ga0207657_10006390 | 3300025919 | Bacteria | 12239 |
| 291 | Ga0207657_10007147 | 3300025919 | Bacteria | 11466 |
| 292 | Ga0207657_10256498 | 3300025919 | Bacteria | 1392 |
| 293 | Ga0207657_10483215 | 3300025919 | Bacteria | 971 |
| 294 | Ga0207649_10004292 | 3300025920 | Bacteria | 7757 |
| 295 | Ga0207649_10006309 | 3300025920 | Bacteria | 6443 |
| 296 | Ga0207649_10385596 | 3300025920 | Bacteria | 1045 |
| 297 | Ga0207649_10409040 | 3300025920 | Bacteria | 1017 |
| 298 | Ga0207649_10705864 | 3300025920 | Bacteria | 782 |
| 299 | Ga0207652_10000014 | 3300025921 | Bacteria | 196569 |
| 300 | Ga0207652_10000076 | 3300025921 | Bacteria | 107686 |
| 301 | Ga0207652_10002969 | 3300025921 | Bacteria | 14173 |
| 302 | Ga0207652_10069249 | 3300025921 | Bacteria | 3063 |
| 303 | Ga0207652_10378129 | 3300025921 | Bacteria | 1278 |
| 304 | Ga0207652_10490868 | 3300025921 | Bacteria | 1106 |
| 305 | Ga0207681_10056764 | 3300025923 | Bacteria | 2672 |
| 306 | Ga0207694_10006803 | 3300025924 | Bacteria | 8679 |
| 307 | Ga0207694_10012929 | 3300025924 | Bacteria | 6287 |
| 308 | Ga0207650_10001926 | 3300025925 | Bacteria | 14613 |
| 309 | Ga0207650_10328626 | 3300025925 | Bacteria | 1254 |
| 310 | Ga0207687_10484561 | 3300025927 | Bacteria | 1030 |
| 311 | Ga0207700_10513190 | 3300025928 | Bacteria | 1061 |
| 312 | Ga0207644_10017204 | 3300025931 | Bacteria | 4877 |
| 313 | Ga0207644_10257288 | 3300025931 | Bacteria | 1395 |
| 314 | Ga0207690_10000122 | 3300025932 | Bacteria | 64448 |
| 315 | Ga0207690_10003069 | 3300025932 | Bacteria | 10060 |
| 316 | Ga0207690_10819681 | 3300025932 | Bacteria | 770 |
| 317 | Ga0207706_10003801 | 3300025933 | Bacteria | 14393 |
| 318 | Ga0207706_10316978 | 3300025933 | Bacteria | 1357 |
| 319 | Ga0207706_10795698 | 3300025933 | Bacteria | 803 |
| 320 | Ga0207691_10009099 | 3300025940 | Bacteria | 9532 |
| 321 | Ga0207691_10019067 | 3300025940 | Bacteria | 6495 |
| 322 | Ga0207711_10010606 | 3300025941 | Bacteria | 7662 |
| 323 | Ga0207689_10034224 | 3300025942 | Bacteria | 4219 |
| 324 | Ga0207661_10007040 | 3300025944 | Bacteria | 7981 |
| 325 | Ga0207661_10071965 | 3300025944 | Bacteria | 2828 |
| 326 | Ga0207661_10113455 | 3300025944 | Bacteria | 2296 |
| 327 | Ga0207661_10266777 | 3300025944 | Bacteria | 1527 |
| 328 | Ga0207661_10289978 | 3300025944 | Bacteria | 1464 |
| 329 | Ga0207679_10026576 | 3300025945 | Bacteria | 3993 |
| 330 | Ga0207667_10000623 | 3300025949 | Bacteria | 45814 |
| 331 | Ga0207667_10000683 | 3300025949 | Bacteria | 43994 |
| 332 | Ga0207667_10008297 | 3300025949 | Bacteria | 12358 |
| 333 | Ga0207667_10019912 | 3300025949 | Bacteria | 7477 |
| 334 | Ga0207667_10038594 | 3300025949 | Bacteria | 5098 |
| 335 | Ga0207667_10049542 | 3300025949 | Bacteria | 4436 |
| 336 | Ga0207651_10070326 | 3300025960 | Bacteria | 2476 |
| 337 | Ga0207712_10000305 | 3300025961 | Bacteria | 45213 |
| 338 | Ga0207712_10024220 | 3300025961 | Bacteria | 4017 |
| 339 | Ga0207668_10017413 | 3300025972 | Bacteria | 4502 |
| 340 | Ga0207668_10290936 | 3300025972 | Bacteria | 1344 |
| 341 | Ga0207640_10000362 | 3300025981 | Bacteria | 29479 |
| 342 | Ga0207640_10002592 | 3300025981 | Bacteria | 9682 |
| 343 | Ga0207640_10003436 | 3300025981 | Bacteria | 8533 |
| 344 | Ga0207640_10022848 | 3300025981 | Bacteria | 3750 |
| 345 | Ga0207640_10053751 | 3300025981 | Bacteria | 2630 |
| 346 | Ga0207640_10062553 | 3300025981 | Bacteria | 2470 |
| 347 | Ga0207640_10135130 | 3300025981 | Bacteria | 1789 |
| 348 | Ga0207658_10000033 | 3300025986 | Bacteria | 158540 |
| 349 | Ga0207658_10009244 | 3300025986 | Bacteria | 6684 |
| 350 | Ga0207658_10513082 | 3300025986 | Bacteria | 1069 |
| 351 | Ga0207658_10805041 | 3300025986 | Bacteria | 853 |
| 352 | Ga0207677_10008057 | 3300026023 | Bacteria | 5868 |
| 353 | Ga0207703_10202544 | 3300026035 | Bacteria | 1764 |
| 354 | Ga0207639_10000437 | 3300026041 | Bacteria | 28831 |
| 355 | Ga0207639_10000514 | 3300026041 | Bacteria | 26656 |
| 356 | Ga0207639_10001917 | 3300026041 | Bacteria | 13965 |
| 357 | Ga0207639_10004441 | 3300026041 | Bacteria | 9464 |
| 358 | Ga0207639_10007675 | 3300026041 | Bacteria | 7363 |
| 359 | Ga0207639_10019356 | 3300026041 | Bacteria | 4854 |
| 360 | Ga0207678_10001678 | 3300026067 | Bacteria | 20323 |
| 361 | Ga0207678_10002250 | 3300026067 | Bacteria | 17473 |
| 362 | Ga0207678_10002720 | 3300026067 | Bacteria | 16033 |
| 363 | Ga0207678_10066322 | 3300026067 | Bacteria | 3100 |
| 364 | Ga0207678_10094476 | 3300026067 | Bacteria | 2555 |
| 365 | Ga0207678_10142849 | 3300026067 | Bacteria | 2043 |
| 366 | Ga0207678_10247627 | 3300026067 | Bacteria | 1526 |
| 367 | Ga0207702_10012063 | 3300026078 | Bacteria | 7187 |
| 368 | Ga0207702_10027084 | 3300026078 | Bacteria | 4759 |
| 369 | Ga0207702_10030282 | 3300026078 | Bacteria | 4509 |
| 370 | Ga0207702_10107880 | 3300026078 | Bacteria | 2470 |
| 371 | Ga0207641_10009512 | 3300026088 | Bacteria | 8012 |
| 372 | Ga0207641_10060657 | 3300026088 | Bacteria | 3224 |
| 373 | Ga0207641_10221528 | 3300026088 | Bacteria | 1755 |
| 374 | Ga0207641_10567599 | 3300026088 | Bacteria | 1108 |
| 375 | Ga0207648_10071014 | 3300026089 | Bacteria | 3035 |
| 376 | Ga0207648_10220498 | 3300026089 | Bacteria | 1686 |
| 377 | Ga0207674_10002322 | 3300026116 | Bacteria | 24094 |
| 378 | Ga0207674_10008389 | 3300026116 | Bacteria | 11948 |
| 379 | Ga0207674_10008726 | 3300026116 | Bacteria | 11669 |
| 380 | Ga0207674_10049463 | 3300026116 | Bacteria | 4299 |
| 381 | Ga0207675_100070634 | 3300026118 | Bacteria | 3264 |
| 382 | Ga0207683_10275069 | 3300026121 | Bacteria | 1539 |
| 383 | Ga0207698_10005406 | 3300026142 | Bacteria | 7890 |
| 384 | Ga0207698_10074478 | 3300026142 | Bacteria | 2708 |
| 385 | Ga0207698_10079744 | 3300026142 | Bacteria | 2634 |
| 386 | Ga0207698_10121696 | 3300026142 | Bacteria | 2210 |
| 387 | Ga0207698_10278447 | 3300026142 | Bacteria | 1546 |
| 388 | Ga0209371_1000018 | 3300027312 | Bacteria | 614700 |
| 389 | Ga0209974_10040660 | 3300027876 | Bacteria | 1548 |
| 390 | Ga0268266_10000017 | 3300028379 | Bacteria | 607272 |
| 391 | Ga0268266_10042299 | 3300028379 | Bacteria | 3891 |
| 392 | Ga0268266_10080274 | 3300028379 | Bacteria | 2842 |
| 393 | Ga0268266_10233736 | 3300028379 | Bacteria | 1694 |
| 394 | Ga0268266_10528461 | 3300028379 | Bacteria | 1128 |
| 395 | Ga0268266_10688073 | 3300028379 | Bacteria | 985 |
| 396 | Ga0268265_10000376 | 3300028380 | Bacteria | 48178 |
| 397 | Ga0307515_10483712 | 3300028794 | Bacteria | 850 |
| 398 | Ga0268256_1000016 | 3300030500 | Bacteria | 614700 |
| 399 | Ga0316178_1024454 | 3300030735 | Bacteria | 1433 |
| 400 | Ga0316183_1013189 | 3300030742 | Bacteria | 1273 |
| 401 | Ga0307513_10146417 | 3300031456 | Bacteria | 2279 |
| 402 | Ga0307509_10154147 | 3300031507 | Bacteria | 2207 |
| 403 | Ga0316575_10014957 | 3300031665 | Bacteria | 2921 |
| 404 | Ga0316578_10001715 | 3300031728 | Bacteria | 9149 |
| 405 | Ga0316578_10173597 | 3300031728 | Bacteria | 1299 |
| 406 | Ga0307406_10003433 | 3300031901 | Bacteria | 8623 |
| 407 | Ga0307409_100899672 | 3300031995 | Bacteria | 899 |
| 408 | Ga0307409_100995499 | 3300031995 | Bacteria | 856 |
| 409 | Ga0307414_10063368 | 3300032004 | Bacteria | 2627 |
| 410 | Ga0307414_10170466 | 3300032004 | Bacteria | 1739 |
| 411 | Ga0307414_10322283 | 3300032004 | Bacteria | 1316 |
| 412 | Ga0316580_10021272 | 3300032139 | Bacteria | 1999 |
| 413 | Ga0373937_0533753 | 3300036401 | Bacteria | 1115 |
| 414 | Ga0316584_0004592 | 3300036712 | Bacteria | 9152 |
| 415 | Ga0395899_0000164 | 3300037312 | Bacteria | 102165 |
| 416 | Ga0395900_0000163 | 3300037418 | Bacteria | 109199 |
| 417 | Ga0395900_0000217 | 3300037418 | Bacteria | 90402 |
| 418 | Ga0395900_0424266 | 3300037418 | Bacteria | 1290 |
| 419 | Ga0395898_0000029 | 3300037466 | Bacteria | 370667 |
| 420 | Ga0395898_0812526 | 3300037466 | Bacteria | 875 |
| 421 | Ga0395905_0246134 | 3300037471 | Bacteria | 1670 |
| 422 | Ga0439436_0027207 | 3300041404 | Bacteria | 1674 |
| 423 | Ga0439439_0014291 | 3300041406 | Bacteria | 1932 |
| 424 | Ga0439447_000276 | 3300041407 | Bacteria | 18194 |
| 425 | Ga0451787_716987 | 3300041441 | Bacteria | 2601 |
| 426 | Ga0451791_0862441 | 3300041451 | Bacteria | 1388 |
| 427 | Ga0451793_1023005 | 3300041452 | Bacteria | 1339 |
| 428 | Ga0451800_0141867 | 3300041459 | Bacteria | 4981 |
| 429 | Ga0451802_1110374 | 3300041460 | Bacteria | 5165 |
| 430 | Ga0451802_1696655 | 3300041460 | Bacteria | 1079 |
| 431 | Ga0451806_117351 | 3300041462 | Bacteria | 8065 |
| 432 | Ga0451807_0337638 | 3300041486 | Bacteria | 1453 |
| 433 | Ga0451807_0456601 | 3300041486 | Bacteria | 1856 |
| 434 | Ga0451807_1394303 | 3300041486 | Bacteria | 2770 |
| 435 | Ga0451837_0747194 | 3300041494 | Bacteria | 1828 |
| 436 | Ga0451837_1713807 | 3300041494 | Bacteria | 1066 |
| 437 | Ga0439445_0014309 | 3300042004 | Bacteria | 1930 |
| 438 | Ga0439432_030801 | 3300042006 | Bacteria | 1738 |
| 439 | Ga0439449_0020377 | 3300042007 | Bacteria | 2485 |
| 440 | Ga0439449_0134387 | 3300042007 | Bacteria | 920 |
| 441 | Ga0450908_000062 | 3300042184 | Bacteria | 21656 |
| 442 | Ga0466988_0067231 | 3300044536 | Bacteria | 2115 |
| 443 | Ga0466969_0015355 | 3300044656 | Bacteria | 4013 |
| 444 | Ga0466972_0001414 | 3300044658 | Bacteria | 11634 |
| 445 | Ga0466982_0000011 | 3300044672 | Bacteria | 175513 |
| 446 | Ga0466966_0043419 | 3300044684 | Bacteria | 2881 |
| 447 | Ga0466966_0153471 | 3300044684 | Bacteria | 1403 |
| 448 | Ga0466961_0036989 | 3300044693 | Bacteria | 3132 |
| 449 | Ga0466961_0323369 | 3300044693 | Bacteria | 940 |
| 450 | Ga0453684_0000531 | 3300044712 | Bacteria | 145390 |
| 451 | Ga0466970_0001522 | 3300044765 | Bacteria | 11158 |
| 452 | Ga0466970_0013448 | 3300044765 | Bacteria | 4195 |
| 453 | Ga0466970_0033643 | 3300044765 | Bacteria | 2709 |
| 454 | Ga0466970_0342560 | 3300044765 | Bacteria | 847 |
| 455 | Ga0466957_0066566 | 3300044842 | Bacteria | 2221 |
| 456 | Ga0466959_0000246 | 3300045049 | Bacteria | 33596 |
| 457 | Ga0466959_0012881 | 3300045049 | Bacteria | 6053 |
| 458 | Ga0466959_0030265 | 3300045049 | Bacteria | 4009 |
| 459 | Ga0451576_0000212 | 3300045051 | Bacteria | 145396 |
| 460 | Ga0466958_0289006 | 3300045836 | Bacteria | 1051 |
| 461 | Ga0495627_018790 | 3300046453 | Bacteria | 2325 |
| 462 | Ga0495638_0000865 | 3300046460 | Bacteria | 31467 |
| 463 | Ga0495607_0001295 | 3300046501 | Bacteria | 22335 |
| 464 | Ga0495606_0000918 | 3300046507 | Bacteria | 43503 |
| 465 | Ga0495606_0000948 | 3300046507 | Bacteria | 42725 |
| 466 | Ga0495606_0011361 | 3300046507 | Bacteria | 7271 |
| 467 | Ga0495610_0004897 | 3300046512 | Bacteria | 9726 |
| 468 | Ga0495616_0100842 | 3300046513 | Bacteria | 1354 |
| 469 | Ga0495620_0000565 | 3300046515 | Bacteria | 23373 |
| 470 | Ga0495631_0003548 | 3300046518 | Bacteria | 8529 |
| 471 | Ga0495643_0010311 | 3300046522 | Bacteria | 5754 |
| 472 | Ga0495663_0001434 | 3300046525 | Bacteria | 7522 |
| 473 | Ga0495598_0075565 | 3300046537 | Bacteria | 1070 |
| 474 | Ga0495621_0001934 | 3300046539 | Bacteria | 5448 |
| 475 | Ga0495656_0003859 | 3300046615 | Bacteria | 5098 |
| 476 | Ga0495656_0006771 | 3300046615 | Bacteria | 4027 |
| 477 | Ga0495668_0002964 | 3300046616 | Bacteria | 13323 |
| 478 | Ga0495625_0107781 | 3300046660 | Bacteria | 1906 |
| 479 | Ga0495670_0236149 | 3300046691 | Bacteria | 973 |
| 480 | Ga0495671_0005538 | 3300046692 | Bacteria | 7384 |
| 481 | Ga0495660_0026804 | 3300046810 | Bacteria | 3263 |
| 482 | Ga0495636_0006456 | 3300047318 | Bacteria | 4607 |
| 483 | Ga0495672_0000087 | 3300047320 | Bacteria | 154275 |
| 484 | Ga0495672_0055159 | 3300047320 | Bacteria | 2320 |
| 485 | Ga0495677_0035505 | 3300047445 | Bacteria | 1819 |
| 486 | Ga0495686_0004214 | 3300047472 | Bacteria | 11939 |
| 487 | Ga0495686_0004945 | 3300047472 | Bacteria | 10727 |
| 488 | Ga0495686_0038417 | 3300047472 | Bacteria | 3061 |
| 489 | Ga0495615_0003458 | 3300048090 | Bacteria | 2648 |
| 490 | Ga0496100_0178507 | 3300048903 | Bacteria | 1534 |
| 491 | Ga0496108_0319897 | 3300048911 | Bacteria | 1353 |
| 492 | Ga0496109_0074224 | 3300048912 | Bacteria | 3126 |
| 493 | Ga0496112_0501297 | 3300048915 | Bacteria | 1149 |
| 494 | Ga0496113_0071099 | 3300048916 | Bacteria | 2646 |
| 495 | Ga0496114_0033133 | 3300048917 | Bacteria | 4255 |
| 496 | Ga0496114_0229627 | 3300048917 | Bacteria | 1630 |
| 497 | Ga0496115_0000077 | 3300048918 | Bacteria | 89885 |
| 498 | Ga0496117_0009829 | 3300048920 | Bacteria | 8812 |
| 499 | Ga0496117_0028737 | 3300048920 | Bacteria | 4301 |
| 500 | Ga0496117_0034057 | 3300048920 | Bacteria | 3844 |
| 501 | Ga0496117_0326005 | 3300048920 | Bacteria | 803 |
| 502 | Ga0496118_0035939 | 3300048921 | Bacteria | 4014 |
| 503 | Ga0496118_0056691 | 3300048921 | Bacteria | 2943 |
| 504 | Ga0496118_0183806 | 3300048921 | Bacteria | 1259 |
| 505 | Ga0496119_0001836 | 3300048922 | Bacteria | 24586 |
| 506 | Ga0496120_0000273 | 3300048923 | Bacteria | 86248 |
| 507 | Ga0496121_0018990 | 3300048924 | Bacteria | 6897 |
| 508 | Ga0496122_0000417 | 3300048925 | Bacteria | 90401 |
| 509 | Ga0496122_0001517 | 3300048925 | Bacteria | 37011 |
| 510 | Ga0496123_0000137 | 3300048926 | Bacteria | 152169 |
| 511 | Ga0496123_0000323 | 3300048926 | Bacteria | 91212 |
| 512 | Ga0496123_0005271 | 3300048926 | Bacteria | 13107 |
| 513 | Ga0496123_0160107 | 3300048926 | Bacteria | 1201 |
| 514 | Ga0496123_0166846 | 3300048926 | Bacteria | 1166 |
| 515 | Ga0496124_0003391 | 3300048927 | Bacteria | 19565 |
| 516 | Ga0496124_0038566 | 3300048927 | Bacteria | 4147 |
| 517 | Ga0496125_0077822 | 3300048928 | Bacteria | 2553 |
| 518 | Ga0496126_0000047 | 3300048929 | Bacteria | 322212 |
| 519 | Ga0496126_0105791 | 3300048929 | Bacteria | 2456 |
| 520 | Ga0496126_0176797 | 3300048929 | Bacteria | 1815 |
| 521 | Ga0496126_0297614 | 3300048929 | Bacteria | 1332 |
| 522 | Ga0501031_0011342 | 3300049568 | Bacteria | 5804 |
| 523 | Ga0501031_0060029 | 3300049568 | Bacteria | 2478 |
| 524 | Ga0501032_0020663 | 3300049569 | Bacteria | 4583 |
| 525 | Ga0501032_0085227 | 3300049569 | Bacteria | 2100 |
| 526 | Ga0501033_0000648 | 3300049570 | Bacteria | 32231 |
| 527 | Ga0501033_0000683 | 3300049570 | Bacteria | 31408 |
| 528 | Ga0501033_0120810 | 3300049570 | Bacteria | 1901 |
| 529 | Ga0501033_0137547 | 3300049570 | Bacteria | 1767 |
| 530 | Ga0501034_0002782 | 3300049571 | Bacteria | 20512 |
| 531 | Ga0501034_0006063 | 3300049571 | Bacteria | 13053 |
| 532 | Ga0501034_0065145 | 3300049571 | Bacteria | 3656 |
| 533 | Ga0501034_0083756 | 3300049571 | Bacteria | 3191 |
| 534 | Ga0501034_0300286 | 3300049571 | Bacteria | 1542 |
| 535 | Ga0501036_0008180 | 3300049572 | Bacteria | 8573 |
| 536 | Ga0501036_0031163 | 3300049572 | Bacteria | 4506 |
| 537 | Ga0501036_0090604 | 3300049572 | Bacteria | 2583 |
| 538 | Ga0501036_0098252 | 3300049572 | Bacteria | 2475 |
| 539 | Ga0501037_0010898 | 3300049573 | Bacteria | 6680 |
| 540 | Ga0501037_0067090 | 3300049573 | Bacteria | 2613 |
| 541 | Ga0501037_0127846 | 3300049573 | Bacteria | 1823 |
| 542 | Ga0501037_0378757 | 3300049573 | Bacteria | 973 |
| 543 | Ga0501038_0049526 | 3300049574 | Bacteria | 3632 |
| 544 | Ga0501038_0054955 | 3300049574 | Bacteria | 3422 |
| 545 | Ga0501038_0106607 | 3300049574 | Bacteria | 2326 |
| 546 | Ga0501038_0138085 | 3300049574 | Bacteria | 1996 |
| 547 | Ga0501038_0187968 | 3300049574 | Bacteria | 1663 |
| 548 | Ga0501038_0208685 | 3300049574 | Bacteria | 1564 |
| 549 | Ga0501038_0390874 | 3300049574 | Bacteria | 1077 |
| 550 | Ga0501039_0017656 | 3300049575 | Bacteria | 5473 |
| 551 | Ga0501039_0109320 | 3300049575 | Bacteria | 2161 |
| 552 | Ga0501043_0016644 | 3300049579 | Bacteria | 5762 |
| 553 | Ga0501043_0033628 | 3300049579 | Bacteria | 4034 |
| 554 | Ga0501043_0100193 | 3300049579 | Bacteria | 2277 |
| 555 | Ga0501046_0021844 | 3300049580 | Bacteria | 5276 |
| 556 | Ga0501046_0039025 | 3300049580 | Bacteria | 3806 |
| 557 | Ga0501046_0048382 | 3300049580 | Bacteria | 3367 |
| 558 | Ga0501046_0094391 | 3300049580 | Bacteria | 2299 |
| 559 | Ga0501046_0206302 | 3300049580 | Bacteria | 1460 |
| 560 | Ga0501047_0001522 | 3300049581 | Bacteria | 22636 |
| 561 | Ga0501047_0001828 | 3300049581 | Bacteria | 20569 |
| 562 | Ga0501047_0015935 | 3300049581 | Bacteria | 7165 |
| 563 | Ga0501047_0018902 | 3300049581 | Bacteria | 6608 |
| 564 | Ga0501047_0029824 | 3300049581 | Bacteria | 5258 |
| 565 | Ga0501047_0082079 | 3300049581 | Bacteria | 3099 |
| 566 | Ga0501047_0196976 | 3300049581 | Bacteria | 1876 |
| 567 | Ga0501047_0261424 | 3300049581 | Bacteria | 1578 |
| 568 | Ga0501048_0005076 | 3300049582 | Bacteria | 10027 |
| 569 | Ga0501067_0000857 | 3300049583 | Bacteria | 16400 |
| 570 | Ga0501067_0061569 | 3300049583 | Bacteria | 2077 |
| 571 | Ga0501068_0002378 | 3300049584 | Bacteria | 10003 |
| 572 | Ga0501068_0014946 | 3300049584 | Bacteria | 4448 |
| 573 | Ga0501068_0041232 | 3300049584 | Bacteria | 2773 |
| 574 | Ga0501068_0305055 | 3300049584 | Bacteria | 1019 |
| 575 | Ga0501069_0004343 | 3300049585 | Bacteria | 7320 |
| 576 | Ga0501069_0065347 | 3300049585 | Bacteria | 2034 |
| 577 | Ga0501069_0066293 | 3300049585 | Bacteria | 2019 |
| 578 | Ga0501070_0005876 | 3300049586 | Bacteria | 10464 |
| 579 | Ga0501070_0023616 | 3300049586 | Bacteria | 5151 |
| 580 | Ga0501070_0028917 | 3300049586 | Bacteria | 4647 |
| 581 | Ga0501070_0050686 | 3300049586 | Bacteria | 3445 |
| 582 | Ga0501070_0053490 | 3300049586 | Bacteria | 3349 |
| 583 | Ga0501070_0100683 | 3300049586 | Bacteria | 2390 |
| 584 | Ga0501070_0113020 | 3300049586 | Bacteria | 2244 |
| 585 | Ga0501070_0254009 | 3300049586 | Bacteria | 1437 |
| 586 | Ga0501070_0265574 | 3300049586 | Bacteria | 1402 |
| 587 | Ga0501071_0027758 | 3300049587 | Bacteria | 3984 |
| 588 | Ga0501071_0071996 | 3300049587 | Bacteria | 2520 |
| 589 | Ga0501072_0000573 | 3300049588 | Bacteria | 26511 |
| 590 | Ga0501073_0000434 | 3300049589 | Bacteria | 28757 |
| 591 | Ga0501073_0021629 | 3300049589 | Bacteria | 4635 |
| 592 | Ga0501073_0070760 | 3300049589 | Bacteria | 2430 |
| 593 | Ga0501073_0094089 | 3300049589 | Bacteria | 2081 |
| 594 | Ga0501073_0186270 | 3300049589 | Bacteria | 1436 |
| 595 | Ga0501073_0319438 | 3300049589 | Bacteria | 1071 |
| 596 | Ga0501074_0002217 | 3300049590 | Bacteria | 13482 |
| 597 | Ga0501074_0003202 | 3300049590 | Bacteria | 11546 |
| 598 | Ga0501074_0004731 | 3300049590 | Bacteria | 9756 |
| 599 | Ga0501074_0050760 | 3300049590 | Bacteria | 2994 |
| 600 | Ga0501074_0256565 | 3300049590 | Bacteria | 1243 |
| 601 | Ga0501077_0013289 | 3300049593 | Bacteria | 5162 |
| 602 | Ga0501079_0004962 | 3300049741 | Bacteria | 9869 |
| 603 | Ga0501079_0011079 | 3300049741 | Bacteria | 6877 |
| 604 | Ga0501079_0055881 | 3300049741 | Bacteria | 3046 |
| 605 | Ga0501079_0148675 | 3300049741 | Bacteria | 1826 |
| 606 | Ga0501079_0260668 | 3300049741 | Bacteria | 1355 |
| 607 | Ga0501080_0000764 | 3300049742 | Bacteria | 26124 |
| 608 | Ga0501080_0040656 | 3300049742 | Bacteria | 4336 |
| 609 | Ga0501080_0309982 | 3300049742 | Bacteria | 1430 |
| 610 | Ga0501083_0000246 | 3300049744 | Bacteria | 34511 |
| 611 | Ga0501083_0016861 | 3300049744 | Bacteria | 5102 |
| 612 | Ga0501083_0117151 | 3300049744 | Bacteria | 1748 |
| 613 | Ga0501265_008607 | 3300049762 | Bacteria | 1219 |
| 614 | Ga0501275_000512 | 3300049772 | Bacteria | 4353 |
| 615 | Ga0501035_0004415 | 3300049822 | Bacteria | 13354 |
| 616 | Ga0501035_0013478 | 3300049822 | Bacteria | 7546 |
| 617 | Ga0501035_0029015 | 3300049822 | Bacteria | 5047 |
| 618 | Ga0501035_0062096 | 3300049822 | Bacteria | 3324 |
| 619 | Ga0501035_0156946 | 3300049822 | Bacteria | 1971 |
| 620 | Ga0501035_0160760 | 3300049822 | Bacteria | 1944 |
| 621 | Ga0501035_0485848 | 3300049822 | Bacteria | 1018 |
| 622 | Ga0501035_0785746 | 3300049822 | Bacteria | 761 |
| 623 | Ga0501044_0004071 | 3300049823 | Bacteria | 16399 |
| 624 | Ga0501044_0004952 | 3300049823 | Bacteria | 14899 |
| 625 | Ga0501044_0017726 | 3300049823 | Bacteria | 7638 |
| 626 | Ga0501044_0053442 | 3300049823 | Bacteria | 4156 |
| 627 | Ga0501044_0066121 | 3300049823 | Bacteria | 3687 |
| 628 | Ga0501044_0104618 | 3300049823 | Bacteria | 2844 |
| 629 | Ga0501044_0104735 | 3300049823 | Bacteria | 2842 |
| 630 | Ga0501044_0118517 | 3300049823 | Bacteria | 2650 |
| 631 | Ga0501044_0133983 | 3300049823 | Bacteria | 2470 |
| 632 | Ga0501044_0155242 | 3300049823 | Bacteria | 2268 |
| 633 | Ga0501045_0022730 | 3300049824 | Bacteria | 4491 |
| 634 | nmdc:mga00v17_153920_c1 | 3300050491 | Bacteria | 1478 |
| 635 | nmdc:mga00v17_2252_c1 | 3300050491 | Bacteria | 9886 |
| 636 | Ga0500610_0000365 | 3300053079 | Bacteria | 13645 |
| 637 | Ga0500651_0006630 | 3300053093 | Bacteria | 6696 |
| 638 | Ga0500651_0034171 | 3300053093 | Bacteria | 3206 |
| 639 | Ga0500651_0414209 | 3300053093 | Bacteria | 755 |
| 640 | Ga0500568_0000233 | 3300053139 | Bacteria | 47567 |
| 641 | Ga0500645_000375 | 3300053730 | Bacteria | 31466 |
| 642 | Ga0500609_012751 | 3300053731 | Bacteria | 1137 |
| 643 | Ga0501084_0073144 | 3300054114 | Bacteria | 2870 |
| 644 | Ga0501082_0000107 | 3300060353 | Bacteria | 65178 |
| 645 | Ga0501082_0054984 | 3300060353 | Bacteria | 3430 |
| 646 | Ga0501082_0156873 | 3300060353 | Bacteria | 1977 |
| 647 | Ga0466962_0012963 | 3300061719 | Bacteria | 4010 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031728 | Ga0316578_10001715 | Ga0316578_100017159 | 207 |
| 2 | 3300049568 | Ga0501031_0011342 | Ga0501031_0011342_1542_2276 | 208 |
| 3 | 3300049569 | Ga0501032_0020663 | Ga0501032_0020663_626_1360 | 208 |
| 4 | 3300049571 | Ga0501034_0002782 | Ga0501034_0002782_7912_8646 | 208 |
| 5 | 3300049575 | Ga0501039_0017656 | Ga0501039_0017656_3653_4387 | 208 |
| 6 | 3300049580 | Ga0501046_0021844 | Ga0501046_0021844_213_947 | 208 |
| 7 | 3300049581 | Ga0501047_0015935 | Ga0501047_0015935_2805_3539 | 208 |
| 8 | 3300049582 | Ga0501048_0005076 | Ga0501048_0005076_6271_7005 | 208 |
| 9 | 3300049583 | Ga0501067_0061569 | Ga0501067_0061569_823_1557 | 208 |
| 10 | 3300049584 | Ga0501068_0002378 | Ga0501068_0002378_8582_9316 | 208 |
| 11 | 3300049587 | Ga0501071_0071996 | Ga0501071_0071996_240_974 | 208 |
| 12 | 3300049590 | Ga0501074_0004731 | Ga0501074_0004731_3214_3948 | 208 |
| 13 | 3300049741 | Ga0501079_0011079 | Ga0501079_0011079_3178_3912 | 208 |
| 14 | 3300049744 | Ga0501083_0016861 | Ga0501083_0016861_4034_4768 | 208 |
| 15 | 3300049822 | Ga0501035_0004415 | Ga0501035_0004415_754_1488 | 208 |
| 16 | 3300049823 | Ga0501044_0104735 | Ga0501044_0104735_195_929 | 208 |
| 17 | 3300049824 | Ga0501045_0022730 | Ga0501045_0022730_2950_3684 | 208 |
| 18 | 3300054114 | Ga0501084_0073144 | Ga0501084_0073144_1876_2610 | 208 |
| 19 | 3300060353 | Ga0501082_0054984 | Ga0501082_0054984_1876_2610 | 208 |
| 20 | 3300031728 | Ga0316578_10173597 | Ga0316578_101735972 | 209 |
| 21 | 3300032139 | Ga0316580_10021272 | Ga0316580_100212722 | 209 |
| 22 | 3300036712 | Ga0316584_0004592 | Ga0316584_0004592_589_1260 | 209 |
| 23 | 3300041460 | Ga0451802_1696655 | Ga0451802_1696655_83_769 | 212 |
| 24 | 3300005327 | Ga0070658_10025096 | Ga0070658_100250964 | 214 |
| 25 | 3300005335 | Ga0070666_10267594 | Ga0070666_102675942 | 214 |
| 26 | 3300005336 | Ga0070680_100004327 | Ga0070680_1000043272 | 214 |
| 27 | 3300005344 | Ga0070661_100122479 | Ga0070661_1001224792 | 214 |
| 28 | 3300005455 | Ga0070663_100136117 | Ga0070663_1001361172 | 214 |
| 29 | 3300005458 | Ga0070681_10001872 | Ga0070681_1000187210 | 214 |
| 30 | 3300005530 | Ga0070679_100004396 | Ga0070679_1000043962 | 214 |
| 31 | 3300005578 | Ga0068854_100070907 | Ga0068854_1000709072 | 214 |
| 32 | 3300005841 | Ga0068863_100066084 | Ga0068863_1000660842 | 214 |
| 33 | 3300009093 | Ga0105240_10103888 | Ga0105240_101038882 | 214 |
| 34 | 3300013100 | Ga0157373_10055024 | Ga0157373_100550242 | 214 |
| 35 | 3300013104 | Ga0157370_10033604 | Ga0157370_100336043 | 214 |
| 36 | 3300013307 | Ga0157372_10037458 | Ga0157372_100374584 | 214 |
| 37 | 3300025912 | Ga0207707_10002407 | Ga0207707_100024079 | 214 |
| 38 | 3300025917 | Ga0207660_10011546 | Ga0207660_100115463 | 214 |
| 39 | 3300025920 | Ga0207649_10409040 | Ga0207649_104090401 | 214 |
| 40 | 3300025921 | Ga0207652_10000014 | Ga0207652_10000014161 | 214 |
| 41 | 3300025928 | Ga0207700_10513190 | Ga0207700_105131901 | 214 |
| 42 | 3300025931 | Ga0207644_10257288 | Ga0207644_102572882 | 214 |
| 43 | 3300025981 | Ga0207640_10022848 | Ga0207640_100228483 | 214 |
| 44 | 3300026067 | Ga0207678_10142849 | Ga0207678_101428493 | 214 |
| 45 | 3300026088 | Ga0207641_10567599 | Ga0207641_105675992 | 214 |
| 46 | 3300049571 | Ga0501034_0006063 | Ga0501034_0006063_11851_12504 | 214 |
| 47 | 3300049574 | Ga0501038_0208685 | Ga0501038_0208685_215_874 | 214 |
| 48 | 3300049581 | Ga0501047_0001522 | Ga0501047_0001522_16287_16946 | 214 |
| 49 | 3300049585 | Ga0501069_0065347 | Ga0501069_0065347_470_1129 | 214 |
| 50 | 3300049586 | Ga0501070_0023616 | Ga0501070_0023616_1320_1979 | 214 |
| 51 | 3300049587 | Ga0501071_0027758 | Ga0501071_0027758_256_915 | 214 |
| 52 | 3300049589 | Ga0501073_0070760 | Ga0501073_0070760_791_1450 | 214 |
| 53 | 3300049590 | Ga0501074_0002217 | Ga0501074_0002217_7120_7779 | 214 |
| 54 | 3300049593 | Ga0501077_0013289 | Ga0501077_0013289_507_1163 | 214 |
| 55 | 3300049741 | Ga0501079_0148675 | Ga0501079_0148675_507_1166 | 214 |
| 56 | 3300049822 | Ga0501035_0029015 | Ga0501035_0029015_3324_3983 | 214 |
| 57 | 3300049823 | Ga0501044_0004952 | Ga0501044_0004952_8915_9574 | 214 |
| 58 | 3300049823 | Ga0501044_0053442 | Ga0501044_0053442_2548_3207 | 214 |
| 59 | 3300005293 | Ga0065715_10008446 | Ga0065715_100084464 | 215 |
| 60 | 3300025907 | Ga0207645_10026306 | Ga0207645_100263062 | 215 |
| 61 | 3300025912 | Ga0207707_10000084 | Ga0207707_1000008469 | 215 |
| 62 | 3300025917 | Ga0207660_10005551 | Ga0207660_100055519 | 215 |
| 63 | 3300025921 | Ga0207652_10000076 | Ga0207652_1000007670 | 215 |
| 64 | 3300003752 | Ga0055539_1001541 | Ga0055539_10015412 | 216 |
| 65 | 3300003756 | Ga0055533_1000809 | Ga0055533_10008097 | 216 |
| 66 | 3300003759 | Ga0055525_1000138 | Ga0055525_10001388 | 216 |
| 67 | 3300003760 | Ga0055527_1000281 | Ga0055527_100028114 | 216 |
| 68 | 3300003760 | Ga0055527_1000330 | Ga0055527_100033014 | 216 |
| 69 | 3300003761 | Ga0055535_1000843 | Ga0055535_100084310 | 216 |
| 70 | 3300003762 | Ga0055542_1000835 | Ga0055542_100083510 | 216 |
| 71 | 3300003762 | Ga0055542_1001160 | Ga0055542_100116014 | 216 |
| 72 | 3300003763 | Ga0055529_1000717 | Ga0055529_100071710 | 216 |
| 73 | 3300003763 | Ga0055529_1000943 | Ga0055529_100094314 | 216 |
| 74 | 3300005338 | Ga0068868_100319978 | Ga0068868_1003199782 | 216 |
| 75 | 3300005344 | Ga0070661_100009383 | Ga0070661_1000093834 | 216 |
| 76 | 3300005353 | Ga0070669_100064482 | Ga0070669_1000644824 | 216 |
| 77 | 3300005354 | Ga0070675_100043947 | Ga0070675_1000439474 | 216 |
| 78 | 3300005364 | Ga0070673_100408221 | Ga0070673_1004082211 | 216 |
| 79 | 3300005367 | Ga0070667_100121267 | Ga0070667_1001212672 | 216 |
| 80 | 3300005457 | Ga0070662_100041992 | Ga0070662_1000419923 | 216 |
| 81 | 3300005458 | Ga0070681_10177415 | Ga0070681_101774152 | 216 |
| 82 | 3300005535 | Ga0070684_100024537 | Ga0070684_1000245373 | 216 |
| 83 | 3300005539 | Ga0068853_100004195 | Ga0068853_1000041957 | 216 |
| 84 | 3300005539 | Ga0068853_100028892 | Ga0068853_1000288924 | 216 |
| 85 | 3300005539 | Ga0068853_100033305 | Ga0068853_1000333053 | 216 |
| 86 | 3300005543 | Ga0070672_100003657 | Ga0070672_1000036576 | 216 |
| 87 | 3300005544 | Ga0070686_100167171 | Ga0070686_1001671713 | 216 |
| 88 | 3300005547 | Ga0070693_100025853 | Ga0070693_1000258533 | 216 |
| 89 | 3300005548 | Ga0070665_100008261 | Ga0070665_1000082616 | 216 |
| 90 | 3300005563 | Ga0068855_100171818 | Ga0068855_1001718182 | 216 |
| 91 | 3300005563 | Ga0068855_100400853 | Ga0068855_1004008533 | 216 |
| 92 | 3300005578 | Ga0068854_100053357 | Ga0068854_1000533572 | 216 |
| 93 | 3300005578 | Ga0068854_100080020 | Ga0068854_1000800203 | 216 |
| 94 | 3300005614 | Ga0068856_100012643 | Ga0068856_1000126435 | 216 |
| 95 | 3300005614 | Ga0068856_100161736 | Ga0068856_1001617363 | 216 |
| 96 | 3300005614 | Ga0068856_100406692 | Ga0068856_1004066922 | 216 |
| 97 | 3300005616 | Ga0068852_100005973 | Ga0068852_1000059732 | 216 |
| 98 | 3300005616 | Ga0068852_100348820 | Ga0068852_1003488203 | 216 |
| 99 | 3300005834 | Ga0068851_10027186 | Ga0068851_100271863 | 216 |
| 100 | 3300005840 | Ga0068870_10057938 | Ga0068870_100579382 | 216 |
| 101 | 3300005843 | Ga0068860_100124956 | Ga0068860_1001249563 | 216 |
| 102 | 3300005844 | Ga0068862_100111847 | Ga0068862_1001118473 | 216 |
| 103 | 3300006881 | Ga0068865_100017143 | Ga0068865_1000171434 | 216 |
| 104 | 3300006881 | Ga0068865_100053746 | Ga0068865_1000537462 | 216 |
| 105 | 3300009093 | Ga0105240_10152371 | Ga0105240_101523713 | 216 |
| 106 | 3300009098 | Ga0105245_10723360 | Ga0105245_107233602 | 216 |
| 107 | 3300009174 | Ga0105241_10055846 | Ga0105241_100558463 | 216 |
| 108 | 3300009174 | Ga0105241_10103439 | Ga0105241_101034392 | 216 |
| 109 | 3300009551 | Ga0105238_10006626 | Ga0105238_100066263 | 216 |
| 110 | 3300009551 | Ga0105238_10192207 | Ga0105238_101922072 | 216 |
| 111 | 3300009553 | Ga0105249_11264596 | Ga0105249_112645961 | 216 |
| 112 | 3300010375 | Ga0105239_10033812 | Ga0105239_100338122 | 216 |
| 113 | 3300013100 | Ga0157373_10042694 | Ga0157373_100426943 | 216 |
| 114 | 3300013104 | Ga0157370_10663632 | Ga0157370_106636322 | 216 |
| 115 | 3300013105 | Ga0157369_10002250 | Ga0157369_1000225015 | 216 |
| 116 | 3300013296 | Ga0157374_10158927 | Ga0157374_101589273 | 216 |
| 117 | 3300013306 | Ga0163162_10028377 | Ga0163162_100283771 | 216 |
| 118 | 3300013306 | Ga0163162_11402870 | Ga0163162_114028701 | 216 |
| 119 | 3300013307 | Ga0157372_10000344 | Ga0157372_1000034419 | 216 |
| 120 | 3300013307 | Ga0157372_10586568 | Ga0157372_105865682 | 216 |
| 121 | 3300013308 | Ga0157375_10584129 | Ga0157375_105841292 | 216 |
| 122 | 3300014325 | Ga0163163_10000029 | Ga0163163_1000002943 | 216 |
| 123 | 3300014325 | Ga0163163_10672312 | Ga0163163_106723122 | 216 |
| 124 | 3300014497 | Ga0182008_10020566 | Ga0182008_100205663 | 216 |
| 125 | 3300014968 | Ga0157379_10001942 | Ga0157379_1000194216 | 216 |
| 126 | 3300014969 | Ga0157376_10005280 | Ga0157376_100052807 | 216 |
| 127 | 3300025226 | Ga0209674_100149 | Ga0209674_10014963 | 216 |
| 128 | 3300025228 | Ga0209672_100004 | Ga0209672_100004884 | 216 |
| 129 | 3300025228 | Ga0209672_100008 | Ga0209672_100008802 | 216 |
| 130 | 3300025230 | Ga0209563_100036 | Ga0209563_1000368 | 216 |
| 131 | 3300025242 | Ga0209258_100003 | Ga0209258_100003884 | 216 |
| 132 | 3300025242 | Ga0209258_100004 | Ga0209258_100004387 | 216 |
| 133 | 3300025242 | Ga0209258_100008 | Ga0209258_10000812 | 216 |
| 134 | 3300025253 | Ga0209677_100974 | Ga0209677_10097413 | 216 |
| 135 | 3300025254 | Ga0209148_1000025 | Ga0209148_1000025188 | 216 |
| 136 | 3300025254 | Ga0209148_1000053 | Ga0209148_1000053132 | 216 |
| 137 | 3300025272 | Ga0209455_1000004 | Ga0209455_1000004884 | 216 |
| 138 | 3300025272 | Ga0209455_1000007 | Ga0209455_1000007132 | 216 |
| 139 | 3300025303 | Ga0209051_1005721 | Ga0209051_10057214 | 216 |
| 140 | 3300025321 | Ga0207656_10021120 | Ga0207656_100211202 | 216 |
| 141 | 3300025903 | Ga0207680_10139401 | Ga0207680_101394011 | 216 |
| 142 | 3300025903 | Ga0207680_10323227 | Ga0207680_103232272 | 216 |
| 143 | 3300025904 | Ga0207647_10001336 | Ga0207647_1000133610 | 216 |
| 144 | 3300025908 | Ga0207643_10041259 | Ga0207643_100412592 | 216 |
| 145 | 3300025911 | Ga0207654_10000458 | Ga0207654_100004583 | 216 |
| 146 | 3300025911 | Ga0207654_10063425 | Ga0207654_100634253 | 216 |
| 147 | 3300025912 | Ga0207707_10054364 | Ga0207707_100543642 | 216 |
| 148 | 3300025913 | Ga0207695_10000772 | Ga0207695_1000077211 | 216 |
| 149 | 3300025913 | Ga0207695_10595887 | Ga0207695_105958872 | 216 |
| 150 | 3300025919 | Ga0207657_10007147 | Ga0207657_1000714712 | 216 |
| 151 | 3300025920 | Ga0207649_10004292 | Ga0207649_100042923 | 216 |
| 152 | 3300025923 | Ga0207681_10056764 | Ga0207681_100567641 | 216 |
| 153 | 3300025924 | Ga0207694_10006803 | Ga0207694_100068037 | 216 |
| 154 | 3300025927 | Ga0207687_10484561 | Ga0207687_104845612 | 216 |
| 155 | 3300025940 | Ga0207691_10009099 | Ga0207691_100090992 | 216 |
| 156 | 3300025942 | Ga0207689_10034224 | Ga0207689_100342242 | 216 |
| 157 | 3300025944 | Ga0207661_10113455 | Ga0207661_101134553 | 216 |
| 158 | 3300025949 | Ga0207667_10019912 | Ga0207667_100199127 | 216 |
| 159 | 3300025981 | Ga0207640_10000362 | Ga0207640_1000036226 | 216 |
| 160 | 3300026041 | Ga0207639_10000514 | Ga0207639_1000051411 | 216 |
| 161 | 3300026067 | Ga0207678_10247627 | Ga0207678_102476272 | 216 |
| 162 | 3300026078 | Ga0207702_10027084 | Ga0207702_100270844 | 216 |
| 163 | 3300026078 | Ga0207702_10030282 | Ga0207702_100302823 | 216 |
| 164 | 3300026078 | Ga0207702_10107880 | Ga0207702_101078803 | 216 |
| 165 | 3300026089 | Ga0207648_10220498 | Ga0207648_102204982 | 216 |
| 166 | 3300026116 | Ga0207674_10008389 | Ga0207674_100083898 | 216 |
| 167 | 3300026121 | Ga0207683_10275069 | Ga0207683_102750692 | 216 |
| 168 | 3300026142 | Ga0207698_10074478 | Ga0207698_100744784 | 216 |
| 169 | 3300036401 | Ga0373937_0533753 | Ga0373937_0533753_83_772 | 216 |
| 170 | 3300037312 | Ga0395899_0000164 | Ga0395899_0000164_15475_16143 | 216 |
| 171 | 3300037418 | Ga0395900_0000217 | Ga0395900_0000217_70708_71376 | 216 |
| 172 | 3300037466 | Ga0395898_0000029 | Ga0395898_0000029_352597_353265 | 216 |
| 173 | 3300041441 | Ga0451787_716987 | Ga0451787_716987_1657_2328 | 216 |
| 174 | 3300042184 | Ga0450908_000062 | Ga0450908_000062_9864_10532 | 216 |
| 175 | 3300044656 | Ga0466969_0015355 | Ga0466969_0015355_2675_3343 | 216 |
| 176 | 3300044672 | Ga0466982_0000011 | Ga0466982_0000011_11460_12128 | 216 |
| 177 | 3300044684 | Ga0466966_0153471 | Ga0466966_0153471_242_910 | 216 |
| 178 | 3300044693 | Ga0466961_0036989 | Ga0466961_0036989_1827_2495 | 216 |
| 179 | 3300044693 | Ga0466961_0323369 | Ga0466961_0323369_31_699 | 216 |
| 180 | 3300044712 | Ga0453684_0000531 | Ga0453684_0000531_56794_57456 | 216 |
| 181 | 3300044765 | Ga0466970_0013448 | Ga0466970_0013448_16_684 | 216 |
| 182 | 3300044765 | Ga0466970_0033643 | Ga0466970_0033643_1142_1810 | 216 |
| 183 | 3300044842 | Ga0466957_0066566 | Ga0466957_0066566_1433_2101 | 216 |
| 184 | 3300045049 | Ga0466959_0000246 | Ga0466959_0000246_17739_18407 | 216 |
| 185 | 3300045051 | Ga0451576_0000212 | Ga0451576_0000212_56800_57462 | 216 |
| 186 | 3300046460 | Ga0495638_0000865 | Ga0495638_0000865_20971_21639 | 216 |
| 187 | 3300046501 | Ga0495607_0001295 | Ga0495607_0001295_17982_18650 | 216 |
| 188 | 3300046507 | Ga0495606_0011361 | Ga0495606_0011361_85_753 | 216 |
| 189 | 3300048903 | Ga0496100_0178507 | Ga0496100_0178507_79_747 | 216 |
| 190 | 3300048920 | Ga0496117_0326005 | Ga0496117_0326005_24_692 | 216 |
| 191 | 3300048926 | Ga0496123_0166846 | Ga0496123_0166846_115_783 | 216 |
| 192 | 3300049572 | Ga0501036_0090604 | Ga0501036_0090604_98_787 | 216 |
| 193 | 3300049574 | Ga0501038_0138085 | Ga0501038_0138085_1082_1771 | 216 |
| 194 | 3300049579 | Ga0501043_0033628 | Ga0501043_0033628_1718_2407 | 216 |
| 195 | 3300049580 | Ga0501046_0206302 | Ga0501046_0206302_43_732 | 216 |
| 196 | 3300049581 | Ga0501047_0001828 | Ga0501047_0001828_15789_16478 | 216 |
| 197 | 3300049581 | Ga0501047_0018902 | Ga0501047_0018902_1569_2258 | 216 |
| 198 | 3300049583 | Ga0501067_0000857 | Ga0501067_0000857_7200_7889 | 216 |
| 199 | 3300049584 | Ga0501068_0014946 | Ga0501068_0014946_337_1026 | 216 |
| 200 | 3300049585 | Ga0501069_0004343 | Ga0501069_0004343_4349_5038 | 216 |
| 201 | 3300049585 | Ga0501069_0066293 | Ga0501069_0066293_897_1586 | 216 |
| 202 | 3300049586 | Ga0501070_0005876 | Ga0501070_0005876_7836_8525 | 216 |
| 203 | 3300049586 | Ga0501070_0113020 | Ga0501070_0113020_209_898 | 216 |
| 204 | 3300049588 | Ga0501072_0000573 | Ga0501072_0000573_17498_18187 | 216 |
| 205 | 3300049589 | Ga0501073_0000434 | Ga0501073_0000434_2132_2821 | 216 |
| 206 | 3300049590 | Ga0501074_0003202 | Ga0501074_0003202_8520_9209 | 216 |
| 207 | 3300049741 | Ga0501079_0004962 | Ga0501079_0004962_8109_8798 | 216 |
| 208 | 3300049742 | Ga0501080_0000764 | Ga0501080_0000764_16567_17256 | 216 |
| 209 | 3300049742 | Ga0501080_0040656 | Ga0501080_0040656_394_1083 | 216 |
| 210 | 3300049744 | Ga0501083_0000246 | Ga0501083_0000246_25401_26090 | 216 |
| 211 | 3300049822 | Ga0501035_0485848 | Ga0501035_0485848_174_863 | 216 |
| 212 | 3300049823 | Ga0501044_0104618 | Ga0501044_0104618_1395_2084 | 216 |
| 213 | 3300049823 | Ga0501044_0133983 | Ga0501044_0133983_1714_2403 | 216 |
| 214 | 3300053093 | Ga0500651_0414209 | Ga0500651_0414209_60_728 | 216 |
| 215 | 3300060353 | Ga0501082_0156873 | Ga0501082_0156873_583_1272 | 216 |
| 216 | 3300013297 | Ga0157378_10000536 | Ga0157378_1000053623 | 217 |
| 217 | 3300026035 | Ga0207703_10202544 | Ga0207703_102025442 | 217 |
| 218 | 3300031995 | Ga0307409_100995499 | Ga0307409_1009954992 | 217 |
| 219 | 3300047445 | Ga0495677_0035505 | Ga0495677_0035505_844_1527 | 217 |
| 220 | 3300049586 | Ga0501070_0050686 | Ga0501070_0050686_61_783 | 217 |
| 221 | 3300049590 | Ga0501074_0256565 | Ga0501074_0256565_282_1004 | 217 |
| 222 | 3300025914 | Ga0207671_10088892 | Ga0207671_100888922 | 218 |
| 223 | 3300041404 | Ga0439436_0027207 | Ga0439436_0027207_53_742 | 218 |
| 224 | 3300042007 | Ga0439449_0134387 | Ga0439449_0134387_191_880 | 218 |
| 225 | 3300001979 | JGI24740J21852_10001041 | JGI24740J21852_100010414 | 219 |
| 226 | 3300004800 | Ga0058861_11997967 | Ga0058861_119979672 | 219 |
| 227 | 3300005337 | Ga0070682_100013741 | Ga0070682_1000137412 | 219 |
| 228 | 3300005341 | Ga0070691_10230441 | Ga0070691_102304412 | 219 |
| 229 | 3300005345 | Ga0070692_10150891 | Ga0070692_101508912 | 219 |
| 230 | 3300005366 | Ga0070659_100187046 | Ga0070659_1001870462 | 219 |
| 231 | 3300005457 | Ga0070662_100014495 | Ga0070662_1000144953 | 219 |
| 232 | 3300005546 | Ga0070696_100002079 | Ga0070696_1000020795 | 219 |
| 233 | 3300005547 | Ga0070693_100005032 | Ga0070693_1000050324 | 219 |
| 234 | 3300005548 | Ga0070665_100027661 | Ga0070665_1000276614 | 219 |
| 235 | 3300005578 | Ga0068854_100542130 | Ga0068854_1005421302 | 219 |
| 236 | 3300005614 | Ga0068856_100452062 | Ga0068856_1004520622 | 219 |
| 237 | 3300005616 | Ga0068852_100212373 | Ga0068852_1002123732 | 219 |
| 238 | 3300005834 | Ga0068851_10011937 | Ga0068851_100119373 | 219 |
| 239 | 3300009093 | Ga0105240_10087720 | Ga0105240_100877203 | 219 |
| 240 | 3300009174 | Ga0105241_10017637 | Ga0105241_100176375 | 219 |
| 241 | 3300009545 | Ga0105237_10618370 | Ga0105237_106183702 | 219 |
| 242 | 3300009551 | Ga0105238_10011965 | Ga0105238_100119653 | 219 |
| 243 | 3300013100 | Ga0157373_10084294 | Ga0157373_100842943 | 219 |
| 244 | 3300013104 | Ga0157370_10144952 | Ga0157370_101449521 | 219 |
| 245 | 3300013105 | Ga0157369_10383664 | Ga0157369_103836642 | 219 |
| 246 | 3300013307 | Ga0157372_10036173 | Ga0157372_100361733 | 219 |
| 247 | 3300020070 | Ga0206356_10496513 | Ga0206356_104965133 | 219 |
| 248 | 3300020082 | Ga0206353_10732351 | Ga0206353_107323513 | 219 |
| 249 | 3300022467 | Ga0224712_10096835 | Ga0224712_100968352 | 219 |
| 250 | 3300025292 | Ga0209676_1000052 | Ga0209676_1000052217 | 219 |
| 251 | 3300025321 | Ga0207656_10003660 | Ga0207656_100036604 | 219 |
| 252 | 3300025904 | Ga0207647_10000826 | Ga0207647_1000082617 | 219 |
| 253 | 3300025909 | Ga0207705_10000097 | Ga0207705_1000009778 | 219 |
| 254 | 3300025909 | Ga0207705_10000341 | Ga0207705_100003417 | 219 |
| 255 | 3300025911 | Ga0207654_10031408 | Ga0207654_100314083 | 219 |
| 256 | 3300025912 | Ga0207707_10001112 | Ga0207707_100011127 | 219 |
| 257 | 3300025913 | Ga0207695_10006652 | Ga0207695_100066526 | 219 |
| 258 | 3300025914 | Ga0207671_10143283 | Ga0207671_101432832 | 219 |
| 259 | 3300025917 | Ga0207660_10010377 | Ga0207660_100103777 | 219 |
| 260 | 3300025919 | Ga0207657_10002465 | Ga0207657_1000246510 | 219 |
| 261 | 3300025920 | Ga0207649_10006309 | Ga0207649_100063092 | 219 |
| 262 | 3300025921 | Ga0207652_10002969 | Ga0207652_100029697 | 219 |
| 263 | 3300025924 | Ga0207694_10012929 | Ga0207694_100129292 | 219 |
| 264 | 3300025932 | Ga0207690_10000122 | Ga0207690_1000012252 | 219 |
| 265 | 3300025933 | Ga0207706_10003801 | Ga0207706_100038018 | 219 |
| 266 | 3300025944 | Ga0207661_10007040 | Ga0207661_100070406 | 219 |
| 267 | 3300025949 | Ga0207667_10000683 | Ga0207667_1000068333 | 219 |
| 268 | 3300025972 | Ga0207668_10290936 | Ga0207668_102909362 | 219 |
| 269 | 3300025981 | Ga0207640_10062553 | Ga0207640_100625532 | 219 |
| 270 | 3300026041 | Ga0207639_10004441 | Ga0207639_100044414 | 219 |
| 271 | 3300026067 | Ga0207678_10002250 | Ga0207678_1000225015 | 219 |
| 272 | 3300026078 | Ga0207702_10012063 | Ga0207702_100120632 | 219 |
| 273 | 3300026116 | Ga0207674_10002322 | Ga0207674_1000232217 | 219 |
| 274 | 3300026118 | Ga0207675_100070634 | Ga0207675_1000706343 | 219 |
| 275 | 3300026142 | Ga0207698_10005406 | Ga0207698_100054065 | 219 |
| 276 | 3300028379 | Ga0268266_10080274 | Ga0268266_100802742 | 219 |
| 277 | 3300028794 | Ga0307515_10483712 | Ga0307515_104837122 | 219 |
| 278 | 3300031456 | Ga0307513_10146417 | Ga0307513_101464173 | 219 |
| 279 | 3300032004 | Ga0307414_10063368 | Ga0307414_100633683 | 219 |
| 280 | 3300037418 | Ga0395900_0424266 | Ga0395900_0424266_245_952 | 219 |
| 281 | 3300046507 | Ga0495606_0000918 | Ga0495606_0000918_10388_11104 | 219 |
| 282 | 3300046507 | Ga0495606_0000948 | Ga0495606_0000948_8630_9433 | 219 |
| 283 | 3300046515 | Ga0495620_0000565 | Ga0495620_0000565_13405_14208 | 219 |
| 284 | 3300047472 | Ga0495686_0004945 | Ga0495686_0004945_8893_9696 | 219 |
| 285 | 3300048917 | Ga0496114_0033133 | Ga0496114_0033133_2078_2737 | 219 |
| 286 | 3300048918 | Ga0496115_0000077 | Ga0496115_0000077_57108_57806 | 219 |
| 287 | 3300048924 | Ga0496121_0018990 | Ga0496121_0018990_4872_5675 | 219 |
| 288 | 3300048929 | Ga0496126_0000047 | Ga0496126_0000047_236776_237474 | 219 |
| 289 | 3300048929 | Ga0496126_0105791 | Ga0496126_0105791_1631_2290 | 219 |
| 290 | 3300049570 | Ga0501033_0000683 | Ga0501033_0000683_29537_30214 | 219 |
| 291 | 3300050491 | nmdc:mga00v17_2252_c1 | nmdc:mga00v17_2252_c1_1106_1765 | 219 |
| 292 | 3300053093 | Ga0500651_0034171 | Ga0500651_0034171_93_776 | 219 |
| 293 | 3300053730 | Ga0500645_000375 | Ga0500645_000375_16595_17356 | 219 |
| 294 | iso_pu_bacteria | 2734482264 | 2735835413 | 219 |
| 295 | 3300005341 | Ga0070691_10146967 | Ga0070691_101469672 | 220 |
| 296 | 3300005344 | Ga0070661_100063255 | Ga0070661_1000632552 | 220 |
| 297 | 3300005345 | Ga0070692_10014304 | Ga0070692_100143043 | 220 |
| 298 | 3300005367 | Ga0070667_100005400 | Ga0070667_10000540010 | 220 |
| 299 | 3300005367 | Ga0070667_100050689 | Ga0070667_1000506892 | 220 |
| 300 | 3300005367 | Ga0070667_100187140 | Ga0070667_1001871402 | 220 |
| 301 | 3300005455 | Ga0070663_100000042 | Ga0070663_1000000428 | 220 |
| 302 | 3300005455 | Ga0070663_100060983 | Ga0070663_1000609833 | 220 |
| 303 | 3300005539 | Ga0068853_100007213 | Ga0068853_1000072137 | 220 |
| 304 | 3300005539 | Ga0068853_100011114 | Ga0068853_1000111142 | 220 |
| 305 | 3300005547 | Ga0070693_100012299 | Ga0070693_1000122993 | 220 |
| 306 | 3300005548 | Ga0070665_100000028 | Ga0070665_100000028165 | 220 |
| 307 | 3300005548 | Ga0070665_100050597 | Ga0070665_1000505972 | 220 |
| 308 | 3300005548 | Ga0070665_100084459 | Ga0070665_1000844593 | 220 |
| 309 | 3300005548 | Ga0070665_100168154 | Ga0070665_1001681542 | 220 |
| 310 | 3300005563 | Ga0068855_100005951 | Ga0068855_1000059513 | 220 |
| 311 | 3300005563 | Ga0068855_100105650 | Ga0068855_1001056503 | 220 |
| 312 | 3300005577 | Ga0068857_100053558 | Ga0068857_1000535582 | 220 |
| 313 | 3300005577 | Ga0068857_100358917 | Ga0068857_1003589172 | 220 |
| 314 | 3300005578 | Ga0068854_100004688 | Ga0068854_1000046882 | 220 |
| 315 | 3300005616 | Ga0068852_100068716 | Ga0068852_1000687161 | 220 |
| 316 | 3300005616 | Ga0068852_100345615 | Ga0068852_1003456153 | 220 |
| 317 | 3300005617 | Ga0068859_100000280 | Ga0068859_10000028033 | 220 |
| 318 | 3300005841 | Ga0068863_100018882 | Ga0068863_1000188824 | 220 |
| 319 | 3300005841 | Ga0068863_100077761 | Ga0068863_1000777612 | 220 |
| 320 | 3300005844 | Ga0068862_100000215 | Ga0068862_10000021517 | 220 |
| 321 | 3300006931 | Ga0097620_100000280 | Ga0097620_10000028012 | 220 |
| 322 | 3300009101 | Ga0105247_10124470 | Ga0105247_101244702 | 220 |
| 323 | 3300009177 | Ga0105248_10000120 | Ga0105248_1000012040 | 220 |
| 324 | 3300009545 | Ga0105237_10010356 | Ga0105237_100103564 | 220 |
| 325 | 3300009553 | Ga0105249_10000898 | Ga0105249_1000089816 | 220 |
| 326 | 3300010375 | Ga0105239_10005391 | Ga0105239_100053913 | 220 |
| 327 | 3300013102 | Ga0157371_10057507 | Ga0157371_100575073 | 220 |
| 328 | 3300013105 | Ga0157369_10024352 | Ga0157369_100243522 | 220 |
| 329 | 3300013307 | Ga0157372_10013581 | Ga0157372_100135815 | 220 |
| 330 | 3300025900 | Ga0207710_10054171 | Ga0207710_100541712 | 220 |
| 331 | 3300025909 | Ga0207705_10000630 | Ga0207705_1000063019 | 220 |
| 332 | 3300025913 | Ga0207695_10002496 | Ga0207695_1000249621 | 220 |
| 333 | 3300025914 | Ga0207671_10007551 | Ga0207671_100075515 | 220 |
| 334 | 3300025919 | Ga0207657_10006390 | Ga0207657_100063902 | 220 |
| 335 | 3300025920 | Ga0207649_10705864 | Ga0207649_107058641 | 220 |
| 336 | 3300025932 | Ga0207690_10003069 | Ga0207690_1000306910 | 220 |
| 337 | 3300025932 | Ga0207690_10819681 | Ga0207690_108196811 | 220 |
| 338 | 3300025941 | Ga0207711_10010606 | Ga0207711_100106063 | 220 |
| 339 | 3300025949 | Ga0207667_10000623 | Ga0207667_1000062315 | 220 |
| 340 | 3300025949 | Ga0207667_10038594 | Ga0207667_100385942 | 220 |
| 341 | 3300025949 | Ga0207667_10049542 | Ga0207667_100495421 | 220 |
| 342 | 3300025961 | Ga0207712_10000305 | Ga0207712_1000030510 | 220 |
| 343 | 3300025961 | Ga0207712_10024220 | Ga0207712_100242203 | 220 |
| 344 | 3300025972 | Ga0207668_10017413 | Ga0207668_100174132 | 220 |
| 345 | 3300025981 | Ga0207640_10003436 | Ga0207640_100034365 | 220 |
| 346 | 3300025986 | Ga0207658_10000033 | Ga0207658_10000033115 | 220 |
| 347 | 3300025986 | Ga0207658_10009244 | Ga0207658_100092443 | 220 |
| 348 | 3300025986 | Ga0207658_10513082 | Ga0207658_105130822 | 220 |
| 349 | 3300025986 | Ga0207658_10805041 | Ga0207658_108050411 | 220 |
| 350 | 3300026041 | Ga0207639_10000437 | Ga0207639_1000043726 | 220 |
| 351 | 3300026041 | Ga0207639_10001917 | Ga0207639_100019175 | 220 |
| 352 | 3300026041 | Ga0207639_10019356 | Ga0207639_100193563 | 220 |
| 353 | 3300026067 | Ga0207678_10001678 | Ga0207678_100016789 | 220 |
| 354 | 3300026067 | Ga0207678_10002720 | Ga0207678_1000272016 | 220 |
| 355 | 3300026067 | Ga0207678_10094476 | Ga0207678_100944763 | 220 |
| 356 | 3300026088 | Ga0207641_10009512 | Ga0207641_100095127 | 220 |
| 357 | 3300026088 | Ga0207641_10060657 | Ga0207641_100606572 | 220 |
| 358 | 3300026142 | Ga0207698_10278447 | Ga0207698_102784472 | 220 |
| 359 | 3300028379 | Ga0268266_10000017 | Ga0268266_10000017309 | 220 |
| 360 | 3300028379 | Ga0268266_10042299 | Ga0268266_100422992 | 220 |
| 361 | 3300028379 | Ga0268266_10528461 | Ga0268266_105284611 | 220 |
| 362 | 3300028380 | Ga0268265_10000376 | Ga0268265_1000037617 | 220 |
| 363 | 3300031507 | Ga0307509_10154147 | Ga0307509_101541472 | 220 |
| 364 | 3300037418 | Ga0395900_0000163 | Ga0395900_0000163_36531_37238 | 220 |
| 365 | 3300041452 | Ga0451793_1023005 | Ga0451793_1023005_285_971 | 220 |
| 366 | 3300041486 | Ga0451807_0456601 | Ga0451807_0456601_428_1114 | 220 |
| 367 | 3300041494 | Ga0451837_0747194 | Ga0451837_0747194_847_1533 | 220 |
| 368 | 3300044658 | Ga0466972_0001414 | Ga0466972_0001414_6768_7454 | 220 |
| 369 | 3300044765 | Ga0466970_0001522 | Ga0466970_0001522_3745_4431 | 220 |
| 370 | 3300045049 | Ga0466959_0012881 | Ga0466959_0012881_3411_4097 | 220 |
| 371 | 3300047472 | Ga0495686_0004214 | Ga0495686_0004214_5835_6527 | 220 |
| 372 | 3300048917 | Ga0496114_0229627 | Ga0496114_0229627_442_1125 | 220 |
| 373 | 3300048925 | Ga0496122_0001517 | Ga0496122_0001517_28496_29188 | 220 |
| 374 | 3300048926 | Ga0496123_0000323 | Ga0496123_0000323_12118_12810 | 220 |
| 375 | 3300053079 | Ga0500610_0000365 | Ga0500610_0000365_9200_9886 | 220 |
| 376 | 3300053093 | Ga0500651_0006630 | Ga0500651_0006630_2251_2937 | 220 |
| 377 | 3300005455 | Ga0070663_100216615 | Ga0070663_1002166151 | 221 |
| 378 | 3300005458 | Ga0070681_10300998 | Ga0070681_103009982 | 221 |
| 379 | 3300005548 | Ga0070665_100412820 | Ga0070665_1004128202 | 221 |
| 380 | 3300025921 | Ga0207652_10490868 | Ga0207652_104908682 | 221 |
| 381 | 3300026067 | Ga0207678_10066322 | Ga0207678_100663221 | 221 |
| 382 | 3300028379 | Ga0268266_10233736 | Ga0268266_102337362 | 221 |
| 383 | 3300041451 | Ga0451791_0862441 | Ga0451791_0862441_512_1183 | 221 |
| 384 | 3300041460 | Ga0451802_1110374 | Ga0451802_1110374_3993_4664 | 221 |
| 385 | 3300041486 | Ga0451807_0337638 | Ga0451807_0337638_125_796 | 221 |
| 386 | 3300041494 | Ga0451837_1713807 | Ga0451837_1713807_362_1033 | 221 |
| 387 | 3300042007 | Ga0439449_0020377 | Ga0439449_0020377_704_1375 | 221 |
| 388 | 3300046513 | Ga0495616_0100842 | Ga0495616_0100842_316_987 | 221 |
| 389 | 3300046525 | Ga0495663_0001434 | Ga0495663_0001434_5770_6441 | 221 |
| 390 | 3300046692 | Ga0495671_0005538 | Ga0495671_0005538_969_1640 | 221 |
| 391 | 3300048911 | Ga0496108_0319897 | Ga0496108_0319897_502_1200 | 221 |
| 392 | 3300048926 | Ga0496123_0160107 | Ga0496123_0160107_410_1081 | 221 |
| 393 | 3300049571 | Ga0501034_0083756 | Ga0501034_0083756_656_1342 | 221 |
| 394 | 3300049574 | Ga0501038_0106607 | Ga0501038_0106607_1116_1802 | 221 |
| 395 | 3300049580 | Ga0501046_0039025 | Ga0501046_0039025_805_1491 | 221 |
| 396 | 3300049581 | Ga0501047_0029824 | Ga0501047_0029824_1913_2599 | 221 |
| 397 | 3300049586 | Ga0501070_0265574 | Ga0501070_0265574_69_755 | 221 |
| 398 | 3300049589 | Ga0501073_0319438 | Ga0501073_0319438_174_872 | 221 |
| 399 | 3300049741 | Ga0501079_0260668 | Ga0501079_0260668_33_719 | 221 |
| 400 | 3300049823 | Ga0501044_0066121 | Ga0501044_0066121_2974_3672 | 221 |
| 401 | 3300049823 | Ga0501044_0118517 | Ga0501044_0118517_1577_2263 | 221 |
| 402 | 3300053139 | Ga0500568_0000233 | Ga0500568_0000233_24657_25343 | 221 |
| 403 | 3300053731 | Ga0500609_012751 | Ga0500609_012751_426_1097 | 221 |
| 404 | 3300060353 | Ga0501082_0000107 | Ga0501082_0000107_12407_13093 | 221 |
| 405 | 3300001904 | JGI24736J21556_1000668 | JGI24736J21556_10006682 | 222 |
| 406 | 3300001915 | JGI24741J21665_1000513 | JGI24741J21665_10005139 | 222 |
| 407 | 3300001979 | JGI24740J21852_10000733 | JGI24740J21852_100007339 | 222 |
| 408 | 3300005329 | Ga0070683_100148995 | Ga0070683_1001489951 | 222 |
| 409 | 3300005355 | Ga0070671_100045193 | Ga0070671_1000451933 | 222 |
| 410 | 3300005367 | Ga0070667_100041398 | Ga0070667_1000413983 | 222 |
| 411 | 3300005458 | Ga0070681_10009167 | Ga0070681_100091673 | 222 |
| 412 | 3300005458 | Ga0070681_10754860 | Ga0070681_107548601 | 222 |
| 413 | 3300005530 | Ga0070679_100164520 | Ga0070679_1001645204 | 222 |
| 414 | 3300005530 | Ga0070679_100819986 | Ga0070679_1008199861 | 222 |
| 415 | 3300005535 | Ga0070684_100048363 | Ga0070684_1000483633 | 222 |
| 416 | 3300005535 | Ga0070684_100152602 | Ga0070684_1001526023 | 222 |
| 417 | 3300005539 | Ga0068853_100047267 | Ga0068853_1000472674 | 222 |
| 418 | 3300005548 | Ga0070665_100219067 | Ga0070665_1002190672 | 222 |
| 419 | 3300005563 | Ga0068855_100384484 | Ga0068855_1003844842 | 222 |
| 420 | 3300005564 | Ga0070664_100023351 | Ga0070664_1000233515 | 222 |
| 421 | 3300005564 | Ga0070664_100203877 | Ga0070664_1002038772 | 222 |
| 422 | 3300005577 | Ga0068857_100182944 | Ga0068857_1001829443 | 222 |
| 423 | 3300005578 | Ga0068854_100024611 | Ga0068854_1000246115 | 222 |
| 424 | 3300005616 | Ga0068852_100082660 | Ga0068852_1000826602 | 222 |
| 425 | 3300005834 | Ga0068851_10035589 | Ga0068851_100355893 | 222 |
| 426 | 3300005841 | Ga0068863_100240960 | Ga0068863_1002409603 | 222 |
| 427 | 3300006237 | Ga0097621_100206800 | Ga0097621_1002068004 | 222 |
| 428 | 3300006358 | Ga0068871_100039983 | Ga0068871_1000399833 | 222 |
| 429 | 3300006358 | Ga0068871_100199111 | Ga0068871_1001991111 | 222 |
| 430 | 3300006358 | Ga0068871_100215267 | Ga0068871_1002152672 | 222 |
| 431 | 3300009176 | Ga0105242_10675965 | Ga0105242_106759652 | 222 |
| 432 | 3300009177 | Ga0105248_10309656 | Ga0105248_103096563 | 222 |
| 433 | 3300009551 | Ga0105238_10110821 | Ga0105238_101108213 | 222 |
| 434 | 3300010375 | Ga0105239_10107680 | Ga0105239_101076801 | 222 |
| 435 | 3300013102 | Ga0157371_10190065 | Ga0157371_101900652 | 222 |
| 436 | 3300013296 | Ga0157374_10625115 | Ga0157374_106251151 | 222 |
| 437 | 3300013307 | Ga0157372_10051825 | Ga0157372_100518253 | 222 |
| 438 | 3300013307 | Ga0157372_10057810 | Ga0157372_100578103 | 222 |
| 439 | 3300014969 | Ga0157376_10002494 | Ga0157376_100024943 | 222 |
| 440 | 3300020070 | Ga0206356_11576430 | Ga0206356_115764302 | 222 |
| 441 | 3300025903 | Ga0207680_10180954 | Ga0207680_101809542 | 222 |
| 442 | 3300025904 | Ga0207647_10003112 | Ga0207647_100031122 | 222 |
| 443 | 3300025904 | Ga0207647_10138743 | Ga0207647_101387431 | 222 |
| 444 | 3300025909 | Ga0207705_10002108 | Ga0207705_100021087 | 222 |
| 445 | 3300025912 | Ga0207707_10000065 | Ga0207707_1000006593 | 222 |
| 446 | 3300025912 | Ga0207707_10000578 | Ga0207707_100005783 | 222 |
| 447 | 3300025914 | Ga0207671_10249251 | Ga0207671_102492513 | 222 |
| 448 | 3300025917 | Ga0207660_10006903 | Ga0207660_100069037 | 222 |
| 449 | 3300025917 | Ga0207660_10184679 | Ga0207660_101846791 | 222 |
| 450 | 3300025919 | Ga0207657_10256498 | Ga0207657_102564982 | 222 |
| 451 | 3300025919 | Ga0207657_10483215 | Ga0207657_104832151 | 222 |
| 452 | 3300025921 | Ga0207652_10069249 | Ga0207652_100692491 | 222 |
| 453 | 3300025921 | Ga0207652_10378129 | Ga0207652_103781292 | 222 |
| 454 | 3300025925 | Ga0207650_10328626 | Ga0207650_103286261 | 222 |
| 455 | 3300025933 | Ga0207706_10316978 | Ga0207706_103169782 | 222 |
| 456 | 3300025944 | Ga0207661_10266777 | Ga0207661_102667773 | 222 |
| 457 | 3300025944 | Ga0207661_10289978 | Ga0207661_102899783 | 222 |
| 458 | 3300025945 | Ga0207679_10026576 | Ga0207679_100265763 | 222 |
| 459 | 3300025949 | Ga0207667_10008297 | Ga0207667_100082978 | 222 |
| 460 | 3300025960 | Ga0207651_10070326 | Ga0207651_100703262 | 222 |
| 461 | 3300025981 | Ga0207640_10002592 | Ga0207640_1000259210 | 222 |
| 462 | 3300025981 | Ga0207640_10053751 | Ga0207640_100537513 | 222 |
| 463 | 3300025981 | Ga0207640_10135130 | Ga0207640_101351301 | 222 |
| 464 | 3300026023 | Ga0207677_10008057 | Ga0207677_100080575 | 222 |
| 465 | 3300026041 | Ga0207639_10007675 | Ga0207639_100076753 | 222 |
| 466 | 3300026116 | Ga0207674_10008726 | Ga0207674_100087267 | 222 |
| 467 | 3300026116 | Ga0207674_10049463 | Ga0207674_100494632 | 222 |
| 468 | 3300026142 | Ga0207698_10079744 | Ga0207698_100797443 | 222 |
| 469 | 3300026142 | Ga0207698_10121696 | Ga0207698_101216961 | 222 |
| 470 | 3300041406 | Ga0439439_0014291 | Ga0439439_0014291_359_1045 | 222 |
| 471 | 3300042004 | Ga0439445_0014309 | Ga0439445_0014309_886_1572 | 222 |
| 472 | 3300049573 | Ga0501037_0378757 | Ga0501037_0378757_99_836 | 222 |
| 473 | 3300049589 | Ga0501073_0021629 | Ga0501073_0021629_1305_2042 | 222 |
| 474 | 3300049822 | Ga0501035_0160760 | Ga0501035_0160760_910_1647 | 222 |
| 475 | iso_pu_bacteria | 8003014200 | 8003015465 | 222 |
| 476 | 3300003187 | JGI25151J46595_10000102 | JGI25151J46595_100001025 | 223 |
| 477 | 3300005355 | Ga0070671_100069039 | Ga0070671_1000690394 | 223 |
| 478 | 3300005548 | Ga0070665_100832480 | Ga0070665_1008324802 | 223 |
| 479 | 3300025245 | Ga0207425_1010986 | Ga0207425_10109861 | 223 |
| 480 | 3300025294 | Ga0209025_1000006 | Ga0209025_1000006653 | 223 |
| 481 | 3300025297 | Ga0209758_1006577 | Ga0209758_10065774 | 223 |
| 482 | 3300025920 | Ga0207649_10385596 | Ga0207649_103855961 | 223 |
| 483 | 3300025931 | Ga0207644_10017204 | Ga0207644_100172043 | 223 |
| 484 | 3300025933 | Ga0207706_10795698 | Ga0207706_107956981 | 223 |
| 485 | 3300028379 | Ga0268266_10688073 | Ga0268266_106880731 | 223 |
| 486 | 3300031901 | Ga0307406_10003433 | Ga0307406_100034334 | 223 |
| 487 | 3300041407 | Ga0439447_000276 | Ga0439447_000276_9916_10599 | 223 |
| 488 | 3300046616 | Ga0495668_0002964 | Ga0495668_0002964_12192_12875 | 223 |
| 489 | 3300048912 | Ga0496109_0074224 | Ga0496109_0074224_1597_2271 | 223 |
| 490 | 3300048915 | Ga0496112_0501297 | Ga0496112_0501297_101_775 | 223 |
| 491 | 3300048916 | Ga0496113_0071099 | Ga0496113_0071099_337_1011 | 223 |
| 492 | iso_pu_bacteria | 2643221573 | 2643880455 | 223 |
| 493 | iso_pu_bacteria | 2643221593 | 2643973376 | 223 |
| 494 | iso_pu_bacteria | 2643221720 | 2644661030 | 223 |
| 495 | iso_pu_bacteria | 2643221728 | 2644699112 | 223 |
| 496 | 3300002741 | JGI25157J39369_1005706 | JGI25157J39369_10057062 | 224 |
| 497 | 3300003773 | Ga0055537_1000059 | Ga0055537_100005914 | 224 |
| 498 | 3300003775 | Ga0055524_1000019 | Ga0055524_1000019197 | 224 |
| 499 | 3300003784 | Ga0055534_1000012 | Ga0055534_100001219 | 224 |
| 500 | 3300003790 | Ga0055528_1000007 | Ga0055528_100000719 | 224 |
| 501 | 3300015265 | Ga0182005_1002582 | Ga0182005_10025823 | 224 |
| 502 | 3300025250 | Ga0209026_1000045 | Ga0209026_100004518 | 224 |
| 503 | 3300025256 | Ga0209759_1000850 | Ga0209759_100085010 | 224 |
| 504 | 3300025263 | Ga0209565_1000001 | Ga0209565_1000001438 | 224 |
| 505 | 3300025273 | Ga0209673_1000001 | Ga0209673_1000001438 | 224 |
| 506 | 3300025291 | Ga0209675_1000001 | Ga0209675_10000012094 | 224 |
| 507 | 3300025295 | Ga0209564_1000001 | Ga0209564_10000012256 | 224 |
| 508 | 3300025299 | Ga0209256_1000006 | Ga0209256_1000006692 | 224 |
| 509 | 3300031665 | Ga0316575_10014957 | Ga0316575_100149573 | 224 |
| 510 | 3300044536 | Ga0466988_0067231 | Ga0466988_0067231_848_1552 | 224 |
| 511 | 3300046615 | Ga0495656_0003859 | Ga0495656_0003859_3437_4123 | 224 |
| 512 | 3300047318 | Ga0495636_0006456 | Ga0495636_0006456_2343_3029 | 224 |
| 513 | 3300049568 | Ga0501031_0060029 | Ga0501031_0060029_1786_2466 | 224 |
| 514 | 3300049570 | Ga0501033_0120810 | Ga0501033_0120810_204_884 | 224 |
| 515 | 3300049572 | Ga0501036_0098252 | Ga0501036_0098252_1623_2303 | 224 |
| 516 | 3300049573 | Ga0501037_0067090 | Ga0501037_0067090_953_1633 | 224 |
| 517 | 3300049574 | Ga0501038_0390874 | Ga0501038_0390874_285_965 | 224 |
| 518 | 3300049575 | Ga0501039_0109320 | Ga0501039_0109320_1105_1785 | 224 |
| 519 | 3300049586 | Ga0501070_0053490 | Ga0501070_0053490_980_1660 | 224 |
| 520 | 3300049762 | Ga0501265_008607 | Ga0501265_008607_66_785 | 224 |
| 521 | 3300049772 | Ga0501275_000512 | Ga0501275_000512_3212_3931 | 224 |
| 522 | 3300049822 | Ga0501035_0013478 | Ga0501035_0013478_2563_3243 | 224 |
| 523 | 3300061719 | Ga0466962_0012963 | Ga0466962_0012963_204_908 | 224 |
| 524 | 3300005535 | Ga0070684_100585753 | Ga0070684_1005857532 | 225 |
| 525 | 3300005539 | Ga0068853_100020141 | Ga0068853_1000201412 | 225 |
| 526 | 3300005563 | Ga0068855_100640412 | Ga0068855_1006404122 | 225 |
| 527 | 3300005578 | Ga0068854_100546565 | Ga0068854_1005465651 | 225 |
| 528 | 3300025893 | Ga0207682_10063268 | Ga0207682_100632684 | 225 |
| 529 | 3300025907 | Ga0207645_10106425 | Ga0207645_101064252 | 225 |
| 530 | 3300025944 | Ga0207661_10071965 | Ga0207661_100719654 | 225 |
| 531 | 3300026088 | Ga0207641_10221528 | Ga0207641_102215283 | 225 |
| 532 | 3300026089 | Ga0207648_10071014 | Ga0207648_100710143 | 225 |
| 533 | 3300005331 | Ga0070670_100510566 | Ga0070670_1005105662 | 226 |
| 534 | 3300005458 | Ga0070681_10191941 | Ga0070681_101919413 | 226 |
| 535 | 3300025913 | Ga0207695_10015003 | Ga0207695_100150033 | 226 |
| 536 | 3300025940 | Ga0207691_10019067 | Ga0207691_100190678 | 226 |
| 537 | 3300031995 | Ga0307409_100899672 | Ga0307409_1008996721 | 226 |
| 538 | 3300032004 | Ga0307414_10170466 | Ga0307414_101704662 | 226 |
| 539 | 3300046537 | Ga0495598_0075565 | Ga0495598_0075565_70_792 | 226 |
| 540 | 3300046539 | Ga0495621_0001934 | Ga0495621_0001934_4173_4895 | 226 |
| 541 | 3300046615 | Ga0495656_0006771 | Ga0495656_0006771_121_819 | 226 |
| 542 | 3300046691 | Ga0495670_0236149 | Ga0495670_0236149_47_769 | 226 |
| 543 | 3300048090 | Ga0495615_0003458 | Ga0495615_0003458_1793_2515 | 226 |
| 544 | 3300049569 | Ga0501032_0085227 | Ga0501032_0085227_747_1469 | 226 |
| 545 | 3300049570 | Ga0501033_0000648 | Ga0501033_0000648_1481_2191 | 226 |
| 546 | 3300049570 | Ga0501033_0137547 | Ga0501033_0137547_666_1388 | 226 |
| 547 | 3300049571 | Ga0501034_0300286 | Ga0501034_0300286_354_1064 | 226 |
| 548 | 3300049572 | Ga0501036_0008180 | Ga0501036_0008180_762_1472 | 226 |
| 549 | 3300049573 | Ga0501037_0127846 | Ga0501037_0127846_552_1262 | 226 |
| 550 | 3300049574 | Ga0501038_0054955 | Ga0501038_0054955_2360_3070 | 226 |
| 551 | 3300049574 | Ga0501038_0187968 | Ga0501038_0187968_745_1467 | 226 |
| 552 | 3300049579 | Ga0501043_0016644 | Ga0501043_0016644_325_1035 | 226 |
| 553 | 3300049579 | Ga0501043_0100193 | Ga0501043_0100193_802_1524 | 226 |
| 554 | 3300049580 | Ga0501046_0048382 | Ga0501046_0048382_2495_3205 | 226 |
| 555 | 3300049580 | Ga0501046_0094391 | Ga0501046_0094391_662_1372 | 226 |
| 556 | 3300049581 | Ga0501047_0196976 | Ga0501047_0196976_788_1510 | 226 |
| 557 | 3300049581 | Ga0501047_0261424 | Ga0501047_0261424_450_1160 | 226 |
| 558 | 3300049584 | Ga0501068_0041232 | Ga0501068_0041232_638_1360 | 226 |
| 559 | 3300049584 | Ga0501068_0305055 | Ga0501068_0305055_147_857 | 226 |
| 560 | 3300049586 | Ga0501070_0100683 | Ga0501070_0100683_668_1390 | 226 |
| 561 | 3300049586 | Ga0501070_0254009 | Ga0501070_0254009_375_1085 | 226 |
| 562 | 3300049589 | Ga0501073_0094089 | Ga0501073_0094089_717_1439 | 226 |
| 563 | 3300049589 | Ga0501073_0186270 | Ga0501073_0186270_353_1063 | 226 |
| 564 | 3300049590 | Ga0501074_0050760 | Ga0501074_0050760_1304_2014 | 226 |
| 565 | 3300049741 | Ga0501079_0055881 | Ga0501079_0055881_1339_2049 | 226 |
| 566 | 3300049742 | Ga0501080_0309982 | Ga0501080_0309982_368_1078 | 226 |
| 567 | 3300049744 | Ga0501083_0117151 | Ga0501083_0117151_35_745 | 226 |
| 568 | 3300049822 | Ga0501035_0156946 | Ga0501035_0156946_515_1237 | 226 |
| 569 | 3300049822 | Ga0501035_0785746 | Ga0501035_0785746_27_737 | 226 |
| 570 | 3300049823 | Ga0501044_0004071 | Ga0501044_0004071_9623_10333 | 226 |
| 571 | 3300049823 | Ga0501044_0155242 | Ga0501044_0155242_745_1467 | 226 |
| 572 | 3300005288 | Ga0065714_10073865 | Ga0065714_100738655 | 227 |
| 573 | 3300005293 | Ga0065715_10210857 | Ga0065715_102108573 | 227 |
| 574 | 3300027876 | Ga0209974_10040660 | Ga0209974_100406603 | 227 |
| 575 | 3300037466 | Ga0395898_0812526 | Ga0395898_0812526_50_763 | 227 |
| 576 | 3300044684 | Ga0466966_0043419 | Ga0466966_0043419_2072_2812 | 227 |
| 577 | 3300044765 | Ga0466970_0342560 | Ga0466970_0342560_68_808 | 227 |
| 578 | 3300045049 | Ga0466959_0030265 | Ga0466959_0030265_2474_3214 | 227 |
| 579 | 3300045836 | Ga0466958_0289006 | Ga0466958_0289006_56_796 | 227 |
| 580 | 3300013100 | Ga0157373_10012798 | Ga0157373_100127985 | 228 |
| 581 | 3300037471 | Ga0395905_0246134 | Ga0395905_0246134_712_1437 | 228 |
| 582 | iso_pu_bacteria | 2576861471 | 2578456967 | 228 |
| 583 | iso_pu_bacteria | 2857442823 | 2857447000 | 228 |
| 584 | iso_pu_bacteria | 2939589442 | 2939589840 | 228 |
| 585 | iso_pu_bacteria | 2939622612 | 2939624953 | 228 |
| 586 | iso_pu_bacteria | 2974307012 | 2974307615 | 228 |
| 587 | iso_pu_bacteria | 2977247770 | 2977248326 | 228 |
| 588 | iso_pu_bacteria | 2984514374 | 2984517181 | 228 |
| 589 | iso_pu_bacteria | 2987605356 | 2987608827 | 228 |
| 590 | 3300048926 | Ga0496123_0005271 | Ga0496123_0005271_340_1032 | 229 |
| 591 | iso_pu_bacteria | 2547132130 | 2547503589 | 229 |
| 592 | iso_pu_bacteria | 2747842428 | 2747949943 | 229 |
| 593 | iso_pu_bacteria | 2765235840 | 2765580539 | 229 |
| 594 | iso_pu_bacteria | 2816332141 | 2816518437 | 229 |
| 595 | iso_pu_bacteria | 2842391507 | 2842394454 | 229 |
| 596 | iso_pu_bacteria | 2919134579 | 2919138752 | 229 |
| 597 | iso_pu_bacteria | 2961064222 | 2961064871 | 229 |
| 598 | 3300048929 | Ga0496126_0297614 | Ga0496126_0297614_299_1012 | 230 |
| 599 | 3300032004 | Ga0307414_10322283 | Ga0307414_103222832 | 231 |
| 600 | iso_pu_bacteria | 8021648035 | 8021649751 | 231 |
| 601 | 3300003771 | Ga0055526_1006479 | Ga0055526_10064795 | 232 |
| 602 | 3300003773 | Ga0055537_1001365 | Ga0055537_10013659 | 232 |
| 603 | 3300003781 | Ga0055536_1018818 | Ga0055536_10188181 | 232 |
| 604 | 3300003784 | Ga0055534_1000112 | Ga0055534_10001122 | 232 |
| 605 | 3300003790 | Ga0055528_1001337 | Ga0055528_10013373 | 232 |
| 606 | 3300003791 | Ga0055530_10001674 | Ga0055530_1000167411 | 232 |
| 607 | 3300003791 | Ga0055530_10002094 | Ga0055530_1000209413 | 232 |
| 608 | 3300003794 | Ga0055531_10013881 | Ga0055531_100138814 | 232 |
| 609 | 3300003794 | Ga0055531_10024818 | Ga0055531_100248181 | 232 |
| 610 | 3300014497 | Ga0182008_10029210 | Ga0182008_100292102 | 232 |
| 611 | 3300015261 | Ga0182006_1053246 | Ga0182006_10532462 | 232 |
| 612 | 3300017792 | Ga0163161_10073490 | Ga0163161_100734903 | 232 |
| 613 | 3300025263 | Ga0209565_1000060 | Ga0209565_1000060120 | 232 |
| 614 | 3300025273 | Ga0209673_1000047 | Ga0209673_100004742 | 232 |
| 615 | 3300025291 | Ga0209675_1000007 | Ga0209675_1000007560 | 232 |
| 616 | 3300025295 | Ga0209564_1000252 | Ga0209564_100025219 | 232 |
| 617 | 3300025298 | Ga0209050_1000146 | Ga0209050_100014615 | 232 |
| 618 | 3300025304 | Ga0209257_1010878 | Ga0209257_10108782 | 232 |
| 619 | 3300030735 | Ga0316178_1024454 | Ga0316178_10244542 | 232 |
| 620 | 3300030742 | Ga0316183_1013189 | Ga0316183_10131892 | 232 |
| 621 | 3300042006 | Ga0439432_030801 | Ga0439432_030801_705_1412 | 232 |
| 622 | 3300046453 | Ga0495627_018790 | Ga0495627_018790_1292_1999 | 232 |
| 623 | 3300046512 | Ga0495610_0004897 | Ga0495610_0004897_527_1234 | 232 |
| 624 | 3300046518 | Ga0495631_0003548 | Ga0495631_0003548_6508_7215 | 232 |
| 625 | 3300046522 | Ga0495643_0010311 | Ga0495643_0010311_1999_2706 | 232 |
| 626 | 3300046660 | Ga0495625_0107781 | Ga0495625_0107781_70_777 | 232 |
| 627 | 3300046810 | Ga0495660_0026804 | Ga0495660_0026804_386_1093 | 232 |
| 628 | 3300047320 | Ga0495672_0000087 | Ga0495672_0000087_10727_11434 | 232 |
| 629 | 3300047320 | Ga0495672_0055159 | Ga0495672_0055159_624_1331 | 232 |
| 630 | 3300047472 | Ga0495686_0038417 | Ga0495686_0038417_1155_1862 | 232 |
| 631 | 3300048920 | Ga0496117_0028737 | Ga0496117_0028737_1104_1811 | 232 |
| 632 | 3300048920 | Ga0496117_0034057 | Ga0496117_0034057_892_1599 | 232 |
| 633 | 3300048921 | Ga0496118_0035939 | Ga0496118_0035939_1046_1753 | 232 |
| 634 | 3300048921 | Ga0496118_0056691 | Ga0496118_0056691_1691_2398 | 232 |
| 635 | 3300048927 | Ga0496124_0038566 | Ga0496124_0038566_2097_2804 | 232 |
| 636 | 3300048928 | Ga0496125_0077822 | Ga0496125_0077822_1056_1763 | 232 |
| 637 | 3300048929 | Ga0496126_0176797 | Ga0496126_0176797_1036_1743 | 232 |
| 638 | 3300050491 | nmdc:mga00v17_153920_c1 | nmdc:mga00v17_153920_c1_17_724 | 232 |
| 639 | 3300003323 | rootH1_10132375 | rootH1_101323752 | 233 |
| 640 | 3300003794 | Ga0055531_10025507 | Ga0055531_100255071 | 233 |
| 641 | 3300005985 | Ga0081539_10008186 | Ga0081539_100081868 | 233 |
| 642 | 3300025284 | Ga0209130_1014021 | Ga0209130_10140212 | 233 |
| 643 | 3300025299 | Ga0209256_1005932 | Ga0209256_10059324 | 233 |
| 644 | 3300025901 | Ga0207688_10169944 | Ga0207688_101699442 | 233 |
| 645 | 3300027312 | Ga0209371_1000018 | Ga0209371_1000018534 | 233 |
| 646 | 3300030500 | Ga0268256_1000016 | Ga0268256_1000016534 | 233 |
| 647 | iso_pu_bacteria | 2818991457 | 2819661328 | 233 |
| 648 | iso_pu_bacteria | 2852684882 | 2852687199 | 233 |
| 649 | iso_pu_bacteria | 2919130084 | 2919131044 | 233 |
| 650 | iso_pu_bacteria | 2929195423 | 2929196283 | 233 |
| 651 | 3300049571 | Ga0501034_0065145 | Ga0501034_0065145_2539_3282 | 236 |
| 652 | 3300049572 | Ga0501036_0031163 | Ga0501036_0031163_2638_3381 | 236 |
| 653 | 3300049573 | Ga0501037_0010898 | Ga0501037_0010898_4887_5630 | 236 |
| 654 | 3300049574 | Ga0501038_0049526 | Ga0501038_0049526_698_1441 | 236 |
| 655 | 3300049581 | Ga0501047_0082079 | Ga0501047_0082079_1427_2170 | 236 |
| 656 | 3300049586 | Ga0501070_0028917 | Ga0501070_0028917_22_765 | 236 |
| 657 | 3300049822 | Ga0501035_0062096 | Ga0501035_0062096_1334_2077 | 236 |
| 658 | 3300049823 | Ga0501044_0017726 | Ga0501044_0017726_1144_1887 | 236 |
| 659 | 2162886007 | SwRhRL2b_contig_1900888 | SwRhRL2b_0158.00007100 | 237 |
| 660 | 3300005331 | Ga0070670_100001962 | Ga0070670_1000019627 | 237 |
| 661 | 3300009011 | Ga0105251_10000205 | Ga0105251_100002057 | 237 |
| 662 | 3300025735 | Ga0207713_1000196 | Ga0207713_100019626 | 237 |
| 663 | 3300025925 | Ga0207650_10001926 | Ga0207650_100019266 | 237 |
| 664 | 3300041459 | Ga0451800_0141867 | Ga0451800_0141867_3309_4028 | 237 |
| 665 | 3300041462 | Ga0451806_117351 | Ga0451806_117351_3105_3824 | 237 |
| 666 | 3300041486 | Ga0451807_1394303 | Ga0451807_1394303_1434_2153 | 237 |
| 667 | 3300048920 | Ga0496117_0009829 | Ga0496117_0009829_7485_8198 | 237 |
| 668 | 3300048921 | Ga0496118_0183806 | Ga0496118_0183806_84_797 | 237 |
| 669 | 3300048922 | Ga0496119_0001836 | Ga0496119_0001836_21371_22084 | 237 |
| 670 | 3300048923 | Ga0496120_0000273 | Ga0496120_0000273_63612_64325 | 237 |
| 671 | 3300048925 | Ga0496122_0000417 | Ga0496122_0000417_73631_74344 | 237 |
| 672 | 3300048926 | Ga0496123_0000137 | Ga0496123_0000137_129022_129735 | 237 |
| 673 | 3300048927 | Ga0496124_0003391 | Ga0496124_0003391_16102_16815 | 237 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2qhv-assembly1.cif.gz_A | structural basis of octanoic acid recognition by lipoate-protein ligase b | 0.9035 | 20 | 225 |
| 1w66-assembly1.cif.gz_A | structure of a lipoate-protein ligase b from mycobacterium tuberculosis | 0.9011 | 21 | 220 |
| 2qhv-assembly1.cif.gz_A | structural basis of octanoic acid recognition by lipoate-protein ligase b | 0.8829 | 20 | 225 |
| 2aru-assembly1.cif.gz_A | crystal structure of lipoate-protein ligase a bound with atp | 0.8271 | 20 | 228 |
| 1w66-assembly1.cif.gz_A | structure of a lipoate-protein ligase b from mycobacterium tuberculosis | 0.8267 | 21 | 220 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P60720_2_203_3.30.930.10 | Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 | 0.9822 | 21 | 217 | 3.30.930.10 |
| af_P60720_2_203_3.30.930.10 | Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 | 0.9535 | 21 | 217 | 3.30.930.10 |
| af_Q9SXP7_6_215_3.30.930.10 | Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 | 0.9468 | 21 | 218 | 3.30.930.10 |
| 2qhuA01 | Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 | 0.9243 | 21 | 219 | 3.30.930.10 |
| af_O36017_5_216_3.30.930.10 | Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 | 0.9214 | 30 | 217 | 3.30.930.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3B0VSD3-F1-model_v4 | lipoyl(octanoyl) transferase (EC 2.3.1.181) | 0.9952 | 20 | 108 |
GO:0033819
|
| AF-A0A3D3D3L3-F1-model_v4 | deleted | 0.9931 | 22 | 99 |
|
| AF-A0A090P1B0-F1-model_v4 | deleted | 0.9919 | 21 | 139 |
|
| AF-A0A2J0QT14-F1-model_v4 | deleted | 0.9916 | 76 | 181 |
|
| AF-A0A7Z7KMB8-F1-model_v4 | deleted | 0.9907 | 21 | 104 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar