F474274

General Info

Members Datasets Scaffolds Average Seq Length
673 322 647 231

Family's Representative Sequence

Representative Sequence 3300001904|JGI24736J21556_1000668|JGI24736J21556_10006682
Length 269
Sequence MHAPNLTPFGMKGVDASASGGCPVAKEPSPLALRARSLRSALRAEGGSHEPGHLPLLVRHLGRQLYEPVWHAMQAFTDARGPDTPDELWLVEHDPVFTLGQAGKPEHVLAAGDIPVIHVDRGGQVTYHGPGQIVAYPLLDLRRLKIGVRELVRRIEQSIIDTLAEWNIVAARREGAPGVYAGEAKIAALGLRVRHGCTFHGLAFNVAMDLEPFHRINPCGYAGLQVAQMLDLGGPSRLADVEEVLVAELGRQFGLSPQDAEPALPRAAA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
3 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
4 2643221573 Lysobacter sp. Root604 Isolate Unclassified
5 2643221593 Lysobacter sp. Root690 Isolate Unclassified
6 2643221720 Lysobacter sp. Root916 Isolate Unclassified
7 2643221728 Lysobacter sp. Root983 Isolate Unclassified
8 2734482264 Dyella sp. AD052 Isolate Unclassified
9 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
10 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
11 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
12 2818991457 Xanthomonas translucens 569 Isolate Unclassified
13 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
14 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
15 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
16 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
17 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
18 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
19 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
20 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
21 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
22 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
23 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
24 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
25 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
26 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
27 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
28 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
29 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
30 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
31 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
32 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
33 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
34 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
35 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
36 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
37 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
38 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
39 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
40 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
41 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
42 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
43 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
44 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
45 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
46 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
47 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
48 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
49 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
50 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
51 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
52 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
53 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
54 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
55 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
56 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
57 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
58 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
59 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
60 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
61 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
62 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
63 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
64 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
65 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
66 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
67 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
68 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
69 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
70 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
71 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
72 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
73 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
74 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
75 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
76 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
77 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
78 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
79 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
80 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
81 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
82 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
83 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
84 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
85 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
86 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
87 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
88 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
89 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
90 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
92 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
106 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
107 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
108 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
109 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
110 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
111 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
112 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
113 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
114 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
115 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
119 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
120 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
121 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
129 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
130 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
133 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
134 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
136 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
137 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
140 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
141 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
142 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
144 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
199 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
200 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
201 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
202 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
203 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
204 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
205 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
206 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
207 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
208 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
209 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
210 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
211 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
212 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
213 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
214 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
215 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
216 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
217 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
218 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
219 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
220 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
221 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
222 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
223 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
224 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
225 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
226 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
227 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
228 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
229 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
230 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
231 3300044536 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E Metagenome Unclassified
232 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
233 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
234 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
235 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
236 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
237 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
238 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
239 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
240 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
241 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
242 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
243 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
244 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
245 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
246 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
247 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
248 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
249 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
250 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
251 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
252 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
253 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
254 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
255 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
256 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
257 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
258 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
259 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
260 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
261 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
262 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
263 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
264 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
265 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
266 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
267 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
268 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
269 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
270 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
271 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
272 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
273 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
274 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
275 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
276 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
277 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
278 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
279 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
280 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
281 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
282 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
283 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
288 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
294 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
295 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
296 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
297 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
298 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
299 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
300 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
301 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
302 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
303 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
304 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
305 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
306 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
307 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
308 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
309 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
310 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
311 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
312 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
313 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
314 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
315 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
316 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
317 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
318 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
319 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
320 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
321 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
322 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.39
Metatranscriptomes 0.74
Isolates 3.86

Biome Distribution

Category Percentage (%)
Aerial Root 0.15
Bulb 0
Endosphere 9.51
Nodule 0.15
Rhizoplane 2.67
Rhizosphere 79.94
Stem 0
Stem Tuber 0
Unclassified 7.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1900888 2162886007 Bacteria 7548
2 JGI24736J21556_1000668 3300001904 Bacteria 6283
3 JGI24741J21665_1000513 3300001915 Bacteria 11829
4 JGI24740J21852_10000733 3300001979 Bacteria 14284
5 JGI24740J21852_10001041 3300001979 Bacteria 12448
6 JGI25157J39369_1005706 3300002741 Bacteria 1985
7 JGI25151J46595_10000102 3300003187 Bacteria 114881
8 rootH1_10132375 3300003323 Bacteria 1213
9 Ga0055539_1001541 3300003752 Bacteria 4192
10 Ga0055533_1000809 3300003756 Bacteria 9692
11 Ga0055525_1000138 3300003759 Bacteria 104087
12 Ga0055527_1000281 3300003760 Bacteria 30006
13 Ga0055527_1000330 3300003760 Bacteria 25414
14 Ga0055535_1000843 3300003761 Bacteria 21891
15 Ga0055542_1000835 3300003762 Bacteria 21895
16 Ga0055542_1001160 3300003762 Bacteria 15324
17 Ga0055529_1000717 3300003763 Bacteria 21895
18 Ga0055529_1000943 3300003763 Bacteria 15407
19 Ga0055526_1006479 3300003771 Bacteria 6343
20 Ga0055537_1000059 3300003773 Bacteria 79628
21 Ga0055537_1001365 3300003773 Bacteria 9847
22 Ga0055524_1000019 3300003775 Bacteria 233561
23 Ga0055536_1018818 3300003781 Bacteria 2197
24 Ga0055534_1000012 3300003784 Bacteria 153530
25 Ga0055534_1000112 3300003784 Bacteria 59920
26 Ga0055528_1000007 3300003790 Bacteria 233327
27 Ga0055528_1001337 3300003790 Bacteria 15339
28 Ga0055530_10001674 3300003791 Bacteria 15731
29 Ga0055530_10002094 3300003791 Bacteria 13328
30 Ga0055531_10013881 3300003794 Bacteria 3678
31 Ga0055531_10024818 3300003794 Bacteria 2197
32 Ga0055531_10025507 3300003794 Bacteria 2143
33 Ga0058861_11997967 3300004800 Bacteria 3815
34 Ga0065714_10073865 3300005288 Bacteria 3115
35 Ga0065715_10008446 3300005293 Bacteria 3910
36 Ga0065715_10210857 3300005293 Bacteria 1310
37 Ga0070658_10025096 3300005327 Bacteria 4778
38 Ga0070683_100148995 3300005329 Bacteria 2218
39 Ga0070670_100001962 3300005331 Bacteria 16837
40 Ga0070670_100510566 3300005331 Bacteria 1070
41 Ga0070666_10267594 3300005335 Bacteria 1213
42 Ga0070680_100004327 3300005336 Bacteria 10676
43 Ga0070682_100013741 3300005337 Bacteria 4667
44 Ga0068868_100319978 3300005338 Bacteria 1321
45 Ga0070691_10146967 3300005341 Bacteria 1206
46 Ga0070691_10230441 3300005341 Bacteria 985
47 Ga0070661_100009383 3300005344 Bacteria 6771
48 Ga0070661_100063255 3300005344 Bacteria 2717
49 Ga0070661_100122479 3300005344 Bacteria 1948
50 Ga0070692_10014304 3300005345 Bacteria 3723
51 Ga0070692_10150891 3300005345 Bacteria 1323
52 Ga0070669_100064482 3300005353 Bacteria 2698
53 Ga0070675_100043947 3300005354 Bacteria 3654
54 Ga0070671_100045193 3300005355 Bacteria 3661
55 Ga0070671_100069039 3300005355 Bacteria 2947
56 Ga0070673_100408221 3300005364 Bacteria 1216
57 Ga0070659_100187046 3300005366 Bacteria 1701
58 Ga0070667_100005400 3300005367 Bacteria 10674
59 Ga0070667_100041398 3300005367 Bacteria 3865
60 Ga0070667_100050689 3300005367 Bacteria 3499
61 Ga0070667_100121267 3300005367 Bacteria 2274
62 Ga0070667_100187140 3300005367 Bacteria 1833
63 Ga0070663_100000042 3300005455 Bacteria 57899
64 Ga0070663_100060983 3300005455 Bacteria 2715
65 Ga0070663_100136117 3300005455 Bacteria 1870
66 Ga0070663_100216615 3300005455 Bacteria 1501
67 Ga0070662_100014495 3300005457 Bacteria 5270
68 Ga0070662_100041992 3300005457 Bacteria 3265
69 Ga0070681_10001872 3300005458 Bacteria 18988
70 Ga0070681_10009167 3300005458 Bacteria 9724
71 Ga0070681_10177415 3300005458 Bacteria 2052
72 Ga0070681_10191941 3300005458 Bacteria 1962
73 Ga0070681_10300998 3300005458 Bacteria 1513
74 Ga0070681_10754860 3300005458 Bacteria 889
75 Ga0070679_100004396 3300005530 Bacteria 13033
76 Ga0070679_100164520 3300005530 Bacteria 2192
77 Ga0070679_100819986 3300005530 Bacteria 873
78 Ga0070684_100024537 3300005535 Bacteria 5060
79 Ga0070684_100048363 3300005535 Bacteria 3690
80 Ga0070684_100152602 3300005535 Bacteria 2093
81 Ga0070684_100585753 3300005535 Bacteria 1037
82 Ga0068853_100004195 3300005539 Bacteria 11116
83 Ga0068853_100007213 3300005539 Bacteria 8902
84 Ga0068853_100011114 3300005539 Bacteria 7303
85 Ga0068853_100020141 3300005539 Bacteria 5545
86 Ga0068853_100028892 3300005539 Bacteria 4668
87 Ga0068853_100033305 3300005539 Bacteria 4371
88 Ga0068853_100047267 3300005539 Bacteria 3692
89 Ga0070672_100003657 3300005543 Bacteria 9989
90 Ga0070686_100167171 3300005544 Bacteria 1553
91 Ga0070696_100002079 3300005546 Bacteria 13147
92 Ga0070693_100005032 3300005547 Bacteria 6313
93 Ga0070693_100012299 3300005547 Bacteria 4328
94 Ga0070693_100025853 3300005547 Bacteria 3162
95 Ga0070665_100000028 3300005548 Bacteria 351357
96 Ga0070665_100008261 3300005548 Bacteria 10529
97 Ga0070665_100027661 3300005548 Bacteria 5710
98 Ga0070665_100050597 3300005548 Bacteria 4169
99 Ga0070665_100084459 3300005548 Bacteria 3180
100 Ga0070665_100168154 3300005548 Bacteria 2194
101 Ga0070665_100219067 3300005548 Bacteria 1904
102 Ga0070665_100412820 3300005548 Bacteria 1358
103 Ga0070665_100832480 3300005548 Bacteria 936
104 Ga0068855_100005951 3300005563 Bacteria 14870
105 Ga0068855_100105650 3300005563 Bacteria 3237
106 Ga0068855_100171818 3300005563 Bacteria 2454
107 Ga0068855_100384484 3300005563 Bacteria 1540
108 Ga0068855_100400853 3300005563 Bacteria 1503
109 Ga0068855_100640412 3300005563 Bacteria 1143
110 Ga0070664_100023351 3300005564 Bacteria 5107
111 Ga0070664_100203877 3300005564 Bacteria 1766
112 Ga0068857_100053558 3300005577 Bacteria 3579
113 Ga0068857_100182944 3300005577 Bacteria 1907
114 Ga0068857_100358917 3300005577 Bacteria 1351
115 Ga0068854_100004688 3300005578 Bacteria 8616
116 Ga0068854_100024611 3300005578 Bacteria 4125
117 Ga0068854_100053357 3300005578 Bacteria 2903
118 Ga0068854_100070907 3300005578 Bacteria 2547
119 Ga0068854_100080020 3300005578 Bacteria 2411
120 Ga0068854_100542130 3300005578 Bacteria 985
121 Ga0068854_100546565 3300005578 Bacteria 982
122 Ga0068856_100012643 3300005614 Bacteria 8173
123 Ga0068856_100161736 3300005614 Bacteria 2249
124 Ga0068856_100406692 3300005614 Bacteria 1381
125 Ga0068856_100452062 3300005614 Bacteria 1305
126 Ga0068852_100005973 3300005616 Bacteria 8769
127 Ga0068852_100068716 3300005616 Bacteria 3102
128 Ga0068852_100082660 3300005616 Bacteria 2854
129 Ga0068852_100212373 3300005616 Bacteria 1836
130 Ga0068852_100345615 3300005616 Bacteria 1451
131 Ga0068852_100348820 3300005616 Bacteria 1445
132 Ga0068859_100000280 3300005617 Bacteria 50848
133 Ga0068851_10011937 3300005834 Bacteria 4084
134 Ga0068851_10027186 3300005834 Bacteria 2818
135 Ga0068851_10035589 3300005834 Bacteria 2489
136 Ga0068870_10057938 3300005840 Bacteria 2073
137 Ga0068863_100018882 3300005841 Bacteria 6597
138 Ga0068863_100066084 3300005841 Bacteria 3421
139 Ga0068863_100077761 3300005841 Bacteria 3140
140 Ga0068863_100240960 3300005841 Bacteria 1745
141 Ga0068860_100124956 3300005843 Bacteria 2466
142 Ga0068862_100000215 3300005844 Bacteria 64251
143 Ga0068862_100111847 3300005844 Bacteria 2398
144 Ga0081539_10008186 3300005985 Bacteria 9212
145 Ga0097621_100206800 3300006237 Bacteria 1706
146 Ga0068871_100039983 3300006358 Bacteria 3755
147 Ga0068871_100199111 3300006358 Bacteria 1728
148 Ga0068871_100215267 3300006358 Bacteria 1663
149 Ga0068865_100017143 3300006881 Bacteria 4652
150 Ga0068865_100053746 3300006881 Bacteria 2795
151 Ga0097620_100000280 3300006931 Bacteria 50848
152 Ga0105251_10000205 3300009011 Bacteria 59437
153 Ga0105240_10087720 3300009093 Bacteria 3809
154 Ga0105240_10103888 3300009093 Bacteria 3451
155 Ga0105240_10152371 3300009093 Bacteria 2752
156 Ga0105245_10723360 3300009098 Bacteria 1030
157 Ga0105247_10124470 3300009101 Bacteria 1674
158 Ga0105241_10017637 3300009174 Bacteria 5249
159 Ga0105241_10055846 3300009174 Bacteria 3026
160 Ga0105241_10103439 3300009174 Bacteria 2268
161 Ga0105242_10675965 3300009176 Bacteria 1007
162 Ga0105248_10000120 3300009177 Bacteria 89960
163 Ga0105248_10309656 3300009177 Bacteria 1778
164 Ga0105237_10010356 3300009545 Bacteria 9929
165 Ga0105237_10618370 3300009545 Bacteria 1090
166 Ga0105238_10006626 3300009551 Bacteria 11543
167 Ga0105238_10011965 3300009551 Bacteria 8742
168 Ga0105238_10110821 3300009551 Bacteria 2725
169 Ga0105238_10192207 3300009551 Bacteria 2017
170 Ga0105249_10000898 3300009553 Bacteria 26273
171 Ga0105249_11264596 3300009553 Bacteria 809
172 Ga0105239_10005391 3300010375 Bacteria 15027
173 Ga0105239_10033812 3300010375 Bacteria 5613
174 Ga0105239_10107680 3300010375 Bacteria 3088
175 Ga0157373_10012798 3300013100 Bacteria 6163
176 Ga0157373_10042694 3300013100 Bacteria 3240
177 Ga0157373_10055024 3300013100 Bacteria 2827
178 Ga0157373_10084294 3300013100 Bacteria 2240
179 Ga0157371_10057507 3300013102 Bacteria 2758
180 Ga0157371_10190065 3300013102 Bacteria 1470
181 Ga0157370_10033604 3300013104 Bacteria 5000
182 Ga0157370_10144952 3300013104 Bacteria 2212
183 Ga0157370_10663632 3300013104 Bacteria 953
184 Ga0157369_10002250 3300013105 Bacteria 23203
185 Ga0157369_10024352 3300013105 Bacteria 6735
186 Ga0157369_10383664 3300013105 Bacteria 1458
187 Ga0157374_10158927 3300013296 Bacteria 2201
188 Ga0157374_10625115 3300013296 Bacteria 1088
189 Ga0157378_10000536 3300013297 Bacteria 36043
190 Ga0163162_10028377 3300013306 Bacteria 5537
191 Ga0163162_11402870 3300013306 Bacteria 795
192 Ga0157372_10000344 3300013307 Bacteria 51217
193 Ga0157372_10013581 3300013307 Bacteria 8705
194 Ga0157372_10036173 3300013307 Bacteria 5442
195 Ga0157372_10037458 3300013307 Bacteria 5350
196 Ga0157372_10051825 3300013307 Bacteria 4568
197 Ga0157372_10057810 3300013307 Bacteria 4336
198 Ga0157372_10586568 3300013307 Bacteria 1299
199 Ga0157375_10584129 3300013308 Bacteria 1277
200 Ga0163163_10000029 3300014325 Bacteria 174973
201 Ga0163163_10672312 3300014325 Bacteria 1099
202 Ga0182008_10020566 3300014497 Bacteria 3397
203 Ga0182008_10029210 3300014497 Bacteria 2787
204 Ga0157379_10001942 3300014968 Bacteria 17106
205 Ga0157376_10002494 3300014969 Bacteria 12460
206 Ga0157376_10005280 3300014969 Bacteria 9025
207 Ga0182006_1053246 3300015261 Bacteria 1552
208 Ga0182005_1002582 3300015265 Bacteria 6416
209 Ga0163161_10073490 3300017792 Bacteria 2506
210 Ga0206356_10496513 3300020070 Bacteria 3064
211 Ga0206356_11576430 3300020070 Bacteria 2668
212 Ga0206353_10732351 3300020082 Bacteria 1349
213 Ga0224712_10096835 3300022467 Bacteria 1245
214 Ga0209674_100149 3300025226 Bacteria 97879
215 Ga0209672_100004 3300025228 Bacteria 1467504
216 Ga0209672_100008 3300025228 Bacteria 946876
217 Ga0209563_100036 3300025230 Bacteria 448275
218 Ga0209258_100003 3300025242 Bacteria 1467504
219 Ga0209258_100004 3300025242 Bacteria 1376422
220 Ga0209258_100008 3300025242 Bacteria 1009355
221 Ga0207425_1010986 3300025245 Bacteria 2182
222 Ga0209026_1000045 3300025250 Bacteria 263431
223 Ga0209677_100974 3300025253 Bacteria 13904
224 Ga0209148_1000025 3300025254 Bacteria 663262
225 Ga0209148_1000053 3300025254 Bacteria 373506
226 Ga0209759_1000850 3300025256 Bacteria 23820
227 Ga0209565_1000001 3300025263 Bacteria 2950419
228 Ga0209565_1000060 3300025263 Bacteria 188543
229 Ga0209455_1000004 3300025272 Bacteria 1467504
230 Ga0209455_1000007 3300025272 Bacteria 1157983
231 Ga0209673_1000001 3300025273 Bacteria 3176258
232 Ga0209673_1000047 3300025273 Bacteria 289276
233 Ga0209130_1014021 3300025284 Bacteria 2029
234 Ga0209675_1000001 3300025291 Bacteria 2950293
235 Ga0209675_1000007 3300025291 Bacteria 683430
236 Ga0209676_1000052 3300025292 Bacteria 371539
237 Ga0209025_1000006 3300025294 Bacteria 1153444
238 Ga0209564_1000001 3300025295 Bacteria 3176258
239 Ga0209564_1000252 3300025295 Bacteria 114416
240 Ga0209758_1006577 3300025297 Bacteria 8257
241 Ga0209050_1000146 3300025298 Bacteria 166930
242 Ga0209256_1000006 3300025299 Bacteria 1250310
243 Ga0209256_1005932 3300025299 Bacteria 6743
244 Ga0209051_1005721 3300025303 Bacteria 7179
245 Ga0209257_1010878 3300025304 Bacteria 4500
246 Ga0207656_10003660 3300025321 Bacteria 5313
247 Ga0207656_10021120 3300025321 Bacteria 2597
248 Ga0207713_1000196 3300025735 Bacteria 84000
249 Ga0207682_10063268 3300025893 Bacteria 1553
250 Ga0207710_10054171 3300025900 Bacteria 1806
251 Ga0207688_10169944 3300025901 Bacteria 1296
252 Ga0207680_10139401 3300025903 Bacteria 1606
253 Ga0207680_10180954 3300025903 Bacteria 1425
254 Ga0207680_10323227 3300025903 Bacteria 1079
255 Ga0207647_10000826 3300025904 Bacteria 24065
256 Ga0207647_10001336 3300025904 Bacteria 18958
257 Ga0207647_10003112 3300025904 Bacteria 12460
258 Ga0207647_10138743 3300025904 Bacteria 1425
259 Ga0207645_10026306 3300025907 Bacteria 3761
260 Ga0207645_10106425 3300025907 Bacteria 1813
261 Ga0207643_10041259 3300025908 Bacteria 2600
262 Ga0207705_10000097 3300025909 Bacteria 105579
263 Ga0207705_10000341 3300025909 Bacteria 42108
264 Ga0207705_10000630 3300025909 Bacteria 29454
265 Ga0207705_10002108 3300025909 Bacteria 15463
266 Ga0207654_10000458 3300025911 Bacteria 23295
267 Ga0207654_10031408 3300025911 Bacteria 2924
268 Ga0207654_10063425 3300025911 Bacteria 2169
269 Ga0207707_10000065 3300025912 Bacteria 106546
270 Ga0207707_10000084 3300025912 Bacteria 95228
271 Ga0207707_10000578 3300025912 Bacteria 37213
272 Ga0207707_10001112 3300025912 Bacteria 25518
273 Ga0207707_10002407 3300025912 Bacteria 16839
274 Ga0207707_10054364 3300025912 Bacteria 3485
275 Ga0207695_10000772 3300025913 Bacteria 60706
276 Ga0207695_10002496 3300025913 Bacteria 27107
277 Ga0207695_10006652 3300025913 Bacteria 14917
278 Ga0207695_10015003 3300025913 Bacteria 9141
279 Ga0207695_10595887 3300025913 Bacteria 986
280 Ga0207671_10007551 3300025914 Bacteria 9414
281 Ga0207671_10088892 3300025914 Bacteria 2324
282 Ga0207671_10143283 3300025914 Bacteria 1842
283 Ga0207671_10249251 3300025914 Bacteria 1396
284 Ga0207660_10005551 3300025917 Bacteria 8192
285 Ga0207660_10006903 3300025917 Bacteria 7349
286 Ga0207660_10010377 3300025917 Bacteria 6043
287 Ga0207660_10011546 3300025917 Bacteria 5755
288 Ga0207660_10184679 3300025917 Bacteria 1621
289 Ga0207657_10002465 3300025919 Bacteria 20016
290 Ga0207657_10006390 3300025919 Bacteria 12239
291 Ga0207657_10007147 3300025919 Bacteria 11466
292 Ga0207657_10256498 3300025919 Bacteria 1392
293 Ga0207657_10483215 3300025919 Bacteria 971
294 Ga0207649_10004292 3300025920 Bacteria 7757
295 Ga0207649_10006309 3300025920 Bacteria 6443
296 Ga0207649_10385596 3300025920 Bacteria 1045
297 Ga0207649_10409040 3300025920 Bacteria 1017
298 Ga0207649_10705864 3300025920 Bacteria 782
299 Ga0207652_10000014 3300025921 Bacteria 196569
300 Ga0207652_10000076 3300025921 Bacteria 107686
301 Ga0207652_10002969 3300025921 Bacteria 14173
302 Ga0207652_10069249 3300025921 Bacteria 3063
303 Ga0207652_10378129 3300025921 Bacteria 1278
304 Ga0207652_10490868 3300025921 Bacteria 1106
305 Ga0207681_10056764 3300025923 Bacteria 2672
306 Ga0207694_10006803 3300025924 Bacteria 8679
307 Ga0207694_10012929 3300025924 Bacteria 6287
308 Ga0207650_10001926 3300025925 Bacteria 14613
309 Ga0207650_10328626 3300025925 Bacteria 1254
310 Ga0207687_10484561 3300025927 Bacteria 1030
311 Ga0207700_10513190 3300025928 Bacteria 1061
312 Ga0207644_10017204 3300025931 Bacteria 4877
313 Ga0207644_10257288 3300025931 Bacteria 1395
314 Ga0207690_10000122 3300025932 Bacteria 64448
315 Ga0207690_10003069 3300025932 Bacteria 10060
316 Ga0207690_10819681 3300025932 Bacteria 770
317 Ga0207706_10003801 3300025933 Bacteria 14393
318 Ga0207706_10316978 3300025933 Bacteria 1357
319 Ga0207706_10795698 3300025933 Bacteria 803
320 Ga0207691_10009099 3300025940 Bacteria 9532
321 Ga0207691_10019067 3300025940 Bacteria 6495
322 Ga0207711_10010606 3300025941 Bacteria 7662
323 Ga0207689_10034224 3300025942 Bacteria 4219
324 Ga0207661_10007040 3300025944 Bacteria 7981
325 Ga0207661_10071965 3300025944 Bacteria 2828
326 Ga0207661_10113455 3300025944 Bacteria 2296
327 Ga0207661_10266777 3300025944 Bacteria 1527
328 Ga0207661_10289978 3300025944 Bacteria 1464
329 Ga0207679_10026576 3300025945 Bacteria 3993
330 Ga0207667_10000623 3300025949 Bacteria 45814
331 Ga0207667_10000683 3300025949 Bacteria 43994
332 Ga0207667_10008297 3300025949 Bacteria 12358
333 Ga0207667_10019912 3300025949 Bacteria 7477
334 Ga0207667_10038594 3300025949 Bacteria 5098
335 Ga0207667_10049542 3300025949 Bacteria 4436
336 Ga0207651_10070326 3300025960 Bacteria 2476
337 Ga0207712_10000305 3300025961 Bacteria 45213
338 Ga0207712_10024220 3300025961 Bacteria 4017
339 Ga0207668_10017413 3300025972 Bacteria 4502
340 Ga0207668_10290936 3300025972 Bacteria 1344
341 Ga0207640_10000362 3300025981 Bacteria 29479
342 Ga0207640_10002592 3300025981 Bacteria 9682
343 Ga0207640_10003436 3300025981 Bacteria 8533
344 Ga0207640_10022848 3300025981 Bacteria 3750
345 Ga0207640_10053751 3300025981 Bacteria 2630
346 Ga0207640_10062553 3300025981 Bacteria 2470
347 Ga0207640_10135130 3300025981 Bacteria 1789
348 Ga0207658_10000033 3300025986 Bacteria 158540
349 Ga0207658_10009244 3300025986 Bacteria 6684
350 Ga0207658_10513082 3300025986 Bacteria 1069
351 Ga0207658_10805041 3300025986 Bacteria 853
352 Ga0207677_10008057 3300026023 Bacteria 5868
353 Ga0207703_10202544 3300026035 Bacteria 1764
354 Ga0207639_10000437 3300026041 Bacteria 28831
355 Ga0207639_10000514 3300026041 Bacteria 26656
356 Ga0207639_10001917 3300026041 Bacteria 13965
357 Ga0207639_10004441 3300026041 Bacteria 9464
358 Ga0207639_10007675 3300026041 Bacteria 7363
359 Ga0207639_10019356 3300026041 Bacteria 4854
360 Ga0207678_10001678 3300026067 Bacteria 20323
361 Ga0207678_10002250 3300026067 Bacteria 17473
362 Ga0207678_10002720 3300026067 Bacteria 16033
363 Ga0207678_10066322 3300026067 Bacteria 3100
364 Ga0207678_10094476 3300026067 Bacteria 2555
365 Ga0207678_10142849 3300026067 Bacteria 2043
366 Ga0207678_10247627 3300026067 Bacteria 1526
367 Ga0207702_10012063 3300026078 Bacteria 7187
368 Ga0207702_10027084 3300026078 Bacteria 4759
369 Ga0207702_10030282 3300026078 Bacteria 4509
370 Ga0207702_10107880 3300026078 Bacteria 2470
371 Ga0207641_10009512 3300026088 Bacteria 8012
372 Ga0207641_10060657 3300026088 Bacteria 3224
373 Ga0207641_10221528 3300026088 Bacteria 1755
374 Ga0207641_10567599 3300026088 Bacteria 1108
375 Ga0207648_10071014 3300026089 Bacteria 3035
376 Ga0207648_10220498 3300026089 Bacteria 1686
377 Ga0207674_10002322 3300026116 Bacteria 24094
378 Ga0207674_10008389 3300026116 Bacteria 11948
379 Ga0207674_10008726 3300026116 Bacteria 11669
380 Ga0207674_10049463 3300026116 Bacteria 4299
381 Ga0207675_100070634 3300026118 Bacteria 3264
382 Ga0207683_10275069 3300026121 Bacteria 1539
383 Ga0207698_10005406 3300026142 Bacteria 7890
384 Ga0207698_10074478 3300026142 Bacteria 2708
385 Ga0207698_10079744 3300026142 Bacteria 2634
386 Ga0207698_10121696 3300026142 Bacteria 2210
387 Ga0207698_10278447 3300026142 Bacteria 1546
388 Ga0209371_1000018 3300027312 Bacteria 614700
389 Ga0209974_10040660 3300027876 Bacteria 1548
390 Ga0268266_10000017 3300028379 Bacteria 607272
391 Ga0268266_10042299 3300028379 Bacteria 3891
392 Ga0268266_10080274 3300028379 Bacteria 2842
393 Ga0268266_10233736 3300028379 Bacteria 1694
394 Ga0268266_10528461 3300028379 Bacteria 1128
395 Ga0268266_10688073 3300028379 Bacteria 985
396 Ga0268265_10000376 3300028380 Bacteria 48178
397 Ga0307515_10483712 3300028794 Bacteria 850
398 Ga0268256_1000016 3300030500 Bacteria 614700
399 Ga0316178_1024454 3300030735 Bacteria 1433
400 Ga0316183_1013189 3300030742 Bacteria 1273
401 Ga0307513_10146417 3300031456 Bacteria 2279
402 Ga0307509_10154147 3300031507 Bacteria 2207
403 Ga0316575_10014957 3300031665 Bacteria 2921
404 Ga0316578_10001715 3300031728 Bacteria 9149
405 Ga0316578_10173597 3300031728 Bacteria 1299
406 Ga0307406_10003433 3300031901 Bacteria 8623
407 Ga0307409_100899672 3300031995 Bacteria 899
408 Ga0307409_100995499 3300031995 Bacteria 856
409 Ga0307414_10063368 3300032004 Bacteria 2627
410 Ga0307414_10170466 3300032004 Bacteria 1739
411 Ga0307414_10322283 3300032004 Bacteria 1316
412 Ga0316580_10021272 3300032139 Bacteria 1999
413 Ga0373937_0533753 3300036401 Bacteria 1115
414 Ga0316584_0004592 3300036712 Bacteria 9152
415 Ga0395899_0000164 3300037312 Bacteria 102165
416 Ga0395900_0000163 3300037418 Bacteria 109199
417 Ga0395900_0000217 3300037418 Bacteria 90402
418 Ga0395900_0424266 3300037418 Bacteria 1290
419 Ga0395898_0000029 3300037466 Bacteria 370667
420 Ga0395898_0812526 3300037466 Bacteria 875
421 Ga0395905_0246134 3300037471 Bacteria 1670
422 Ga0439436_0027207 3300041404 Bacteria 1674
423 Ga0439439_0014291 3300041406 Bacteria 1932
424 Ga0439447_000276 3300041407 Bacteria 18194
425 Ga0451787_716987 3300041441 Bacteria 2601
426 Ga0451791_0862441 3300041451 Bacteria 1388
427 Ga0451793_1023005 3300041452 Bacteria 1339
428 Ga0451800_0141867 3300041459 Bacteria 4981
429 Ga0451802_1110374 3300041460 Bacteria 5165
430 Ga0451802_1696655 3300041460 Bacteria 1079
431 Ga0451806_117351 3300041462 Bacteria 8065
432 Ga0451807_0337638 3300041486 Bacteria 1453
433 Ga0451807_0456601 3300041486 Bacteria 1856
434 Ga0451807_1394303 3300041486 Bacteria 2770
435 Ga0451837_0747194 3300041494 Bacteria 1828
436 Ga0451837_1713807 3300041494 Bacteria 1066
437 Ga0439445_0014309 3300042004 Bacteria 1930
438 Ga0439432_030801 3300042006 Bacteria 1738
439 Ga0439449_0020377 3300042007 Bacteria 2485
440 Ga0439449_0134387 3300042007 Bacteria 920
441 Ga0450908_000062 3300042184 Bacteria 21656
442 Ga0466988_0067231 3300044536 Bacteria 2115
443 Ga0466969_0015355 3300044656 Bacteria 4013
444 Ga0466972_0001414 3300044658 Bacteria 11634
445 Ga0466982_0000011 3300044672 Bacteria 175513
446 Ga0466966_0043419 3300044684 Bacteria 2881
447 Ga0466966_0153471 3300044684 Bacteria 1403
448 Ga0466961_0036989 3300044693 Bacteria 3132
449 Ga0466961_0323369 3300044693 Bacteria 940
450 Ga0453684_0000531 3300044712 Bacteria 145390
451 Ga0466970_0001522 3300044765 Bacteria 11158
452 Ga0466970_0013448 3300044765 Bacteria 4195
453 Ga0466970_0033643 3300044765 Bacteria 2709
454 Ga0466970_0342560 3300044765 Bacteria 847
455 Ga0466957_0066566 3300044842 Bacteria 2221
456 Ga0466959_0000246 3300045049 Bacteria 33596
457 Ga0466959_0012881 3300045049 Bacteria 6053
458 Ga0466959_0030265 3300045049 Bacteria 4009
459 Ga0451576_0000212 3300045051 Bacteria 145396
460 Ga0466958_0289006 3300045836 Bacteria 1051
461 Ga0495627_018790 3300046453 Bacteria 2325
462 Ga0495638_0000865 3300046460 Bacteria 31467
463 Ga0495607_0001295 3300046501 Bacteria 22335
464 Ga0495606_0000918 3300046507 Bacteria 43503
465 Ga0495606_0000948 3300046507 Bacteria 42725
466 Ga0495606_0011361 3300046507 Bacteria 7271
467 Ga0495610_0004897 3300046512 Bacteria 9726
468 Ga0495616_0100842 3300046513 Bacteria 1354
469 Ga0495620_0000565 3300046515 Bacteria 23373
470 Ga0495631_0003548 3300046518 Bacteria 8529
471 Ga0495643_0010311 3300046522 Bacteria 5754
472 Ga0495663_0001434 3300046525 Bacteria 7522
473 Ga0495598_0075565 3300046537 Bacteria 1070
474 Ga0495621_0001934 3300046539 Bacteria 5448
475 Ga0495656_0003859 3300046615 Bacteria 5098
476 Ga0495656_0006771 3300046615 Bacteria 4027
477 Ga0495668_0002964 3300046616 Bacteria 13323
478 Ga0495625_0107781 3300046660 Bacteria 1906
479 Ga0495670_0236149 3300046691 Bacteria 973
480 Ga0495671_0005538 3300046692 Bacteria 7384
481 Ga0495660_0026804 3300046810 Bacteria 3263
482 Ga0495636_0006456 3300047318 Bacteria 4607
483 Ga0495672_0000087 3300047320 Bacteria 154275
484 Ga0495672_0055159 3300047320 Bacteria 2320
485 Ga0495677_0035505 3300047445 Bacteria 1819
486 Ga0495686_0004214 3300047472 Bacteria 11939
487 Ga0495686_0004945 3300047472 Bacteria 10727
488 Ga0495686_0038417 3300047472 Bacteria 3061
489 Ga0495615_0003458 3300048090 Bacteria 2648
490 Ga0496100_0178507 3300048903 Bacteria 1534
491 Ga0496108_0319897 3300048911 Bacteria 1353
492 Ga0496109_0074224 3300048912 Bacteria 3126
493 Ga0496112_0501297 3300048915 Bacteria 1149
494 Ga0496113_0071099 3300048916 Bacteria 2646
495 Ga0496114_0033133 3300048917 Bacteria 4255
496 Ga0496114_0229627 3300048917 Bacteria 1630
497 Ga0496115_0000077 3300048918 Bacteria 89885
498 Ga0496117_0009829 3300048920 Bacteria 8812
499 Ga0496117_0028737 3300048920 Bacteria 4301
500 Ga0496117_0034057 3300048920 Bacteria 3844
501 Ga0496117_0326005 3300048920 Bacteria 803
502 Ga0496118_0035939 3300048921 Bacteria 4014
503 Ga0496118_0056691 3300048921 Bacteria 2943
504 Ga0496118_0183806 3300048921 Bacteria 1259
505 Ga0496119_0001836 3300048922 Bacteria 24586
506 Ga0496120_0000273 3300048923 Bacteria 86248
507 Ga0496121_0018990 3300048924 Bacteria 6897
508 Ga0496122_0000417 3300048925 Bacteria 90401
509 Ga0496122_0001517 3300048925 Bacteria 37011
510 Ga0496123_0000137 3300048926 Bacteria 152169
511 Ga0496123_0000323 3300048926 Bacteria 91212
512 Ga0496123_0005271 3300048926 Bacteria 13107
513 Ga0496123_0160107 3300048926 Bacteria 1201
514 Ga0496123_0166846 3300048926 Bacteria 1166
515 Ga0496124_0003391 3300048927 Bacteria 19565
516 Ga0496124_0038566 3300048927 Bacteria 4147
517 Ga0496125_0077822 3300048928 Bacteria 2553
518 Ga0496126_0000047 3300048929 Bacteria 322212
519 Ga0496126_0105791 3300048929 Bacteria 2456
520 Ga0496126_0176797 3300048929 Bacteria 1815
521 Ga0496126_0297614 3300048929 Bacteria 1332
522 Ga0501031_0011342 3300049568 Bacteria 5804
523 Ga0501031_0060029 3300049568 Bacteria 2478
524 Ga0501032_0020663 3300049569 Bacteria 4583
525 Ga0501032_0085227 3300049569 Bacteria 2100
526 Ga0501033_0000648 3300049570 Bacteria 32231
527 Ga0501033_0000683 3300049570 Bacteria 31408
528 Ga0501033_0120810 3300049570 Bacteria 1901
529 Ga0501033_0137547 3300049570 Bacteria 1767
530 Ga0501034_0002782 3300049571 Bacteria 20512
531 Ga0501034_0006063 3300049571 Bacteria 13053
532 Ga0501034_0065145 3300049571 Bacteria 3656
533 Ga0501034_0083756 3300049571 Bacteria 3191
534 Ga0501034_0300286 3300049571 Bacteria 1542
535 Ga0501036_0008180 3300049572 Bacteria 8573
536 Ga0501036_0031163 3300049572 Bacteria 4506
537 Ga0501036_0090604 3300049572 Bacteria 2583
538 Ga0501036_0098252 3300049572 Bacteria 2475
539 Ga0501037_0010898 3300049573 Bacteria 6680
540 Ga0501037_0067090 3300049573 Bacteria 2613
541 Ga0501037_0127846 3300049573 Bacteria 1823
542 Ga0501037_0378757 3300049573 Bacteria 973
543 Ga0501038_0049526 3300049574 Bacteria 3632
544 Ga0501038_0054955 3300049574 Bacteria 3422
545 Ga0501038_0106607 3300049574 Bacteria 2326
546 Ga0501038_0138085 3300049574 Bacteria 1996
547 Ga0501038_0187968 3300049574 Bacteria 1663
548 Ga0501038_0208685 3300049574 Bacteria 1564
549 Ga0501038_0390874 3300049574 Bacteria 1077
550 Ga0501039_0017656 3300049575 Bacteria 5473
551 Ga0501039_0109320 3300049575 Bacteria 2161
552 Ga0501043_0016644 3300049579 Bacteria 5762
553 Ga0501043_0033628 3300049579 Bacteria 4034
554 Ga0501043_0100193 3300049579 Bacteria 2277
555 Ga0501046_0021844 3300049580 Bacteria 5276
556 Ga0501046_0039025 3300049580 Bacteria 3806
557 Ga0501046_0048382 3300049580 Bacteria 3367
558 Ga0501046_0094391 3300049580 Bacteria 2299
559 Ga0501046_0206302 3300049580 Bacteria 1460
560 Ga0501047_0001522 3300049581 Bacteria 22636
561 Ga0501047_0001828 3300049581 Bacteria 20569
562 Ga0501047_0015935 3300049581 Bacteria 7165
563 Ga0501047_0018902 3300049581 Bacteria 6608
564 Ga0501047_0029824 3300049581 Bacteria 5258
565 Ga0501047_0082079 3300049581 Bacteria 3099
566 Ga0501047_0196976 3300049581 Bacteria 1876
567 Ga0501047_0261424 3300049581 Bacteria 1578
568 Ga0501048_0005076 3300049582 Bacteria 10027
569 Ga0501067_0000857 3300049583 Bacteria 16400
570 Ga0501067_0061569 3300049583 Bacteria 2077
571 Ga0501068_0002378 3300049584 Bacteria 10003
572 Ga0501068_0014946 3300049584 Bacteria 4448
573 Ga0501068_0041232 3300049584 Bacteria 2773
574 Ga0501068_0305055 3300049584 Bacteria 1019
575 Ga0501069_0004343 3300049585 Bacteria 7320
576 Ga0501069_0065347 3300049585 Bacteria 2034
577 Ga0501069_0066293 3300049585 Bacteria 2019
578 Ga0501070_0005876 3300049586 Bacteria 10464
579 Ga0501070_0023616 3300049586 Bacteria 5151
580 Ga0501070_0028917 3300049586 Bacteria 4647
581 Ga0501070_0050686 3300049586 Bacteria 3445
582 Ga0501070_0053490 3300049586 Bacteria 3349
583 Ga0501070_0100683 3300049586 Bacteria 2390
584 Ga0501070_0113020 3300049586 Bacteria 2244
585 Ga0501070_0254009 3300049586 Bacteria 1437
586 Ga0501070_0265574 3300049586 Bacteria 1402
587 Ga0501071_0027758 3300049587 Bacteria 3984
588 Ga0501071_0071996 3300049587 Bacteria 2520
589 Ga0501072_0000573 3300049588 Bacteria 26511
590 Ga0501073_0000434 3300049589 Bacteria 28757
591 Ga0501073_0021629 3300049589 Bacteria 4635
592 Ga0501073_0070760 3300049589 Bacteria 2430
593 Ga0501073_0094089 3300049589 Bacteria 2081
594 Ga0501073_0186270 3300049589 Bacteria 1436
595 Ga0501073_0319438 3300049589 Bacteria 1071
596 Ga0501074_0002217 3300049590 Bacteria 13482
597 Ga0501074_0003202 3300049590 Bacteria 11546
598 Ga0501074_0004731 3300049590 Bacteria 9756
599 Ga0501074_0050760 3300049590 Bacteria 2994
600 Ga0501074_0256565 3300049590 Bacteria 1243
601 Ga0501077_0013289 3300049593 Bacteria 5162
602 Ga0501079_0004962 3300049741 Bacteria 9869
603 Ga0501079_0011079 3300049741 Bacteria 6877
604 Ga0501079_0055881 3300049741 Bacteria 3046
605 Ga0501079_0148675 3300049741 Bacteria 1826
606 Ga0501079_0260668 3300049741 Bacteria 1355
607 Ga0501080_0000764 3300049742 Bacteria 26124
608 Ga0501080_0040656 3300049742 Bacteria 4336
609 Ga0501080_0309982 3300049742 Bacteria 1430
610 Ga0501083_0000246 3300049744 Bacteria 34511
611 Ga0501083_0016861 3300049744 Bacteria 5102
612 Ga0501083_0117151 3300049744 Bacteria 1748
613 Ga0501265_008607 3300049762 Bacteria 1219
614 Ga0501275_000512 3300049772 Bacteria 4353
615 Ga0501035_0004415 3300049822 Bacteria 13354
616 Ga0501035_0013478 3300049822 Bacteria 7546
617 Ga0501035_0029015 3300049822 Bacteria 5047
618 Ga0501035_0062096 3300049822 Bacteria 3324
619 Ga0501035_0156946 3300049822 Bacteria 1971
620 Ga0501035_0160760 3300049822 Bacteria 1944
621 Ga0501035_0485848 3300049822 Bacteria 1018
622 Ga0501035_0785746 3300049822 Bacteria 761
623 Ga0501044_0004071 3300049823 Bacteria 16399
624 Ga0501044_0004952 3300049823 Bacteria 14899
625 Ga0501044_0017726 3300049823 Bacteria 7638
626 Ga0501044_0053442 3300049823 Bacteria 4156
627 Ga0501044_0066121 3300049823 Bacteria 3687
628 Ga0501044_0104618 3300049823 Bacteria 2844
629 Ga0501044_0104735 3300049823 Bacteria 2842
630 Ga0501044_0118517 3300049823 Bacteria 2650
631 Ga0501044_0133983 3300049823 Bacteria 2470
632 Ga0501044_0155242 3300049823 Bacteria 2268
633 Ga0501045_0022730 3300049824 Bacteria 4491
634 nmdc:mga00v17_153920_c1 3300050491 Bacteria 1478
635 nmdc:mga00v17_2252_c1 3300050491 Bacteria 9886
636 Ga0500610_0000365 3300053079 Bacteria 13645
637 Ga0500651_0006630 3300053093 Bacteria 6696
638 Ga0500651_0034171 3300053093 Bacteria 3206
639 Ga0500651_0414209 3300053093 Bacteria 755
640 Ga0500568_0000233 3300053139 Bacteria 47567
641 Ga0500645_000375 3300053730 Bacteria 31466
642 Ga0500609_012751 3300053731 Bacteria 1137
643 Ga0501084_0073144 3300054114 Bacteria 2870
644 Ga0501082_0000107 3300060353 Bacteria 65178
645 Ga0501082_0054984 3300060353 Bacteria 3430
646 Ga0501082_0156873 3300060353 Bacteria 1977
647 Ga0466962_0012963 3300061719 Bacteria 4010

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031728 Ga0316578_10001715 Ga0316578_100017159 207
2 3300049568 Ga0501031_0011342 Ga0501031_0011342_1542_2276 208
3 3300049569 Ga0501032_0020663 Ga0501032_0020663_626_1360 208
4 3300049571 Ga0501034_0002782 Ga0501034_0002782_7912_8646 208
5 3300049575 Ga0501039_0017656 Ga0501039_0017656_3653_4387 208
6 3300049580 Ga0501046_0021844 Ga0501046_0021844_213_947 208
7 3300049581 Ga0501047_0015935 Ga0501047_0015935_2805_3539 208
8 3300049582 Ga0501048_0005076 Ga0501048_0005076_6271_7005 208
9 3300049583 Ga0501067_0061569 Ga0501067_0061569_823_1557 208
10 3300049584 Ga0501068_0002378 Ga0501068_0002378_8582_9316 208
11 3300049587 Ga0501071_0071996 Ga0501071_0071996_240_974 208
12 3300049590 Ga0501074_0004731 Ga0501074_0004731_3214_3948 208
13 3300049741 Ga0501079_0011079 Ga0501079_0011079_3178_3912 208
14 3300049744 Ga0501083_0016861 Ga0501083_0016861_4034_4768 208
15 3300049822 Ga0501035_0004415 Ga0501035_0004415_754_1488 208
16 3300049823 Ga0501044_0104735 Ga0501044_0104735_195_929 208
17 3300049824 Ga0501045_0022730 Ga0501045_0022730_2950_3684 208
18 3300054114 Ga0501084_0073144 Ga0501084_0073144_1876_2610 208
19 3300060353 Ga0501082_0054984 Ga0501082_0054984_1876_2610 208
20 3300031728 Ga0316578_10173597 Ga0316578_101735972 209
21 3300032139 Ga0316580_10021272 Ga0316580_100212722 209
22 3300036712 Ga0316584_0004592 Ga0316584_0004592_589_1260 209
23 3300041460 Ga0451802_1696655 Ga0451802_1696655_83_769 212
24 3300005327 Ga0070658_10025096 Ga0070658_100250964 214
25 3300005335 Ga0070666_10267594 Ga0070666_102675942 214
26 3300005336 Ga0070680_100004327 Ga0070680_1000043272 214
27 3300005344 Ga0070661_100122479 Ga0070661_1001224792 214
28 3300005455 Ga0070663_100136117 Ga0070663_1001361172 214
29 3300005458 Ga0070681_10001872 Ga0070681_1000187210 214
30 3300005530 Ga0070679_100004396 Ga0070679_1000043962 214
31 3300005578 Ga0068854_100070907 Ga0068854_1000709072 214
32 3300005841 Ga0068863_100066084 Ga0068863_1000660842 214
33 3300009093 Ga0105240_10103888 Ga0105240_101038882 214
34 3300013100 Ga0157373_10055024 Ga0157373_100550242 214
35 3300013104 Ga0157370_10033604 Ga0157370_100336043 214
36 3300013307 Ga0157372_10037458 Ga0157372_100374584 214
37 3300025912 Ga0207707_10002407 Ga0207707_100024079 214
38 3300025917 Ga0207660_10011546 Ga0207660_100115463 214
39 3300025920 Ga0207649_10409040 Ga0207649_104090401 214
40 3300025921 Ga0207652_10000014 Ga0207652_10000014161 214
41 3300025928 Ga0207700_10513190 Ga0207700_105131901 214
42 3300025931 Ga0207644_10257288 Ga0207644_102572882 214
43 3300025981 Ga0207640_10022848 Ga0207640_100228483 214
44 3300026067 Ga0207678_10142849 Ga0207678_101428493 214
45 3300026088 Ga0207641_10567599 Ga0207641_105675992 214
46 3300049571 Ga0501034_0006063 Ga0501034_0006063_11851_12504 214
47 3300049574 Ga0501038_0208685 Ga0501038_0208685_215_874 214
48 3300049581 Ga0501047_0001522 Ga0501047_0001522_16287_16946 214
49 3300049585 Ga0501069_0065347 Ga0501069_0065347_470_1129 214
50 3300049586 Ga0501070_0023616 Ga0501070_0023616_1320_1979 214
51 3300049587 Ga0501071_0027758 Ga0501071_0027758_256_915 214
52 3300049589 Ga0501073_0070760 Ga0501073_0070760_791_1450 214
53 3300049590 Ga0501074_0002217 Ga0501074_0002217_7120_7779 214
54 3300049593 Ga0501077_0013289 Ga0501077_0013289_507_1163 214
55 3300049741 Ga0501079_0148675 Ga0501079_0148675_507_1166 214
56 3300049822 Ga0501035_0029015 Ga0501035_0029015_3324_3983 214
57 3300049823 Ga0501044_0004952 Ga0501044_0004952_8915_9574 214
58 3300049823 Ga0501044_0053442 Ga0501044_0053442_2548_3207 214
59 3300005293 Ga0065715_10008446 Ga0065715_100084464 215
60 3300025907 Ga0207645_10026306 Ga0207645_100263062 215
61 3300025912 Ga0207707_10000084 Ga0207707_1000008469 215
62 3300025917 Ga0207660_10005551 Ga0207660_100055519 215
63 3300025921 Ga0207652_10000076 Ga0207652_1000007670 215
64 3300003752 Ga0055539_1001541 Ga0055539_10015412 216
65 3300003756 Ga0055533_1000809 Ga0055533_10008097 216
66 3300003759 Ga0055525_1000138 Ga0055525_10001388 216
67 3300003760 Ga0055527_1000281 Ga0055527_100028114 216
68 3300003760 Ga0055527_1000330 Ga0055527_100033014 216
69 3300003761 Ga0055535_1000843 Ga0055535_100084310 216
70 3300003762 Ga0055542_1000835 Ga0055542_100083510 216
71 3300003762 Ga0055542_1001160 Ga0055542_100116014 216
72 3300003763 Ga0055529_1000717 Ga0055529_100071710 216
73 3300003763 Ga0055529_1000943 Ga0055529_100094314 216
74 3300005338 Ga0068868_100319978 Ga0068868_1003199782 216
75 3300005344 Ga0070661_100009383 Ga0070661_1000093834 216
76 3300005353 Ga0070669_100064482 Ga0070669_1000644824 216
77 3300005354 Ga0070675_100043947 Ga0070675_1000439474 216
78 3300005364 Ga0070673_100408221 Ga0070673_1004082211 216
79 3300005367 Ga0070667_100121267 Ga0070667_1001212672 216
80 3300005457 Ga0070662_100041992 Ga0070662_1000419923 216
81 3300005458 Ga0070681_10177415 Ga0070681_101774152 216
82 3300005535 Ga0070684_100024537 Ga0070684_1000245373 216
83 3300005539 Ga0068853_100004195 Ga0068853_1000041957 216
84 3300005539 Ga0068853_100028892 Ga0068853_1000288924 216
85 3300005539 Ga0068853_100033305 Ga0068853_1000333053 216
86 3300005543 Ga0070672_100003657 Ga0070672_1000036576 216
87 3300005544 Ga0070686_100167171 Ga0070686_1001671713 216
88 3300005547 Ga0070693_100025853 Ga0070693_1000258533 216
89 3300005548 Ga0070665_100008261 Ga0070665_1000082616 216
90 3300005563 Ga0068855_100171818 Ga0068855_1001718182 216
91 3300005563 Ga0068855_100400853 Ga0068855_1004008533 216
92 3300005578 Ga0068854_100053357 Ga0068854_1000533572 216
93 3300005578 Ga0068854_100080020 Ga0068854_1000800203 216
94 3300005614 Ga0068856_100012643 Ga0068856_1000126435 216
95 3300005614 Ga0068856_100161736 Ga0068856_1001617363 216
96 3300005614 Ga0068856_100406692 Ga0068856_1004066922 216
97 3300005616 Ga0068852_100005973 Ga0068852_1000059732 216
98 3300005616 Ga0068852_100348820 Ga0068852_1003488203 216
99 3300005834 Ga0068851_10027186 Ga0068851_100271863 216
100 3300005840 Ga0068870_10057938 Ga0068870_100579382 216
101 3300005843 Ga0068860_100124956 Ga0068860_1001249563 216
102 3300005844 Ga0068862_100111847 Ga0068862_1001118473 216
103 3300006881 Ga0068865_100017143 Ga0068865_1000171434 216
104 3300006881 Ga0068865_100053746 Ga0068865_1000537462 216
105 3300009093 Ga0105240_10152371 Ga0105240_101523713 216
106 3300009098 Ga0105245_10723360 Ga0105245_107233602 216
107 3300009174 Ga0105241_10055846 Ga0105241_100558463 216
108 3300009174 Ga0105241_10103439 Ga0105241_101034392 216
109 3300009551 Ga0105238_10006626 Ga0105238_100066263 216
110 3300009551 Ga0105238_10192207 Ga0105238_101922072 216
111 3300009553 Ga0105249_11264596 Ga0105249_112645961 216
112 3300010375 Ga0105239_10033812 Ga0105239_100338122 216
113 3300013100 Ga0157373_10042694 Ga0157373_100426943 216
114 3300013104 Ga0157370_10663632 Ga0157370_106636322 216
115 3300013105 Ga0157369_10002250 Ga0157369_1000225015 216
116 3300013296 Ga0157374_10158927 Ga0157374_101589273 216
117 3300013306 Ga0163162_10028377 Ga0163162_100283771 216
118 3300013306 Ga0163162_11402870 Ga0163162_114028701 216
119 3300013307 Ga0157372_10000344 Ga0157372_1000034419 216
120 3300013307 Ga0157372_10586568 Ga0157372_105865682 216
121 3300013308 Ga0157375_10584129 Ga0157375_105841292 216
122 3300014325 Ga0163163_10000029 Ga0163163_1000002943 216
123 3300014325 Ga0163163_10672312 Ga0163163_106723122 216
124 3300014497 Ga0182008_10020566 Ga0182008_100205663 216
125 3300014968 Ga0157379_10001942 Ga0157379_1000194216 216
126 3300014969 Ga0157376_10005280 Ga0157376_100052807 216
127 3300025226 Ga0209674_100149 Ga0209674_10014963 216
128 3300025228 Ga0209672_100004 Ga0209672_100004884 216
129 3300025228 Ga0209672_100008 Ga0209672_100008802 216
130 3300025230 Ga0209563_100036 Ga0209563_1000368 216
131 3300025242 Ga0209258_100003 Ga0209258_100003884 216
132 3300025242 Ga0209258_100004 Ga0209258_100004387 216
133 3300025242 Ga0209258_100008 Ga0209258_10000812 216
134 3300025253 Ga0209677_100974 Ga0209677_10097413 216
135 3300025254 Ga0209148_1000025 Ga0209148_1000025188 216
136 3300025254 Ga0209148_1000053 Ga0209148_1000053132 216
137 3300025272 Ga0209455_1000004 Ga0209455_1000004884 216
138 3300025272 Ga0209455_1000007 Ga0209455_1000007132 216
139 3300025303 Ga0209051_1005721 Ga0209051_10057214 216
140 3300025321 Ga0207656_10021120 Ga0207656_100211202 216
141 3300025903 Ga0207680_10139401 Ga0207680_101394011 216
142 3300025903 Ga0207680_10323227 Ga0207680_103232272 216
143 3300025904 Ga0207647_10001336 Ga0207647_1000133610 216
144 3300025908 Ga0207643_10041259 Ga0207643_100412592 216
145 3300025911 Ga0207654_10000458 Ga0207654_100004583 216
146 3300025911 Ga0207654_10063425 Ga0207654_100634253 216
147 3300025912 Ga0207707_10054364 Ga0207707_100543642 216
148 3300025913 Ga0207695_10000772 Ga0207695_1000077211 216
149 3300025913 Ga0207695_10595887 Ga0207695_105958872 216
150 3300025919 Ga0207657_10007147 Ga0207657_1000714712 216
151 3300025920 Ga0207649_10004292 Ga0207649_100042923 216
152 3300025923 Ga0207681_10056764 Ga0207681_100567641 216
153 3300025924 Ga0207694_10006803 Ga0207694_100068037 216
154 3300025927 Ga0207687_10484561 Ga0207687_104845612 216
155 3300025940 Ga0207691_10009099 Ga0207691_100090992 216
156 3300025942 Ga0207689_10034224 Ga0207689_100342242 216
157 3300025944 Ga0207661_10113455 Ga0207661_101134553 216
158 3300025949 Ga0207667_10019912 Ga0207667_100199127 216
159 3300025981 Ga0207640_10000362 Ga0207640_1000036226 216
160 3300026041 Ga0207639_10000514 Ga0207639_1000051411 216
161 3300026067 Ga0207678_10247627 Ga0207678_102476272 216
162 3300026078 Ga0207702_10027084 Ga0207702_100270844 216
163 3300026078 Ga0207702_10030282 Ga0207702_100302823 216
164 3300026078 Ga0207702_10107880 Ga0207702_101078803 216
165 3300026089 Ga0207648_10220498 Ga0207648_102204982 216
166 3300026116 Ga0207674_10008389 Ga0207674_100083898 216
167 3300026121 Ga0207683_10275069 Ga0207683_102750692 216
168 3300026142 Ga0207698_10074478 Ga0207698_100744784 216
169 3300036401 Ga0373937_0533753 Ga0373937_0533753_83_772 216
170 3300037312 Ga0395899_0000164 Ga0395899_0000164_15475_16143 216
171 3300037418 Ga0395900_0000217 Ga0395900_0000217_70708_71376 216
172 3300037466 Ga0395898_0000029 Ga0395898_0000029_352597_353265 216
173 3300041441 Ga0451787_716987 Ga0451787_716987_1657_2328 216
174 3300042184 Ga0450908_000062 Ga0450908_000062_9864_10532 216
175 3300044656 Ga0466969_0015355 Ga0466969_0015355_2675_3343 216
176 3300044672 Ga0466982_0000011 Ga0466982_0000011_11460_12128 216
177 3300044684 Ga0466966_0153471 Ga0466966_0153471_242_910 216
178 3300044693 Ga0466961_0036989 Ga0466961_0036989_1827_2495 216
179 3300044693 Ga0466961_0323369 Ga0466961_0323369_31_699 216
180 3300044712 Ga0453684_0000531 Ga0453684_0000531_56794_57456 216
181 3300044765 Ga0466970_0013448 Ga0466970_0013448_16_684 216
182 3300044765 Ga0466970_0033643 Ga0466970_0033643_1142_1810 216
183 3300044842 Ga0466957_0066566 Ga0466957_0066566_1433_2101 216
184 3300045049 Ga0466959_0000246 Ga0466959_0000246_17739_18407 216
185 3300045051 Ga0451576_0000212 Ga0451576_0000212_56800_57462 216
186 3300046460 Ga0495638_0000865 Ga0495638_0000865_20971_21639 216
187 3300046501 Ga0495607_0001295 Ga0495607_0001295_17982_18650 216
188 3300046507 Ga0495606_0011361 Ga0495606_0011361_85_753 216
189 3300048903 Ga0496100_0178507 Ga0496100_0178507_79_747 216
190 3300048920 Ga0496117_0326005 Ga0496117_0326005_24_692 216
191 3300048926 Ga0496123_0166846 Ga0496123_0166846_115_783 216
192 3300049572 Ga0501036_0090604 Ga0501036_0090604_98_787 216
193 3300049574 Ga0501038_0138085 Ga0501038_0138085_1082_1771 216
194 3300049579 Ga0501043_0033628 Ga0501043_0033628_1718_2407 216
195 3300049580 Ga0501046_0206302 Ga0501046_0206302_43_732 216
196 3300049581 Ga0501047_0001828 Ga0501047_0001828_15789_16478 216
197 3300049581 Ga0501047_0018902 Ga0501047_0018902_1569_2258 216
198 3300049583 Ga0501067_0000857 Ga0501067_0000857_7200_7889 216
199 3300049584 Ga0501068_0014946 Ga0501068_0014946_337_1026 216
200 3300049585 Ga0501069_0004343 Ga0501069_0004343_4349_5038 216
201 3300049585 Ga0501069_0066293 Ga0501069_0066293_897_1586 216
202 3300049586 Ga0501070_0005876 Ga0501070_0005876_7836_8525 216
203 3300049586 Ga0501070_0113020 Ga0501070_0113020_209_898 216
204 3300049588 Ga0501072_0000573 Ga0501072_0000573_17498_18187 216
205 3300049589 Ga0501073_0000434 Ga0501073_0000434_2132_2821 216
206 3300049590 Ga0501074_0003202 Ga0501074_0003202_8520_9209 216
207 3300049741 Ga0501079_0004962 Ga0501079_0004962_8109_8798 216
208 3300049742 Ga0501080_0000764 Ga0501080_0000764_16567_17256 216
209 3300049742 Ga0501080_0040656 Ga0501080_0040656_394_1083 216
210 3300049744 Ga0501083_0000246 Ga0501083_0000246_25401_26090 216
211 3300049822 Ga0501035_0485848 Ga0501035_0485848_174_863 216
212 3300049823 Ga0501044_0104618 Ga0501044_0104618_1395_2084 216
213 3300049823 Ga0501044_0133983 Ga0501044_0133983_1714_2403 216
214 3300053093 Ga0500651_0414209 Ga0500651_0414209_60_728 216
215 3300060353 Ga0501082_0156873 Ga0501082_0156873_583_1272 216
216 3300013297 Ga0157378_10000536 Ga0157378_1000053623 217
217 3300026035 Ga0207703_10202544 Ga0207703_102025442 217
218 3300031995 Ga0307409_100995499 Ga0307409_1009954992 217
219 3300047445 Ga0495677_0035505 Ga0495677_0035505_844_1527 217
220 3300049586 Ga0501070_0050686 Ga0501070_0050686_61_783 217
221 3300049590 Ga0501074_0256565 Ga0501074_0256565_282_1004 217
222 3300025914 Ga0207671_10088892 Ga0207671_100888922 218
223 3300041404 Ga0439436_0027207 Ga0439436_0027207_53_742 218
224 3300042007 Ga0439449_0134387 Ga0439449_0134387_191_880 218
225 3300001979 JGI24740J21852_10001041 JGI24740J21852_100010414 219
226 3300004800 Ga0058861_11997967 Ga0058861_119979672 219
227 3300005337 Ga0070682_100013741 Ga0070682_1000137412 219
228 3300005341 Ga0070691_10230441 Ga0070691_102304412 219
229 3300005345 Ga0070692_10150891 Ga0070692_101508912 219
230 3300005366 Ga0070659_100187046 Ga0070659_1001870462 219
231 3300005457 Ga0070662_100014495 Ga0070662_1000144953 219
232 3300005546 Ga0070696_100002079 Ga0070696_1000020795 219
233 3300005547 Ga0070693_100005032 Ga0070693_1000050324 219
234 3300005548 Ga0070665_100027661 Ga0070665_1000276614 219
235 3300005578 Ga0068854_100542130 Ga0068854_1005421302 219
236 3300005614 Ga0068856_100452062 Ga0068856_1004520622 219
237 3300005616 Ga0068852_100212373 Ga0068852_1002123732 219
238 3300005834 Ga0068851_10011937 Ga0068851_100119373 219
239 3300009093 Ga0105240_10087720 Ga0105240_100877203 219
240 3300009174 Ga0105241_10017637 Ga0105241_100176375 219
241 3300009545 Ga0105237_10618370 Ga0105237_106183702 219
242 3300009551 Ga0105238_10011965 Ga0105238_100119653 219
243 3300013100 Ga0157373_10084294 Ga0157373_100842943 219
244 3300013104 Ga0157370_10144952 Ga0157370_101449521 219
245 3300013105 Ga0157369_10383664 Ga0157369_103836642 219
246 3300013307 Ga0157372_10036173 Ga0157372_100361733 219
247 3300020070 Ga0206356_10496513 Ga0206356_104965133 219
248 3300020082 Ga0206353_10732351 Ga0206353_107323513 219
249 3300022467 Ga0224712_10096835 Ga0224712_100968352 219
250 3300025292 Ga0209676_1000052 Ga0209676_1000052217 219
251 3300025321 Ga0207656_10003660 Ga0207656_100036604 219
252 3300025904 Ga0207647_10000826 Ga0207647_1000082617 219
253 3300025909 Ga0207705_10000097 Ga0207705_1000009778 219
254 3300025909 Ga0207705_10000341 Ga0207705_100003417 219
255 3300025911 Ga0207654_10031408 Ga0207654_100314083 219
256 3300025912 Ga0207707_10001112 Ga0207707_100011127 219
257 3300025913 Ga0207695_10006652 Ga0207695_100066526 219
258 3300025914 Ga0207671_10143283 Ga0207671_101432832 219
259 3300025917 Ga0207660_10010377 Ga0207660_100103777 219
260 3300025919 Ga0207657_10002465 Ga0207657_1000246510 219
261 3300025920 Ga0207649_10006309 Ga0207649_100063092 219
262 3300025921 Ga0207652_10002969 Ga0207652_100029697 219
263 3300025924 Ga0207694_10012929 Ga0207694_100129292 219
264 3300025932 Ga0207690_10000122 Ga0207690_1000012252 219
265 3300025933 Ga0207706_10003801 Ga0207706_100038018 219
266 3300025944 Ga0207661_10007040 Ga0207661_100070406 219
267 3300025949 Ga0207667_10000683 Ga0207667_1000068333 219
268 3300025972 Ga0207668_10290936 Ga0207668_102909362 219
269 3300025981 Ga0207640_10062553 Ga0207640_100625532 219
270 3300026041 Ga0207639_10004441 Ga0207639_100044414 219
271 3300026067 Ga0207678_10002250 Ga0207678_1000225015 219
272 3300026078 Ga0207702_10012063 Ga0207702_100120632 219
273 3300026116 Ga0207674_10002322 Ga0207674_1000232217 219
274 3300026118 Ga0207675_100070634 Ga0207675_1000706343 219
275 3300026142 Ga0207698_10005406 Ga0207698_100054065 219
276 3300028379 Ga0268266_10080274 Ga0268266_100802742 219
277 3300028794 Ga0307515_10483712 Ga0307515_104837122 219
278 3300031456 Ga0307513_10146417 Ga0307513_101464173 219
279 3300032004 Ga0307414_10063368 Ga0307414_100633683 219
280 3300037418 Ga0395900_0424266 Ga0395900_0424266_245_952 219
281 3300046507 Ga0495606_0000918 Ga0495606_0000918_10388_11104 219
282 3300046507 Ga0495606_0000948 Ga0495606_0000948_8630_9433 219
283 3300046515 Ga0495620_0000565 Ga0495620_0000565_13405_14208 219
284 3300047472 Ga0495686_0004945 Ga0495686_0004945_8893_9696 219
285 3300048917 Ga0496114_0033133 Ga0496114_0033133_2078_2737 219
286 3300048918 Ga0496115_0000077 Ga0496115_0000077_57108_57806 219
287 3300048924 Ga0496121_0018990 Ga0496121_0018990_4872_5675 219
288 3300048929 Ga0496126_0000047 Ga0496126_0000047_236776_237474 219
289 3300048929 Ga0496126_0105791 Ga0496126_0105791_1631_2290 219
290 3300049570 Ga0501033_0000683 Ga0501033_0000683_29537_30214 219
291 3300050491 nmdc:mga00v17_2252_c1 nmdc:mga00v17_2252_c1_1106_1765 219
292 3300053093 Ga0500651_0034171 Ga0500651_0034171_93_776 219
293 3300053730 Ga0500645_000375 Ga0500645_000375_16595_17356 219
294 iso_pu_bacteria 2734482264 2735835413 219
295 3300005341 Ga0070691_10146967 Ga0070691_101469672 220
296 3300005344 Ga0070661_100063255 Ga0070661_1000632552 220
297 3300005345 Ga0070692_10014304 Ga0070692_100143043 220
298 3300005367 Ga0070667_100005400 Ga0070667_10000540010 220
299 3300005367 Ga0070667_100050689 Ga0070667_1000506892 220
300 3300005367 Ga0070667_100187140 Ga0070667_1001871402 220
301 3300005455 Ga0070663_100000042 Ga0070663_1000000428 220
302 3300005455 Ga0070663_100060983 Ga0070663_1000609833 220
303 3300005539 Ga0068853_100007213 Ga0068853_1000072137 220
304 3300005539 Ga0068853_100011114 Ga0068853_1000111142 220
305 3300005547 Ga0070693_100012299 Ga0070693_1000122993 220
306 3300005548 Ga0070665_100000028 Ga0070665_100000028165 220
307 3300005548 Ga0070665_100050597 Ga0070665_1000505972 220
308 3300005548 Ga0070665_100084459 Ga0070665_1000844593 220
309 3300005548 Ga0070665_100168154 Ga0070665_1001681542 220
310 3300005563 Ga0068855_100005951 Ga0068855_1000059513 220
311 3300005563 Ga0068855_100105650 Ga0068855_1001056503 220
312 3300005577 Ga0068857_100053558 Ga0068857_1000535582 220
313 3300005577 Ga0068857_100358917 Ga0068857_1003589172 220
314 3300005578 Ga0068854_100004688 Ga0068854_1000046882 220
315 3300005616 Ga0068852_100068716 Ga0068852_1000687161 220
316 3300005616 Ga0068852_100345615 Ga0068852_1003456153 220
317 3300005617 Ga0068859_100000280 Ga0068859_10000028033 220
318 3300005841 Ga0068863_100018882 Ga0068863_1000188824 220
319 3300005841 Ga0068863_100077761 Ga0068863_1000777612 220
320 3300005844 Ga0068862_100000215 Ga0068862_10000021517 220
321 3300006931 Ga0097620_100000280 Ga0097620_10000028012 220
322 3300009101 Ga0105247_10124470 Ga0105247_101244702 220
323 3300009177 Ga0105248_10000120 Ga0105248_1000012040 220
324 3300009545 Ga0105237_10010356 Ga0105237_100103564 220
325 3300009553 Ga0105249_10000898 Ga0105249_1000089816 220
326 3300010375 Ga0105239_10005391 Ga0105239_100053913 220
327 3300013102 Ga0157371_10057507 Ga0157371_100575073 220
328 3300013105 Ga0157369_10024352 Ga0157369_100243522 220
329 3300013307 Ga0157372_10013581 Ga0157372_100135815 220
330 3300025900 Ga0207710_10054171 Ga0207710_100541712 220
331 3300025909 Ga0207705_10000630 Ga0207705_1000063019 220
332 3300025913 Ga0207695_10002496 Ga0207695_1000249621 220
333 3300025914 Ga0207671_10007551 Ga0207671_100075515 220
334 3300025919 Ga0207657_10006390 Ga0207657_100063902 220
335 3300025920 Ga0207649_10705864 Ga0207649_107058641 220
336 3300025932 Ga0207690_10003069 Ga0207690_1000306910 220
337 3300025932 Ga0207690_10819681 Ga0207690_108196811 220
338 3300025941 Ga0207711_10010606 Ga0207711_100106063 220
339 3300025949 Ga0207667_10000623 Ga0207667_1000062315 220
340 3300025949 Ga0207667_10038594 Ga0207667_100385942 220
341 3300025949 Ga0207667_10049542 Ga0207667_100495421 220
342 3300025961 Ga0207712_10000305 Ga0207712_1000030510 220
343 3300025961 Ga0207712_10024220 Ga0207712_100242203 220
344 3300025972 Ga0207668_10017413 Ga0207668_100174132 220
345 3300025981 Ga0207640_10003436 Ga0207640_100034365 220
346 3300025986 Ga0207658_10000033 Ga0207658_10000033115 220
347 3300025986 Ga0207658_10009244 Ga0207658_100092443 220
348 3300025986 Ga0207658_10513082 Ga0207658_105130822 220
349 3300025986 Ga0207658_10805041 Ga0207658_108050411 220
350 3300026041 Ga0207639_10000437 Ga0207639_1000043726 220
351 3300026041 Ga0207639_10001917 Ga0207639_100019175 220
352 3300026041 Ga0207639_10019356 Ga0207639_100193563 220
353 3300026067 Ga0207678_10001678 Ga0207678_100016789 220
354 3300026067 Ga0207678_10002720 Ga0207678_1000272016 220
355 3300026067 Ga0207678_10094476 Ga0207678_100944763 220
356 3300026088 Ga0207641_10009512 Ga0207641_100095127 220
357 3300026088 Ga0207641_10060657 Ga0207641_100606572 220
358 3300026142 Ga0207698_10278447 Ga0207698_102784472 220
359 3300028379 Ga0268266_10000017 Ga0268266_10000017309 220
360 3300028379 Ga0268266_10042299 Ga0268266_100422992 220
361 3300028379 Ga0268266_10528461 Ga0268266_105284611 220
362 3300028380 Ga0268265_10000376 Ga0268265_1000037617 220
363 3300031507 Ga0307509_10154147 Ga0307509_101541472 220
364 3300037418 Ga0395900_0000163 Ga0395900_0000163_36531_37238 220
365 3300041452 Ga0451793_1023005 Ga0451793_1023005_285_971 220
366 3300041486 Ga0451807_0456601 Ga0451807_0456601_428_1114 220
367 3300041494 Ga0451837_0747194 Ga0451837_0747194_847_1533 220
368 3300044658 Ga0466972_0001414 Ga0466972_0001414_6768_7454 220
369 3300044765 Ga0466970_0001522 Ga0466970_0001522_3745_4431 220
370 3300045049 Ga0466959_0012881 Ga0466959_0012881_3411_4097 220
371 3300047472 Ga0495686_0004214 Ga0495686_0004214_5835_6527 220
372 3300048917 Ga0496114_0229627 Ga0496114_0229627_442_1125 220
373 3300048925 Ga0496122_0001517 Ga0496122_0001517_28496_29188 220
374 3300048926 Ga0496123_0000323 Ga0496123_0000323_12118_12810 220
375 3300053079 Ga0500610_0000365 Ga0500610_0000365_9200_9886 220
376 3300053093 Ga0500651_0006630 Ga0500651_0006630_2251_2937 220
377 3300005455 Ga0070663_100216615 Ga0070663_1002166151 221
378 3300005458 Ga0070681_10300998 Ga0070681_103009982 221
379 3300005548 Ga0070665_100412820 Ga0070665_1004128202 221
380 3300025921 Ga0207652_10490868 Ga0207652_104908682 221
381 3300026067 Ga0207678_10066322 Ga0207678_100663221 221
382 3300028379 Ga0268266_10233736 Ga0268266_102337362 221
383 3300041451 Ga0451791_0862441 Ga0451791_0862441_512_1183 221
384 3300041460 Ga0451802_1110374 Ga0451802_1110374_3993_4664 221
385 3300041486 Ga0451807_0337638 Ga0451807_0337638_125_796 221
386 3300041494 Ga0451837_1713807 Ga0451837_1713807_362_1033 221
387 3300042007 Ga0439449_0020377 Ga0439449_0020377_704_1375 221
388 3300046513 Ga0495616_0100842 Ga0495616_0100842_316_987 221
389 3300046525 Ga0495663_0001434 Ga0495663_0001434_5770_6441 221
390 3300046692 Ga0495671_0005538 Ga0495671_0005538_969_1640 221
391 3300048911 Ga0496108_0319897 Ga0496108_0319897_502_1200 221
392 3300048926 Ga0496123_0160107 Ga0496123_0160107_410_1081 221
393 3300049571 Ga0501034_0083756 Ga0501034_0083756_656_1342 221
394 3300049574 Ga0501038_0106607 Ga0501038_0106607_1116_1802 221
395 3300049580 Ga0501046_0039025 Ga0501046_0039025_805_1491 221
396 3300049581 Ga0501047_0029824 Ga0501047_0029824_1913_2599 221
397 3300049586 Ga0501070_0265574 Ga0501070_0265574_69_755 221
398 3300049589 Ga0501073_0319438 Ga0501073_0319438_174_872 221
399 3300049741 Ga0501079_0260668 Ga0501079_0260668_33_719 221
400 3300049823 Ga0501044_0066121 Ga0501044_0066121_2974_3672 221
401 3300049823 Ga0501044_0118517 Ga0501044_0118517_1577_2263 221
402 3300053139 Ga0500568_0000233 Ga0500568_0000233_24657_25343 221
403 3300053731 Ga0500609_012751 Ga0500609_012751_426_1097 221
404 3300060353 Ga0501082_0000107 Ga0501082_0000107_12407_13093 221
405 3300001904 JGI24736J21556_1000668 JGI24736J21556_10006682 222
406 3300001915 JGI24741J21665_1000513 JGI24741J21665_10005139 222
407 3300001979 JGI24740J21852_10000733 JGI24740J21852_100007339 222
408 3300005329 Ga0070683_100148995 Ga0070683_1001489951 222
409 3300005355 Ga0070671_100045193 Ga0070671_1000451933 222
410 3300005367 Ga0070667_100041398 Ga0070667_1000413983 222
411 3300005458 Ga0070681_10009167 Ga0070681_100091673 222
412 3300005458 Ga0070681_10754860 Ga0070681_107548601 222
413 3300005530 Ga0070679_100164520 Ga0070679_1001645204 222
414 3300005530 Ga0070679_100819986 Ga0070679_1008199861 222
415 3300005535 Ga0070684_100048363 Ga0070684_1000483633 222
416 3300005535 Ga0070684_100152602 Ga0070684_1001526023 222
417 3300005539 Ga0068853_100047267 Ga0068853_1000472674 222
418 3300005548 Ga0070665_100219067 Ga0070665_1002190672 222
419 3300005563 Ga0068855_100384484 Ga0068855_1003844842 222
420 3300005564 Ga0070664_100023351 Ga0070664_1000233515 222
421 3300005564 Ga0070664_100203877 Ga0070664_1002038772 222
422 3300005577 Ga0068857_100182944 Ga0068857_1001829443 222
423 3300005578 Ga0068854_100024611 Ga0068854_1000246115 222
424 3300005616 Ga0068852_100082660 Ga0068852_1000826602 222
425 3300005834 Ga0068851_10035589 Ga0068851_100355893 222
426 3300005841 Ga0068863_100240960 Ga0068863_1002409603 222
427 3300006237 Ga0097621_100206800 Ga0097621_1002068004 222
428 3300006358 Ga0068871_100039983 Ga0068871_1000399833 222
429 3300006358 Ga0068871_100199111 Ga0068871_1001991111 222
430 3300006358 Ga0068871_100215267 Ga0068871_1002152672 222
431 3300009176 Ga0105242_10675965 Ga0105242_106759652 222
432 3300009177 Ga0105248_10309656 Ga0105248_103096563 222
433 3300009551 Ga0105238_10110821 Ga0105238_101108213 222
434 3300010375 Ga0105239_10107680 Ga0105239_101076801 222
435 3300013102 Ga0157371_10190065 Ga0157371_101900652 222
436 3300013296 Ga0157374_10625115 Ga0157374_106251151 222
437 3300013307 Ga0157372_10051825 Ga0157372_100518253 222
438 3300013307 Ga0157372_10057810 Ga0157372_100578103 222
439 3300014969 Ga0157376_10002494 Ga0157376_100024943 222
440 3300020070 Ga0206356_11576430 Ga0206356_115764302 222
441 3300025903 Ga0207680_10180954 Ga0207680_101809542 222
442 3300025904 Ga0207647_10003112 Ga0207647_100031122 222
443 3300025904 Ga0207647_10138743 Ga0207647_101387431 222
444 3300025909 Ga0207705_10002108 Ga0207705_100021087 222
445 3300025912 Ga0207707_10000065 Ga0207707_1000006593 222
446 3300025912 Ga0207707_10000578 Ga0207707_100005783 222
447 3300025914 Ga0207671_10249251 Ga0207671_102492513 222
448 3300025917 Ga0207660_10006903 Ga0207660_100069037 222
449 3300025917 Ga0207660_10184679 Ga0207660_101846791 222
450 3300025919 Ga0207657_10256498 Ga0207657_102564982 222
451 3300025919 Ga0207657_10483215 Ga0207657_104832151 222
452 3300025921 Ga0207652_10069249 Ga0207652_100692491 222
453 3300025921 Ga0207652_10378129 Ga0207652_103781292 222
454 3300025925 Ga0207650_10328626 Ga0207650_103286261 222
455 3300025933 Ga0207706_10316978 Ga0207706_103169782 222
456 3300025944 Ga0207661_10266777 Ga0207661_102667773 222
457 3300025944 Ga0207661_10289978 Ga0207661_102899783 222
458 3300025945 Ga0207679_10026576 Ga0207679_100265763 222
459 3300025949 Ga0207667_10008297 Ga0207667_100082978 222
460 3300025960 Ga0207651_10070326 Ga0207651_100703262 222
461 3300025981 Ga0207640_10002592 Ga0207640_1000259210 222
462 3300025981 Ga0207640_10053751 Ga0207640_100537513 222
463 3300025981 Ga0207640_10135130 Ga0207640_101351301 222
464 3300026023 Ga0207677_10008057 Ga0207677_100080575 222
465 3300026041 Ga0207639_10007675 Ga0207639_100076753 222
466 3300026116 Ga0207674_10008726 Ga0207674_100087267 222
467 3300026116 Ga0207674_10049463 Ga0207674_100494632 222
468 3300026142 Ga0207698_10079744 Ga0207698_100797443 222
469 3300026142 Ga0207698_10121696 Ga0207698_101216961 222
470 3300041406 Ga0439439_0014291 Ga0439439_0014291_359_1045 222
471 3300042004 Ga0439445_0014309 Ga0439445_0014309_886_1572 222
472 3300049573 Ga0501037_0378757 Ga0501037_0378757_99_836 222
473 3300049589 Ga0501073_0021629 Ga0501073_0021629_1305_2042 222
474 3300049822 Ga0501035_0160760 Ga0501035_0160760_910_1647 222
475 iso_pu_bacteria 8003014200 8003015465 222
476 3300003187 JGI25151J46595_10000102 JGI25151J46595_100001025 223
477 3300005355 Ga0070671_100069039 Ga0070671_1000690394 223
478 3300005548 Ga0070665_100832480 Ga0070665_1008324802 223
479 3300025245 Ga0207425_1010986 Ga0207425_10109861 223
480 3300025294 Ga0209025_1000006 Ga0209025_1000006653 223
481 3300025297 Ga0209758_1006577 Ga0209758_10065774 223
482 3300025920 Ga0207649_10385596 Ga0207649_103855961 223
483 3300025931 Ga0207644_10017204 Ga0207644_100172043 223
484 3300025933 Ga0207706_10795698 Ga0207706_107956981 223
485 3300028379 Ga0268266_10688073 Ga0268266_106880731 223
486 3300031901 Ga0307406_10003433 Ga0307406_100034334 223
487 3300041407 Ga0439447_000276 Ga0439447_000276_9916_10599 223
488 3300046616 Ga0495668_0002964 Ga0495668_0002964_12192_12875 223
489 3300048912 Ga0496109_0074224 Ga0496109_0074224_1597_2271 223
490 3300048915 Ga0496112_0501297 Ga0496112_0501297_101_775 223
491 3300048916 Ga0496113_0071099 Ga0496113_0071099_337_1011 223
492 iso_pu_bacteria 2643221573 2643880455 223
493 iso_pu_bacteria 2643221593 2643973376 223
494 iso_pu_bacteria 2643221720 2644661030 223
495 iso_pu_bacteria 2643221728 2644699112 223
496 3300002741 JGI25157J39369_1005706 JGI25157J39369_10057062 224
497 3300003773 Ga0055537_1000059 Ga0055537_100005914 224
498 3300003775 Ga0055524_1000019 Ga0055524_1000019197 224
499 3300003784 Ga0055534_1000012 Ga0055534_100001219 224
500 3300003790 Ga0055528_1000007 Ga0055528_100000719 224
501 3300015265 Ga0182005_1002582 Ga0182005_10025823 224
502 3300025250 Ga0209026_1000045 Ga0209026_100004518 224
503 3300025256 Ga0209759_1000850 Ga0209759_100085010 224
504 3300025263 Ga0209565_1000001 Ga0209565_1000001438 224
505 3300025273 Ga0209673_1000001 Ga0209673_1000001438 224
506 3300025291 Ga0209675_1000001 Ga0209675_10000012094 224
507 3300025295 Ga0209564_1000001 Ga0209564_10000012256 224
508 3300025299 Ga0209256_1000006 Ga0209256_1000006692 224
509 3300031665 Ga0316575_10014957 Ga0316575_100149573 224
510 3300044536 Ga0466988_0067231 Ga0466988_0067231_848_1552 224
511 3300046615 Ga0495656_0003859 Ga0495656_0003859_3437_4123 224
512 3300047318 Ga0495636_0006456 Ga0495636_0006456_2343_3029 224
513 3300049568 Ga0501031_0060029 Ga0501031_0060029_1786_2466 224
514 3300049570 Ga0501033_0120810 Ga0501033_0120810_204_884 224
515 3300049572 Ga0501036_0098252 Ga0501036_0098252_1623_2303 224
516 3300049573 Ga0501037_0067090 Ga0501037_0067090_953_1633 224
517 3300049574 Ga0501038_0390874 Ga0501038_0390874_285_965 224
518 3300049575 Ga0501039_0109320 Ga0501039_0109320_1105_1785 224
519 3300049586 Ga0501070_0053490 Ga0501070_0053490_980_1660 224
520 3300049762 Ga0501265_008607 Ga0501265_008607_66_785 224
521 3300049772 Ga0501275_000512 Ga0501275_000512_3212_3931 224
522 3300049822 Ga0501035_0013478 Ga0501035_0013478_2563_3243 224
523 3300061719 Ga0466962_0012963 Ga0466962_0012963_204_908 224
524 3300005535 Ga0070684_100585753 Ga0070684_1005857532 225
525 3300005539 Ga0068853_100020141 Ga0068853_1000201412 225
526 3300005563 Ga0068855_100640412 Ga0068855_1006404122 225
527 3300005578 Ga0068854_100546565 Ga0068854_1005465651 225
528 3300025893 Ga0207682_10063268 Ga0207682_100632684 225
529 3300025907 Ga0207645_10106425 Ga0207645_101064252 225
530 3300025944 Ga0207661_10071965 Ga0207661_100719654 225
531 3300026088 Ga0207641_10221528 Ga0207641_102215283 225
532 3300026089 Ga0207648_10071014 Ga0207648_100710143 225
533 3300005331 Ga0070670_100510566 Ga0070670_1005105662 226
534 3300005458 Ga0070681_10191941 Ga0070681_101919413 226
535 3300025913 Ga0207695_10015003 Ga0207695_100150033 226
536 3300025940 Ga0207691_10019067 Ga0207691_100190678 226
537 3300031995 Ga0307409_100899672 Ga0307409_1008996721 226
538 3300032004 Ga0307414_10170466 Ga0307414_101704662 226
539 3300046537 Ga0495598_0075565 Ga0495598_0075565_70_792 226
540 3300046539 Ga0495621_0001934 Ga0495621_0001934_4173_4895 226
541 3300046615 Ga0495656_0006771 Ga0495656_0006771_121_819 226
542 3300046691 Ga0495670_0236149 Ga0495670_0236149_47_769 226
543 3300048090 Ga0495615_0003458 Ga0495615_0003458_1793_2515 226
544 3300049569 Ga0501032_0085227 Ga0501032_0085227_747_1469 226
545 3300049570 Ga0501033_0000648 Ga0501033_0000648_1481_2191 226
546 3300049570 Ga0501033_0137547 Ga0501033_0137547_666_1388 226
547 3300049571 Ga0501034_0300286 Ga0501034_0300286_354_1064 226
548 3300049572 Ga0501036_0008180 Ga0501036_0008180_762_1472 226
549 3300049573 Ga0501037_0127846 Ga0501037_0127846_552_1262 226
550 3300049574 Ga0501038_0054955 Ga0501038_0054955_2360_3070 226
551 3300049574 Ga0501038_0187968 Ga0501038_0187968_745_1467 226
552 3300049579 Ga0501043_0016644 Ga0501043_0016644_325_1035 226
553 3300049579 Ga0501043_0100193 Ga0501043_0100193_802_1524 226
554 3300049580 Ga0501046_0048382 Ga0501046_0048382_2495_3205 226
555 3300049580 Ga0501046_0094391 Ga0501046_0094391_662_1372 226
556 3300049581 Ga0501047_0196976 Ga0501047_0196976_788_1510 226
557 3300049581 Ga0501047_0261424 Ga0501047_0261424_450_1160 226
558 3300049584 Ga0501068_0041232 Ga0501068_0041232_638_1360 226
559 3300049584 Ga0501068_0305055 Ga0501068_0305055_147_857 226
560 3300049586 Ga0501070_0100683 Ga0501070_0100683_668_1390 226
561 3300049586 Ga0501070_0254009 Ga0501070_0254009_375_1085 226
562 3300049589 Ga0501073_0094089 Ga0501073_0094089_717_1439 226
563 3300049589 Ga0501073_0186270 Ga0501073_0186270_353_1063 226
564 3300049590 Ga0501074_0050760 Ga0501074_0050760_1304_2014 226
565 3300049741 Ga0501079_0055881 Ga0501079_0055881_1339_2049 226
566 3300049742 Ga0501080_0309982 Ga0501080_0309982_368_1078 226
567 3300049744 Ga0501083_0117151 Ga0501083_0117151_35_745 226
568 3300049822 Ga0501035_0156946 Ga0501035_0156946_515_1237 226
569 3300049822 Ga0501035_0785746 Ga0501035_0785746_27_737 226
570 3300049823 Ga0501044_0004071 Ga0501044_0004071_9623_10333 226
571 3300049823 Ga0501044_0155242 Ga0501044_0155242_745_1467 226
572 3300005288 Ga0065714_10073865 Ga0065714_100738655 227
573 3300005293 Ga0065715_10210857 Ga0065715_102108573 227
574 3300027876 Ga0209974_10040660 Ga0209974_100406603 227
575 3300037466 Ga0395898_0812526 Ga0395898_0812526_50_763 227
576 3300044684 Ga0466966_0043419 Ga0466966_0043419_2072_2812 227
577 3300044765 Ga0466970_0342560 Ga0466970_0342560_68_808 227
578 3300045049 Ga0466959_0030265 Ga0466959_0030265_2474_3214 227
579 3300045836 Ga0466958_0289006 Ga0466958_0289006_56_796 227
580 3300013100 Ga0157373_10012798 Ga0157373_100127985 228
581 3300037471 Ga0395905_0246134 Ga0395905_0246134_712_1437 228
582 iso_pu_bacteria 2576861471 2578456967 228
583 iso_pu_bacteria 2857442823 2857447000 228
584 iso_pu_bacteria 2939589442 2939589840 228
585 iso_pu_bacteria 2939622612 2939624953 228
586 iso_pu_bacteria 2974307012 2974307615 228
587 iso_pu_bacteria 2977247770 2977248326 228
588 iso_pu_bacteria 2984514374 2984517181 228
589 iso_pu_bacteria 2987605356 2987608827 228
590 3300048926 Ga0496123_0005271 Ga0496123_0005271_340_1032 229
591 iso_pu_bacteria 2547132130 2547503589 229
592 iso_pu_bacteria 2747842428 2747949943 229
593 iso_pu_bacteria 2765235840 2765580539 229
594 iso_pu_bacteria 2816332141 2816518437 229
595 iso_pu_bacteria 2842391507 2842394454 229
596 iso_pu_bacteria 2919134579 2919138752 229
597 iso_pu_bacteria 2961064222 2961064871 229
598 3300048929 Ga0496126_0297614 Ga0496126_0297614_299_1012 230
599 3300032004 Ga0307414_10322283 Ga0307414_103222832 231
600 iso_pu_bacteria 8021648035 8021649751 231
601 3300003771 Ga0055526_1006479 Ga0055526_10064795 232
602 3300003773 Ga0055537_1001365 Ga0055537_10013659 232
603 3300003781 Ga0055536_1018818 Ga0055536_10188181 232
604 3300003784 Ga0055534_1000112 Ga0055534_10001122 232
605 3300003790 Ga0055528_1001337 Ga0055528_10013373 232
606 3300003791 Ga0055530_10001674 Ga0055530_1000167411 232
607 3300003791 Ga0055530_10002094 Ga0055530_1000209413 232
608 3300003794 Ga0055531_10013881 Ga0055531_100138814 232
609 3300003794 Ga0055531_10024818 Ga0055531_100248181 232
610 3300014497 Ga0182008_10029210 Ga0182008_100292102 232
611 3300015261 Ga0182006_1053246 Ga0182006_10532462 232
612 3300017792 Ga0163161_10073490 Ga0163161_100734903 232
613 3300025263 Ga0209565_1000060 Ga0209565_1000060120 232
614 3300025273 Ga0209673_1000047 Ga0209673_100004742 232
615 3300025291 Ga0209675_1000007 Ga0209675_1000007560 232
616 3300025295 Ga0209564_1000252 Ga0209564_100025219 232
617 3300025298 Ga0209050_1000146 Ga0209050_100014615 232
618 3300025304 Ga0209257_1010878 Ga0209257_10108782 232
619 3300030735 Ga0316178_1024454 Ga0316178_10244542 232
620 3300030742 Ga0316183_1013189 Ga0316183_10131892 232
621 3300042006 Ga0439432_030801 Ga0439432_030801_705_1412 232
622 3300046453 Ga0495627_018790 Ga0495627_018790_1292_1999 232
623 3300046512 Ga0495610_0004897 Ga0495610_0004897_527_1234 232
624 3300046518 Ga0495631_0003548 Ga0495631_0003548_6508_7215 232
625 3300046522 Ga0495643_0010311 Ga0495643_0010311_1999_2706 232
626 3300046660 Ga0495625_0107781 Ga0495625_0107781_70_777 232
627 3300046810 Ga0495660_0026804 Ga0495660_0026804_386_1093 232
628 3300047320 Ga0495672_0000087 Ga0495672_0000087_10727_11434 232
629 3300047320 Ga0495672_0055159 Ga0495672_0055159_624_1331 232
630 3300047472 Ga0495686_0038417 Ga0495686_0038417_1155_1862 232
631 3300048920 Ga0496117_0028737 Ga0496117_0028737_1104_1811 232
632 3300048920 Ga0496117_0034057 Ga0496117_0034057_892_1599 232
633 3300048921 Ga0496118_0035939 Ga0496118_0035939_1046_1753 232
634 3300048921 Ga0496118_0056691 Ga0496118_0056691_1691_2398 232
635 3300048927 Ga0496124_0038566 Ga0496124_0038566_2097_2804 232
636 3300048928 Ga0496125_0077822 Ga0496125_0077822_1056_1763 232
637 3300048929 Ga0496126_0176797 Ga0496126_0176797_1036_1743 232
638 3300050491 nmdc:mga00v17_153920_c1 nmdc:mga00v17_153920_c1_17_724 232
639 3300003323 rootH1_10132375 rootH1_101323752 233
640 3300003794 Ga0055531_10025507 Ga0055531_100255071 233
641 3300005985 Ga0081539_10008186 Ga0081539_100081868 233
642 3300025284 Ga0209130_1014021 Ga0209130_10140212 233
643 3300025299 Ga0209256_1005932 Ga0209256_10059324 233
644 3300025901 Ga0207688_10169944 Ga0207688_101699442 233
645 3300027312 Ga0209371_1000018 Ga0209371_1000018534 233
646 3300030500 Ga0268256_1000016 Ga0268256_1000016534 233
647 iso_pu_bacteria 2818991457 2819661328 233
648 iso_pu_bacteria 2852684882 2852687199 233
649 iso_pu_bacteria 2919130084 2919131044 233
650 iso_pu_bacteria 2929195423 2929196283 233
651 3300049571 Ga0501034_0065145 Ga0501034_0065145_2539_3282 236
652 3300049572 Ga0501036_0031163 Ga0501036_0031163_2638_3381 236
653 3300049573 Ga0501037_0010898 Ga0501037_0010898_4887_5630 236
654 3300049574 Ga0501038_0049526 Ga0501038_0049526_698_1441 236
655 3300049581 Ga0501047_0082079 Ga0501047_0082079_1427_2170 236
656 3300049586 Ga0501070_0028917 Ga0501070_0028917_22_765 236
657 3300049822 Ga0501035_0062096 Ga0501035_0062096_1334_2077 236
658 3300049823 Ga0501044_0017726 Ga0501044_0017726_1144_1887 236
659 2162886007 SwRhRL2b_contig_1900888 SwRhRL2b_0158.00007100 237
660 3300005331 Ga0070670_100001962 Ga0070670_1000019627 237
661 3300009011 Ga0105251_10000205 Ga0105251_100002057 237
662 3300025735 Ga0207713_1000196 Ga0207713_100019626 237
663 3300025925 Ga0207650_10001926 Ga0207650_100019266 237
664 3300041459 Ga0451800_0141867 Ga0451800_0141867_3309_4028 237
665 3300041462 Ga0451806_117351 Ga0451806_117351_3105_3824 237
666 3300041486 Ga0451807_1394303 Ga0451807_1394303_1434_2153 237
667 3300048920 Ga0496117_0009829 Ga0496117_0009829_7485_8198 237
668 3300048921 Ga0496118_0183806 Ga0496118_0183806_84_797 237
669 3300048922 Ga0496119_0001836 Ga0496119_0001836_21371_22084 237
670 3300048923 Ga0496120_0000273 Ga0496120_0000273_63612_64325 237
671 3300048925 Ga0496122_0000417 Ga0496122_0000417_73631_74344 237
672 3300048926 Ga0496123_0000137 Ga0496123_0000137_129022_129735 237
673 3300048927 Ga0496124_0003391 Ga0496124_0003391_16102_16815 237

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21948

LplA-B_cat

Lipoyl protein ligase A/B catalytic domain

66

250

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qhv-assembly1.cif.gz_A structural basis of octanoic acid recognition by lipoate-protein ligase b 0.9035 20 225
1w66-assembly1.cif.gz_A structure of a lipoate-protein ligase b from mycobacterium tuberculosis 0.9011 21 220
2qhv-assembly1.cif.gz_A structural basis of octanoic acid recognition by lipoate-protein ligase b 0.8829 20 225
2aru-assembly1.cif.gz_A crystal structure of lipoate-protein ligase a bound with atp 0.8271 20 228
1w66-assembly1.cif.gz_A structure of a lipoate-protein ligase b from mycobacterium tuberculosis 0.8267 21 220
ID Description Score Start End Superfamily
af_P60720_2_203_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.9822 21 217 3.30.930.10
af_P60720_2_203_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.9535 21 217 3.30.930.10
af_Q9SXP7_6_215_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.9468 21 218 3.30.930.10
2qhuA01 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.9243 21 219 3.30.930.10
af_O36017_5_216_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.9214 30 217 3.30.930.10
ID Description Score Start End GO Terms
AF-A0A3B0VSD3-F1-model_v4 lipoyl(octanoyl) transferase (EC 2.3.1.181) 0.9952 20 108 GO:0033819
AF-A0A3D3D3L3-F1-model_v4 deleted 0.9931 22 99
AF-A0A090P1B0-F1-model_v4 deleted 0.9919 21 139
AF-A0A2J0QT14-F1-model_v4 deleted 0.9916 76 181
AF-A0A7Z7KMB8-F1-model_v4 deleted 0.9907 21 104

Feature Viewer

pLDDT pTM Quality
89.51 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map