F474210

General Info

Members Datasets Scaffolds Average Seq Length
672 314 672 170

Family's Representative Sequence

Representative Sequence 3300005353|Ga0070669_100431524|Ga0070669_1004315242
Length 186
Sequence MLFVDLLRLTVLVIGGSATALGAVTVIAAKLEADDATLIFAGAWWLVAAALGIFLGASSRAGEAMARALASARTATALPTESPGRIAFLRLWPVGAFSLLVGGVAWLFPQVAAVGAGFAVLNALAWRNRERAVTAIEERDGVRFYVEPTSALEPIKLIRTPGLGRDRMPAGHPDEATRLIRMPDGR

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
65 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
66 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
67 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
68 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
69 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
70 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
71 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
156 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
160 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
161 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
162 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
163 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
164 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
165 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
166 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
167 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
168 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
169 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
170 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
171 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
172 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
173 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
174 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
175 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
176 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
177 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
178 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
179 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
180 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
181 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
182 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
183 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
184 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
185 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
186 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
187 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
188 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
189 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
190 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
191 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
192 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
193 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
194 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
195 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
196 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
197 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
198 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
199 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
200 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
201 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
202 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
203 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
204 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
205 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
206 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
207 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
208 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
209 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
210 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
211 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
212 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
213 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
214 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
215 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
216 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
217 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
218 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
219 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
220 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
221 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
222 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
223 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
224 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
225 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
226 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
227 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
228 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
229 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
230 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
231 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
232 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
233 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
234 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
235 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
236 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
237 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
238 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
239 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
240 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
241 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
242 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
243 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
244 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
245 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
246 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
247 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
248 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
249 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
250 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
251 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
252 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
253 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
254 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
255 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
256 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
257 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
258 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
259 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
260 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
261 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
262 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
263 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
264 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
265 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
266 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
267 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
268 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
269 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
270 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
276 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
280 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
281 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
282 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
283 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
284 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
285 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
286 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
287 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
288 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
289 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
290 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
291 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
292 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
294 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
295 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
296 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
297 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
298 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
299 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
300 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
301 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
302 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
303 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
304 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
305 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
306 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
307 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
308 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
309 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
310 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
311 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
312 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
313 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
314 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.49
Nodule 0
Rhizoplane 9.38
Rhizosphere 87.05
Stem 0
Stem Tuber 0
Unclassified 2.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1001937 3300001977 Bacteria 3296
2 JGI24740J21852_10000392 3300001979 Bacteria 18771
3 JGI25406J46586_10018654 3300003203 Bacteria 2847
4 JGI25407J50210_10031519 3300003373 Bacteria 1372
5 Ga0070658_11225640 3300005327 Bacteria 652
6 Ga0070683_100011292 3300005329 Bacteria 7711
7 Ga0070683_100132025 3300005329 Bacteria 2364
8 Ga0070683_100166626 3300005329 Bacteria 2091
9 Ga0070683_100200901 3300005329 Bacteria 1893
10 Ga0070683_100204451 3300005329 Bacteria 1876
11 Ga0070683_100218918 3300005329 Bacteria 1809
12 Ga0070670_100661160 3300005331 Unclassified 938
13 Ga0070670_100795377 3300005331 Bacteria 854
14 Ga0068869_100304890 3300005334 Bacteria 1287
15 Ga0070666_10130504 3300005335 Bacteria 1746
16 Ga0068868_100000630 3300005338 Bacteria 23709
17 Ga0068868_100007830 3300005338 Bacteria 7627
18 Ga0068868_100013387 3300005338 Bacteria 6016
19 Ga0068868_100581851 3300005338 Bacteria 990
20 Ga0070660_100360022 3300005339 Bacteria 1199
21 Ga0070660_100881979 3300005339 Bacteria 754
22 Ga0070660_101261583 3300005339 Unclassified 627
23 Ga0070689_100118366 3300005340 Bacteria 2113
24 Ga0070689_100275718 3300005340 Bacteria 1394
25 Ga0070691_10000124 3300005341 Bacteria 23289
26 Ga0070691_10121755 3300005341 Bacteria 1314
27 Ga0070661_100000045 3300005344 Bacteria 94702
28 Ga0070692_10085595 3300005345 Bacteria 1705
29 Ga0070668_100019444 3300005347 Bacteria 5112
30 Ga0070668_100065392 3300005347 Bacteria 2821
31 Ga0070668_100430500 3300005347 Bacteria 1131
32 Ga0070668_100789921 3300005347 Unclassified 843
33 Ga0070669_100431524 3300005353 Bacteria 1083
34 Ga0070675_100000187 3300005354 Bacteria 38675
35 Ga0070675_100251789 3300005354 Bacteria 1546
36 Ga0070671_100042553 3300005355 Bacteria 3776
37 Ga0070674_100000011 3300005356 Bacteria 134886
38 Ga0070674_100427065 3300005356 Bacteria 1089
39 Ga0070674_100606498 3300005356 Bacteria 925
40 Ga0070673_100000804 3300005364 Bacteria 17538
41 Ga0070673_100246723 3300005364 Bacteria 1555
42 Ga0070659_100063795 3300005366 Bacteria 2915
43 Ga0070659_100304430 3300005366 Bacteria 1330
44 Ga0070659_100457757 3300005366 Bacteria 1083
45 Ga0070659_100773351 3300005366 Bacteria 834
46 Ga0070667_100000374 3300005367 Bacteria 48918
47 Ga0070714_100042858 3300005435 Bacteria 3825
48 Ga0070714_100047621 3300005435 Bacteria 3643
49 Ga0070710_10321379 3300005437 Unclassified 1016
50 Ga0070701_10318101 3300005438 Bacteria 962
51 Ga0070711_100037276 3300005439 Bacteria 3262
52 Ga0070705_100338113 3300005440 Bacteria 1093
53 Ga0070700_100024596 3300005441 Bacteria 3538
54 Ga0070700_100057935 3300005441 Bacteria 2432
55 Ga0070694_100113332 3300005444 Bacteria 1935
56 Ga0070694_100178997 3300005444 Bacteria 1567
57 Ga0070663_100000698 3300005455 Bacteria 18086
58 Ga0070663_100015088 3300005455 Bacteria 4974
59 Ga0070663_100459301 3300005455 Bacteria 1051
60 Ga0070663_100634852 3300005455 Bacteria 902
61 Ga0070663_101416483 3300005455 Unclassified 616
62 Ga0070678_100070973 3300005456 Bacteria 2606
63 Ga0070678_100159308 3300005456 Bacteria 1827
64 Ga0070678_100213808 3300005456 Bacteria 1599
65 Ga0070662_100000008 3300005457 Bacteria 168754
66 Ga0070681_10469373 3300005458 Bacteria 1171
67 Ga0068867_100640815 3300005459 Bacteria 931
68 Ga0068867_101077033 3300005459 Bacteria 733
69 Ga0070685_10002681 3300005466 Bacteria 9110
70 Ga0070685_10038181 3300005466 Bacteria 2723
71 Ga0070685_10089592 3300005466 Bacteria 1860
72 Ga0070685_10476139 3300005466 Bacteria 879
73 Ga0070707_100509138 3300005468 Bacteria 1166
74 Ga0070679_100006106 3300005530 Bacteria 11207
75 Ga0070679_100562483 3300005530 Bacteria 1084
76 Ga0070684_100014039 3300005535 Bacteria 6477
77 Ga0070684_100036375 3300005535 Bacteria 4218
78 Ga0070684_100406798 3300005535 Bacteria 1255
79 Ga0070684_100730482 3300005535 Bacteria 924
80 Ga0070684_100902870 3300005535 Bacteria 828
81 Ga0068853_100092136 3300005539 Bacteria 2666
82 Ga0068853_101544668 3300005539 Bacteria 643
83 Ga0070672_100000003 3300005543 Bacteria 159532
84 Ga0070686_100965392 3300005544 Bacteria 697
85 Ga0070695_100325927 3300005545 Bacteria 1143
86 Ga0070695_100442849 3300005545 Bacteria 994
87 Ga0070695_100496326 3300005545 Bacteria 943
88 Ga0070696_100281907 3300005546 Bacteria 1267
89 Ga0070696_100997958 3300005546 Bacteria 699
90 Ga0070696_101187887 3300005546 Bacteria 644
91 Ga0070693_100711599 3300005547 Bacteria 736
92 Ga0070704_100044190 3300005549 Bacteria 3094
93 Ga0070704_100491076 3300005549 Bacteria 1064
94 Ga0068855_100629730 3300005563 Bacteria 1154
95 Ga0070664_100017819 3300005564 Bacteria 5832
96 Ga0070664_100114129 3300005564 Bacteria 2360
97 Ga0070664_100532737 3300005564 Bacteria 1085
98 Ga0070664_100579871 3300005564 Bacteria 1039
99 Ga0070664_100808496 3300005564 Bacteria 877
100 Ga0068857_100044619 3300005577 Bacteria 3933
101 Ga0068857_100633759 3300005577 Bacteria 1012
102 Ga0068857_101018018 3300005577 Unclassified 798
103 Ga0068854_100005403 3300005578 Bacteria 8067
104 Ga0068854_100210015 3300005578 Bacteria 1535
105 Ga0068854_100506719 3300005578 Bacteria 1017
106 Ga0068856_100005550 3300005614 Bacteria 12425
107 Ga0068856_100016706 3300005614 Bacteria 7108
108 Ga0068856_101617584 3300005614 Bacteria 661
109 Ga0070702_100089804 3300005615 Bacteria 1861
110 Ga0070702_100144761 3300005615 Bacteria 1518
111 Ga0070702_100582319 3300005615 Bacteria 836
112 Ga0068852_100575123 3300005616 Bacteria 1129
113 Ga0068852_101446079 3300005616 Bacteria 710
114 Ga0068859_100703707 3300005617 Bacteria 1101
115 Ga0068864_100035240 3300005618 Bacteria 4259
116 Ga0068864_101297641 3300005618 Unclassified 728
117 Ga0068866_10000002 3300005718 Bacteria 394090
118 Ga0068851_10022018 3300005834 Bacteria 3100
119 Ga0068870_10102758 3300005840 Bacteria 1618
120 Ga0068863_100000042 3300005841 Bacteria 154459
121 Ga0068863_100282913 3300005841 Bacteria 1607
122 Ga0068858_100119035 3300005842 Bacteria 2469
123 Ga0068858_101157919 3300005842 Bacteria 760
124 Ga0068860_100100342 3300005843 Bacteria 2762
125 Ga0068862_100000278 3300005844 Bacteria 57006
126 Ga0068862_100192889 3300005844 Bacteria 1834
127 Ga0081455_10008890 3300005937 Bacteria 10385
128 Ga0081455_10013749 3300005937 Bacteria 7967
129 Ga0081455_10023617 3300005937 Bacteria 5716
130 Ga0081455_10077124 3300005937 Unclassified 2743
131 Ga0081455_10122076 3300005937 Bacteria 2051
132 Ga0081538_10000672 3300005981 Bacteria 37620
133 Ga0081538_10047438 3300005981 Bacteria 2634
134 Ga0081538_10138040 3300005981 Bacteria 1130
135 Ga0081538_10161820 3300005981 Unclassified 993
136 Ga0081540_1000126 3300005983 Bacteria 81203
137 Ga0081540_1000197 3300005983 Bacteria 62537
138 Ga0081539_10003805 3300005985 Bacteria 17759
139 Ga0081539_10028605 3300005985 Bacteria 3501
140 Ga0081539_10028719 3300005985 Unclassified 3493
141 Ga0075365_10001083 3300006038 Bacteria 11826
142 Ga0075365_10007080 3300006038 Bacteria 6250
143 Ga0075364_10022106 3300006051 Bacteria 4014
144 Ga0075432_10090093 3300006058 Bacteria 1122
145 Ga0070715_10000015 3300006163 Bacteria 152816
146 Ga0070716_100166796 3300006173 Bacteria 1433
147 Ga0070712_100028261 3300006175 Bacteria 3750
148 Ga0070712_100058438 3300006175 Bacteria 2713
149 Ga0070712_100114183 3300006175 Bacteria 2021
150 Ga0075367_10071294 3300006178 Bacteria 2090
151 Ga0068871_100544773 3300006358 Bacteria 1050
152 Ga0068871_101435956 3300006358 Bacteria 651
153 Ga0075428_100045652 3300006844 Bacteria 4813
154 Ga0075428_100082542 3300006844 Bacteria 3507
155 Ga0075430_100022244 3300006846 Bacteria 5393
156 Ga0075430_100255751 3300006846 Unclassified 1451
157 Ga0075431_100000960 3300006847 Bacteria 25567
158 Ga0075431_100531887 3300006847 Unclassified 1164
159 Ga0075431_100534343 3300006847 Bacteria 1161
160 Ga0075431_100655129 3300006847 Bacteria 1030
161 Ga0075433_10010256 3300006852 Bacteria 7515
162 Ga0075434_100003617 3300006871 Bacteria 13797
163 Ga0075434_100189946 3300006871 Bacteria 2074
164 Ga0075434_100296494 3300006871 Bacteria 1637
165 Ga0075434_100872329 3300006871 Bacteria 915
166 Ga0068865_100062494 3300006881 Bacteria 2614
167 Ga0068865_101299922 3300006881 Unclassified 647
168 Ga0068865_101469688 3300006881 Bacteria 610
169 Ga0075436_100065903 3300006914 Bacteria 2503
170 Ga0097620_100703675 3300006931 Bacteria 1101
171 Ga0105240_10063125 3300009093 Bacteria 4609
172 Ga0105240_10450313 3300009093 Bacteria 1441
173 Ga0111539_10009234 3300009094 Bacteria 12462
174 Ga0111539_10021383 3300009094 Bacteria 7964
175 Ga0111539_10065292 3300009094 Bacteria 4301
176 Ga0111539_10332640 3300009094 Bacteria 1768
177 Ga0105245_10000425 3300009098 Bacteria 39393
178 Ga0105245_10003240 3300009098 Bacteria 14580
179 Ga0105245_10011445 3300009098 Bacteria 7727
180 Ga0105245_10607744 3300009098 Bacteria 1120
181 Ga0105245_11238130 3300009098 Bacteria 794
182 Ga0114129_10002590 3300009147 Bacteria 25131
183 Ga0114129_10032655 3300009147 Bacteria 7355
184 Ga0114129_10794606 3300009147 Bacteria 1208
185 Ga0114129_10840677 3300009147 Unclassified 1168
186 Ga0105243_10021302 3300009148 Bacteria 4919
187 Ga0105243_10028552 3300009148 Bacteria 4283
188 Ga0105243_10355068 3300009148 Bacteria 1347
189 Ga0105243_10430997 3300009148 Bacteria 1232
190 Ga0105243_10479133 3300009148 Unclassified 1174
191 Ga0105242_10000975 3300009176 Bacteria 22368
192 Ga0105242_10218215 3300009176 Bacteria 1703
193 Ga0105242_10395813 3300009176 Bacteria 1288
194 Ga0105242_11470223 3300009176 Bacteria 711
195 Ga0105248_10181516 3300009177 Bacteria 2371
196 Ga0105237_10193645 3300009545 Bacteria 2033
197 Ga0105238_10000051 3300009551 Bacteria 141705
198 Ga0105238_10855761 3300009551 Bacteria 926
199 Ga0105249_10000085 3300009553 Bacteria 133497
200 Ga0105249_10004260 3300009553 Bacteria 12366
201 Ga0105249_10390570 3300009553 Bacteria 1420
202 Ga0105249_10458693 3300009553 Bacteria 1314
203 Ga0105239_10014993 3300010375 Bacteria 8591
204 Ga0105239_10837492 3300010375 Bacteria 1054
205 Ga0105239_11320221 3300010375 Bacteria 832
206 Ga0105239_11561949 3300010375 Bacteria 763
207 Ga0105239_11644988 3300010375 Bacteria 743
208 Ga0105246_10545038 3300011119 Bacteria 993
209 Ga0105246_11111435 3300011119 Bacteria 722
210 Ga0157374_10008161 3300013296 Bacteria 8949
211 Ga0157374_10030601 3300013296 Unclassified 4889
212 Ga0157378_10009908 3300013297 Bacteria 8306
213 Ga0157378_10144750 3300013297 Bacteria 2210
214 Ga0163162_10252839 3300013306 Bacteria 1894
215 Ga0163162_10723612 3300013306 Bacteria 1116
216 Ga0157372_10021012 3300013307 Bacteria 7047
217 Ga0157375_10071918 3300013308 Bacteria 3473
218 Ga0157375_10282617 3300013308 Bacteria 1822
219 Ga0163163_10132820 3300014325 Bacteria 2529
220 Ga0163163_10383221 3300014325 Bacteria 1463
221 Ga0163163_10634903 3300014325 Bacteria 1131
222 Ga0157380_10000017 3300014326 Bacteria 119468
223 Ga0157380_10000072 3300014326 Bacteria 56363
224 Ga0157380_10558060 3300014326 Unclassified 1125
225 Ga0157377_10000202 3300014745 Bacteria 33023
226 Ga0157379_10002830 3300014968 Bacteria 14625
227 Ga0157379_10091796 3300014968 Bacteria 2724
228 Ga0157379_10106090 3300014968 Bacteria 2522
229 Ga0157379_10120078 3300014968 Bacteria 2364
230 Ga0157379_10438288 3300014968 Bacteria 1205
231 Ga0157376_10121005 3300014969 Bacteria 2320
232 Ga0163161_10142522 3300017792 Bacteria 1815
233 Ga0207682_10000457 3300025893 Bacteria 18841
234 Ga0207692_10419080 3300025898 Unclassified 838
235 Ga0207642_10000001 3300025899 Bacteria 714030
236 Ga0207642_10000003 3300025899 Bacteria 650651
237 Ga0207642_10358057 3300025899 Bacteria 863
238 Ga0207688_10004236 3300025901 Bacteria 7819
239 Ga0207688_10020234 3300025901 Bacteria 3633
240 Ga0207688_10324552 3300025901 Bacteria 945
241 Ga0207680_10411618 3300025903 Bacteria 957
242 Ga0207685_10000001 3300025905 Bacteria 604473
243 Ga0207645_10134516 3300025907 Bacteria 1610
244 Ga0207643_10045902 3300025908 Bacteria 2469
245 Ga0207643_10053322 3300025908 Bacteria 2297
246 Ga0207643_10145792 3300025908 Bacteria 1416
247 Ga0207643_10371112 3300025908 Bacteria 901
248 Ga0207693_10008956 3300025915 Bacteria 8168
249 Ga0207693_10018190 3300025915 Bacteria 5599
250 Ga0207693_10025456 3300025915 Bacteria 4692
251 Ga0207663_10047827 3300025916 Bacteria 2643
252 Ga0207657_10257700 3300025919 Bacteria 1389
253 Ga0207649_10000021 3300025920 Bacteria 209660
254 Ga0207652_10008471 3300025921 Bacteria 8274
255 Ga0207646_10252262 3300025922 Bacteria 1594
256 Ga0207681_10605440 3300025923 Bacteria 906
257 Ga0207694_10000035 3300025924 Bacteria 195870
258 Ga0207650_10451257 3300025925 Bacteria 1070
259 Ga0207659_10000074 3300025926 Bacteria 63348
260 Ga0207659_10055358 3300025926 Bacteria 2837
261 Ga0207687_10000021 3300025927 Bacteria 226396
262 Ga0207687_10012274 3300025927 Bacteria 5603
263 Ga0207687_10020408 3300025927 Bacteria 4395
264 Ga0207664_10258909 3300025929 Bacteria 1521
265 Ga0207690_10055624 3300025932 Bacteria 2666
266 Ga0207690_10368001 3300025932 Bacteria 1140
267 Ga0207690_10457079 3300025932 Bacteria 1027
268 Ga0207706_10000016 3300025933 Bacteria 170697
269 Ga0207706_10044210 3300025933 Bacteria 3948
270 Ga0207706_10576692 3300025933 Bacteria 967
271 Ga0207706_10591398 3300025933 Bacteria 954
272 Ga0207686_10000418 3300025934 Bacteria 28994
273 Ga0207686_10373022 3300025934 Bacteria 1080
274 Ga0207686_10983465 3300025934 Bacteria 684
275 Ga0207709_10027029 3300025935 Bacteria 3302
276 Ga0207709_10562161 3300025935 Unclassified 898
277 Ga0207669_10000027 3300025937 Bacteria 91216
278 Ga0207669_10837942 3300025937 Bacteria 765
279 Ga0207704_10021680 3300025938 Bacteria 3427
280 Ga0207704_10311339 3300025938 Bacteria 1211
281 Ga0207704_10487627 3300025938 Bacteria 991
282 Ga0207704_10896565 3300025938 Unclassified 745
283 Ga0207665_10105338 3300025939 Bacteria 1975
284 Ga0207691_10000005 3300025940 Bacteria 163117
285 Ga0207691_10322078 3300025940 Bacteria 1325
286 Ga0207711_10220126 3300025941 Bacteria 1736
287 Ga0207689_10007500 3300025942 Bacteria 9562
288 Ga0207661_10000145 3300025944 Bacteria 45007
289 Ga0207661_10030094 3300025944 Bacteria 4178
290 Ga0207661_10097221 3300025944 Bacteria 2465
291 Ga0207679_10057576 3300025945 Bacteria 2875
292 Ga0207679_10088214 3300025945 Bacteria 2391
293 Ga0207679_10395543 3300025945 Bacteria 1214
294 Ga0207679_10544814 3300025945 Bacteria 1040
295 Ga0207679_11364670 3300025945 Bacteria 650
296 Ga0207651_10001207 3300025960 Bacteria 11569
297 Ga0207712_10000033 3300025961 Bacteria 209336
298 Ga0207712_10002885 3300025961 Bacteria 10989
299 Ga0207712_10184686 3300025961 Bacteria 1641
300 Ga0207712_10217501 3300025961 Bacteria 1525
301 Ga0207712_10620335 3300025961 Bacteria 937
302 Ga0207668_10014146 3300025972 Bacteria 4934
303 Ga0207668_10061962 3300025972 Bacteria 2633
304 Ga0207668_10062042 3300025972 Bacteria 2631
305 Ga0207640_10023696 3300025981 Bacteria 3693
306 Ga0207640_10411148 3300025981 Bacteria 1104
307 Ga0207658_10001722 3300025986 Bacteria 16531
308 Ga0207677_10000225 3300026023 Bacteria 44520
309 Ga0207677_10009775 3300026023 Bacteria 5405
310 Ga0207677_10267664 3300026023 Bacteria 1396
311 Ga0207677_10712381 3300026023 Bacteria 891
312 Ga0207703_10169181 3300026035 Bacteria 1921
313 Ga0207639_10266062 3300026041 Bacteria 1502
314 Ga0207678_10008262 3300026067 Bacteria 9171
315 Ga0207678_10014936 3300026067 Bacteria 6832
316 Ga0207678_10217878 3300026067 Bacteria 1633
317 Ga0207708_10000869 3300026075 Bacteria 22730
318 Ga0207708_10141957 3300026075 Bacteria 1885
319 Ga0207702_10001072 3300026078 Bacteria 28003
320 Ga0207702_10177134 3300026078 Bacteria 1960
321 Ga0207641_10973440 3300026088 Bacteria 844
322 Ga0207648_10030680 3300026089 Bacteria 4758
323 Ga0207648_10482944 3300026089 Bacteria 1132
324 Ga0207674_10377087 3300026116 Bacteria 1371
325 Ga0207674_10675608 3300026116 Bacteria 997
326 Ga0207674_11358656 3300026116 Bacteria 680
327 Ga0207675_100014322 3300026118 Bacteria 7392
328 Ga0207675_100155247 3300026118 Bacteria 2181
329 Ga0207683_10028543 3300026121 Bacteria 4825
330 Ga0207683_10086377 3300026121 Bacteria 2789
331 Ga0207683_10202143 3300026121 Bacteria 1806
332 Ga0207698_10398578 3300026142 Bacteria 1314
333 Ga0207698_11309018 3300026142 Bacteria 739
334 Ga0207428_10007412 3300027907 Bacteria 10002
335 Ga0207428_10019314 3300027907 Bacteria 5810
336 Ga0207428_10043985 3300027907 Bacteria 3604
337 Ga0268266_10369633 3300028379 Bacteria 1350
338 Ga0268266_10476464 3300028379 Bacteria 1189
339 Ga0268266_11149997 3300028379 Bacteria 751
340 Ga0268265_10012654 3300028380 Bacteria 5724
341 Ga0268264_10073004 3300028381 Bacteria 2911
342 Ga0268264_10654475 3300028381 Bacteria 1040
343 Ga0268264_10967225 3300028381 Bacteria 857
344 Ga0265326_10000003 3300028558 Bacteria 479811
345 Ga0265319_1001029 3300028563 Bacteria 17461
346 Ga0265334_10000019 3300028573 Bacteria 143921
347 Ga0265336_10071044 3300028666 Bacteria 1040
348 Ga0265338_10004357 3300028800 Bacteria 19152
349 Ga0265324_10000344 3300029957 Bacteria 33865
350 Ga0265327_10046293 3300031251 Bacteria 2304
351 Ga0307408_100433638 3300031548 Bacteria 1136
352 Ga0307405_10015592 3300031731 Bacteria 4121
353 Ga0307405_10216365 3300031731 Unclassified 1403
354 Ga0307413_10028803 3300031824 Bacteria 3099
355 Ga0307410_10034172 3300031852 Bacteria 3290
356 Ga0307410_10138507 3300031852 Bacteria 1797
357 Ga0307406_10018027 3300031901 Bacteria 4118
358 Ga0307406_10227359 3300031901 Unclassified 1391
359 Ga0307407_10007021 3300031903 Bacteria 5067
360 Ga0307412_10323890 3300031911 Bacteria 1227
361 Ga0307409_100163018 3300031995 Bacteria 1952
362 Ga0307409_100400896 3300031995 Bacteria 1310
363 Ga0307409_100403306 3300031995 Bacteria 1307
364 Ga0307416_100010981 3300032002 Bacteria 6012
365 Ga0307416_100114106 3300032002 Bacteria 2389
366 Ga0307416_101355612 3300032002 Bacteria 817
367 Ga0307411_10037829 3300032005 Bacteria 3038
368 Ga0307411_10234816 3300032005 Bacteria 1432
369 Ga0307411_10435597 3300032005 Bacteria 1093
370 Ga0307415_100000902 3300032126 Bacteria 13600
371 Ga0307415_100018798 3300032126 Bacteria 4182
372 Ga0307415_100179335 3300032126 Bacteria 1660
373 Ga0307415_100392427 3300032126 Bacteria 1182
374 Ga0307415_100450932 3300032126 Bacteria 1112
375 Ga0307415_101286024 3300032126 Bacteria 692
376 Ga0307415_101340856 3300032126 Bacteria 679
377 Ga0373957_0067017 3300035120 Bacteria 1399
378 Ga0373955_0197218 3300035172 Unclassified 1198
379 Ga0373937_0027519 3300036401 Bacteria 5141
380 Ga0395899_0735148 3300037312 Bacteria 616
381 Ga0395900_0063212 3300037418 Bacteria 3805
382 Ga0395900_0625959 3300037418 Bacteria 1015
383 Ga0395900_0675323 3300037418 Bacteria 968
384 Ga0395898_0005594 3300037466 Bacteria 13554
385 Ga0395898_0076838 3300037466 Bacteria 3224
386 Ga0395898_0242946 3300037466 Bacteria 1717
387 Ga0395898_0741479 3300037466 Bacteria 924
388 Ga0395898_1028707 3300037466 Unclassified 759
389 Ga0395905_0010070 3300037471 Bacteria 9215
390 Ga0395905_0132251 3300037471 Bacteria 2347
391 Ga0395901_0014858 3300038443 Bacteria 7910
392 Ga0395901_0169820 3300038443 Bacteria 2288
393 Ga0395901_0565201 3300038443 Bacteria 1151
394 Ga0395901_1264614 3300038443 Bacteria 701
395 Ga0395901_1687576 3300038443 Bacteria 585
396 Ga0436362_0988173 3300039453 Bacteria 3558
397 Ga0451802_0700236 3300041460 Bacteria 603
398 Ga0451853_1508810 3300041512 Bacteria 2563
399 Ga0439454_033148 3300042011 Bacteria 818
400 Ga0439459_0171988 3300042438 Bacteria 578
401 Ga0466972_0266297 3300044658 Bacteria 801
402 Ga0466961_0203009 3300044693 Bacteria 1225
403 Ga0466963_0000034 3300044694 Bacteria 44604
404 Ga0466963_0011130 3300044694 Bacteria 5471
405 Ga0466963_0122868 3300044694 Bacteria 1788
406 Ga0466963_0132078 3300044694 Bacteria 1725
407 Ga0466963_0139994 3300044694 Bacteria 1676
408 Ga0466963_0150559 3300044694 Bacteria 1615
409 Ga0466964_0157631 3300044706 Bacteria 1058
410 Ga0466970_0203787 3300044765 Bacteria 1101
411 Ga0466957_0043534 3300044842 Bacteria 2719
412 Ga0466957_0202147 3300044842 Bacteria 1305
413 Ga0466960_0281825 3300044901 Bacteria 932
414 Ga0466967_0000007 3300045976 Bacteria 135597
415 Ga0466967_0016981 3300045976 Bacteria 5758
416 Ga0466967_0034447 3300045976 Bacteria 4298
417 Ga0466967_0076943 3300045976 Bacteria 3002
418 Ga0466967_0077728 3300045976 Bacteria 2988
419 Ga0466967_0085176 3300045976 Bacteria 2861
420 Ga0466967_0094559 3300045976 Bacteria 2722
421 Ga0466967_0206678 3300045976 Bacteria 1861
422 Ga0466967_0355069 3300045976 Bacteria 1419
423 Ga0466967_0513106 3300045976 Bacteria 1177
424 Ga0466967_0591584 3300045976 Bacteria 1094
425 Ga0466967_1150937 3300045976 Bacteria 773
426 Ga0495592_0000537 3300046454 Bacteria 27057
427 Ga0495592_0404695 3300046454 Bacteria 864
428 Ga0495603_0044142 3300046455 Bacteria 2660
429 Ga0495629_0000746 3300046459 Bacteria 26275
430 Ga0495629_0110986 3300046459 Bacteria 1912
431 Ga0495629_0255943 3300046459 Bacteria 1204
432 Ga0495638_0180848 3300046460 Bacteria 1203
433 Ga0495641_0037143 3300046461 Bacteria 2285
434 Ga0495641_0061685 3300046461 Bacteria 1692
435 Ga0495641_0115829 3300046461 Bacteria 1195
436 Ga0495582_0000022 3300046473 Bacteria 83315
437 Ga0495582_0038704 3300046473 Bacteria 2625
438 Ga0495584_0172878 3300046491 Unclassified 1098
439 Ga0495594_0000005 3300046499 Bacteria 175437
440 Ga0495594_0104820 3300046499 Bacteria 1592
441 Ga0495596_0091803 3300046500 Bacteria 1179
442 Ga0495606_0000131 3300046507 Bacteria 127298
443 Ga0495608_0080179 3300046511 Bacteria 2122
444 Ga0495618_0000004 3300046514 Bacteria 245690
445 Ga0495620_0000388 3300046515 Bacteria 29740
446 Ga0495628_0000194 3300046516 Bacteria 53139
447 Ga0495628_0007060 3300046516 Bacteria 9725
448 Ga0495628_0295102 3300046516 Bacteria 1201
449 Ga0495630_0000168 3300046517 Bacteria 51209
450 Ga0495630_0000416 3300046517 Bacteria 32826
451 Ga0495630_0020577 3300046517 Bacteria 4866
452 Ga0495630_0414810 3300046517 Unclassified 1032
453 Ga0495631_0179932 3300046518 Bacteria 906
454 Ga0495644_0003763 3300046523 Bacteria 5973
455 Ga0495652_0025477 3300046529 Bacteria 5232
456 Ga0495640_0014191 3300046533 Bacteria 6039
457 Ga0495640_0031717 3300046533 Bacteria 3769
458 Ga0495586_0004988 3300046535 Bacteria 7100
459 Ga0495587_0111489 3300046536 Bacteria 1571
460 Ga0495598_0304441 3300046537 Bacteria 604
461 Ga0495621_0392720 3300046539 Unclassified 587
462 Ga0495645_0004732 3300046543 Bacteria 9303
463 Ga0495622_0000026 3300046557 Bacteria 137934
464 Ga0495667_0000044 3300046559 Bacteria 121910
465 Ga0495656_0319829 3300046615 Bacteria 799
466 Ga0495634_0013021 3300046642 Bacteria 6017
467 Ga0495634_0058197 3300046642 Unclassified 2577
468 Ga0495634_0214518 3300046642 Unclassified 1190
469 Ga0495634_0666406 3300046642 Bacteria 600
470 Ga0495625_0000204 3300046660 Bacteria 94356
471 Ga0495625_0321034 3300046660 Unclassified 986
472 Ga0495635_0000063 3300046663 Bacteria 65304
473 Ga0495635_0040045 3300046663 Bacteria 3239
474 Ga0495657_0068360 3300046675 Bacteria 2328
475 Ga0495647_0000003 3300046681 Bacteria 145235
476 Ga0495658_0000008 3300046683 Bacteria 115426
477 Ga0495658_0064364 3300046683 Bacteria 2113
478 Ga0495658_0317603 3300046683 Unclassified 987
479 Ga0495669_0000169 3300046684 Bacteria 41171
480 Ga0495613_0000369 3300046689 Bacteria 39198
481 Ga0495624_0000305 3300046690 Bacteria 38658
482 Ga0495624_0003530 3300046690 Bacteria 11592
483 Ga0495649_0001488 3300046694 Bacteria 17602
484 Ga0495600_0002253 3300046809 Bacteria 10994
485 Ga0495600_0017502 3300046809 Bacteria 4560
486 Ga0495604_0000033 3300047317 Bacteria 134810
487 Ga0495604_0020213 3300047317 Bacteria 5321
488 Ga0495604_0444852 3300047317 Bacteria 847
489 Ga0495674_0000027 3300047319 Bacteria 132744
490 Ga0495674_0334653 3300047319 Bacteria 1231
491 Ga0495672_0240939 3300047320 Bacteria 883
492 Ga0495676_0008602 3300047321 Bacteria 9347
493 Ga0495680_0008245 3300047322 Bacteria 9493
494 Ga0495680_0309582 3300047322 Unclassified 1107
495 Ga0495675_0029691 3300047444 Bacteria 3488
496 Ga0495675_0313595 3300047444 Bacteria 929
497 Ga0495673_0047463 3300047469 Bacteria 1898
498 Ga0495684_0481076 3300047471 Bacteria 857
499 Ga0495686_0036681 3300047472 Bacteria 3146
500 Ga0495602_0001509 3300048088 Bacteria 23180
501 Ga0495602_0707031 3300048088 Bacteria 683
502 Ga0496100_0000003 3300048903 Bacteria 360802
503 Ga0496100_0330969 3300048903 Bacteria 1146
504 Ga0496101_0000003 3300048904 Bacteria 406565
505 Ga0496101_0039050 3300048904 Bacteria 3373
506 Ga0496101_0169979 3300048904 Bacteria 1675
507 Ga0496102_0029058 3300048905 Bacteria 4943
508 Ga0496102_0045086 3300048905 Bacteria 4002
509 Ga0496102_0261101 3300048905 Bacteria 1633
510 Ga0496102_1166496 3300048905 Bacteria 690
511 Ga0496103_0020698 3300048906 Bacteria 3954
512 Ga0496103_0063823 3300048906 Bacteria 2295
513 Ga0496103_0284347 3300048906 Bacteria 1064
514 Ga0496103_0487612 3300048906 Bacteria 789
515 Ga0496103_0552623 3300048906 Bacteria 735
516 Ga0496104_0000007 3300048907 Bacteria 524804
517 Ga0496104_0000066 3300048907 Bacteria 108721
518 Ga0496104_0007632 3300048907 Bacteria 9576
519 Ga0496104_0171027 3300048907 Bacteria 2083
520 Ga0496105_0000002 3300048908 Bacteria 753215
521 Ga0496105_0000020 3300048908 Bacteria 181484
522 Ga0496105_0047857 3300048908 Bacteria 3528
523 Ga0496105_0049913 3300048908 Bacteria 3456
524 Ga0496105_0066557 3300048908 Bacteria 2974
525 Ga0496105_0653889 3300048908 Bacteria 811
526 Ga0496106_0000015 3300048909 Bacteria 187570
527 Ga0496106_0000147 3300048909 Bacteria 51986
528 Ga0496106_0012504 3300048909 Bacteria 6270
529 Ga0496106_0033927 3300048909 Bacteria 3810
530 Ga0496106_0537979 3300048909 Unclassified 938
531 Ga0496106_0757346 3300048909 Bacteria 772
532 Ga0496107_0000008 3300048910 Bacteria 251874
533 Ga0496107_0004466 3300048910 Bacteria 9484
534 Ga0496107_0027536 3300048910 Bacteria 4036
535 Ga0496107_0037005 3300048910 Bacteria 3502
536 Ga0496107_0139789 3300048910 Bacteria 1790
537 Ga0496108_0000002 3300048911 Bacteria 700890
538 Ga0496108_0024788 3300048911 Bacteria 4939
539 Ga0496108_0030574 3300048911 Bacteria 4463
540 Ga0496109_0000001 3300048912 Bacteria 700852
541 Ga0496109_0055073 3300048912 Bacteria 3628
542 Ga0496109_0232746 3300048912 Bacteria 1733
543 Ga0496109_0368335 3300048912 Bacteria 1357
544 Ga0496109_0372894 3300048912 Bacteria 1348
545 Ga0496109_0382369 3300048912 Bacteria 1330
546 Ga0496109_0470305 3300048912 Bacteria 1187
547 Ga0496110_0071200 3300048913 Bacteria 3082
548 Ga0496110_0192970 3300048913 Bacteria 1849
549 Ga0496110_0742544 3300048913 Bacteria 884
550 Ga0496110_0746208 3300048913 Bacteria 882
551 Ga0496111_0049802 3300048914 Bacteria 3020
552 Ga0496111_0051254 3300048914 Bacteria 2979
553 Ga0496111_0140244 3300048914 Bacteria 1791
554 Ga0496111_0340594 3300048914 Bacteria 1110
555 Ga0496112_0069733 3300048915 Bacteria 3472
556 Ga0496112_0301035 3300048915 Unclassified 1549
557 Ga0496112_0565644 3300048915 Bacteria 1070
558 Ga0496113_0021763 3300048916 Bacteria 4527
559 Ga0496114_0076181 3300048917 Bacteria 2826
560 Ga0496114_0105636 3300048917 Bacteria 2409
561 Ga0496114_0235275 3300048917 Archaea 1610
562 Ga0496115_0010437 3300048918 Bacteria 6941
563 Ga0496115_0030971 3300048918 Bacteria 4213
564 Ga0496116_0000383 3300048919 Bacteria 65450
565 Ga0496117_0006252 3300048920 Bacteria 12141
566 Ga0496117_0172358 3300048920 Bacteria 1254
567 Ga0496117_0251798 3300048920 Bacteria 963
568 Ga0496118_0000151 3300048921 Bacteria 122978
569 Ga0496119_0001491 3300048922 Bacteria 28020
570 Ga0496119_0020645 3300048922 Bacteria 4795
571 Ga0496119_0191967 3300048922 Bacteria 1063
572 Ga0496120_0031801 3300048923 Bacteria 3190
573 Ga0496124_0370730 3300048927 Bacteria 1005
574 Ga0496125_0023449 3300048928 Bacteria 5696
575 Ga0496126_0041631 3300048929 Bacteria 4249
576 Ga0496126_0101084 3300048929 Bacteria 2522
577 Ga0501033_0290880 3300049570 Bacteria 1152
578 Ga0501036_0072455 3300049572 Bacteria 2912
579 Ga0501038_0074699 3300049574 Bacteria 2867
580 Ga0501039_0058119 3300049575 Bacteria 2995
581 Ga0501040_0403839 3300049576 Bacteria 981
582 Ga0501040_0581071 3300049576 Bacteria 809
583 Ga0501042_0022841 3300049578 Bacteria 4371
584 Ga0501042_0033220 3300049578 Bacteria 3657
585 Ga0501043_0441120 3300049579 Bacteria 979
586 Ga0501047_0006642 3300049581 Bacteria 10874
587 Ga0501047_0047086 3300049581 Bacteria 4166
588 Ga0501047_0081451 3300049581 Bacteria 3111
589 Ga0501047_0227903 3300049581 Bacteria 1718
590 Ga0501048_0014802 3300049582 Bacteria 5770
591 Ga0501048_0344963 3300049582 Bacteria 1062
592 Ga0501067_0227383 3300049583 Bacteria 1039
593 Ga0501068_0204358 3300049584 Unclassified 1253
594 Ga0501069_0064796 3300049585 Bacteria 2042
595 Ga0501069_0435247 3300049585 Bacteria 778
596 Ga0501070_0007643 3300049586 Bacteria 9177
597 Ga0501070_0217273 3300049586 Bacteria 1568
598 Ga0501070_0237462 3300049586 Bacteria 1492
599 Ga0501070_0305179 3300049586 Unclassified 1296
600 Ga0501070_0624377 3300049586 Bacteria 857
601 Ga0501070_0751237 3300049586 Unclassified 768
602 Ga0501072_0002808 3300049588 Bacteria 13068
603 Ga0501074_0016615 3300049590 Bacteria 5341
604 Ga0501074_0172762 3300049590 Bacteria 1542
605 Ga0501075_0017405 3300049591 Bacteria 5192
606 Ga0501075_0102000 3300049591 Unclassified 2179
607 Ga0501076_0001340 3300049592 Bacteria 16472
608 Ga0501077_0157549 3300049593 Bacteria 1441
609 Ga0501079_0032683 3300049741 Bacteria 4001
610 Ga0501079_0072035 3300049741 Bacteria 2670
611 Ga0501079_0210422 3300049741 Bacteria 1519
612 Ga0501079_0604150 3300049741 Bacteria 863
613 Ga0501080_0156454 3300049742 Bacteria 2105
614 Ga0501081_0003237 3300049743 Bacteria 10359
615 Ga0501081_0310852 3300049743 Bacteria 1157
616 Ga0501083_0229773 3300049744 Bacteria 1208
617 Ga0501035_0178443 3300049822 Bacteria 1831
618 Ga0501035_0399070 3300049822 Bacteria 1144
619 Ga0501045_0004663 3300049824 Bacteria 9468
620 nmdc:mga00v17_25864_c1 3300050491 Bacteria 3122
621 nmdc:mga0yw44_5034_c1 3300050492 Bacteria 6175
622 nmdc:mga0yw44_5381_c1 3300050492 Bacteria 6034
623 nmdc:mga05p37_1191423_c1 3300050507 Unclassified 788
624 nmdc:mga05p37_22454_c1 3300050507 Bacteria 7651
625 nmdc:mga05p37_3930_c1 3300050507 Bacteria 17409
626 nmdc:mga05p37_805080_c1 3300050507 Bacteria 1027
627 nmdc:mga05p37_84577_c1 3300050507 Bacteria 3908
628 nmdc:mga09592_509687_c1 3300050508 Bacteria 1035
629 nmdc:mga0qj67_115620_c1 3300050509 Bacteria 2167
630 nmdc:mga0qj67_324025_c1 3300050509 Unclassified 1247
631 nmdc:mga0qj67_537711_c1 3300050509 Unclassified 938
632 nmdc:mga06r32_14654_c1 3300050510 Bacteria 7115
633 nmdc:mga06r32_1531_c1 3300050510 Bacteria 20797
634 nmdc:mga06r32_19865_c1 3300050510 Bacteria 6174
635 nmdc:mga06r32_789405_c1 3300050510 Bacteria 911
636 nmdc:mga08y16_2067_c1 3300050511 Bacteria 20576
637 nmdc:mga08y16_244087_c1 3300050511 Bacteria 1856
638 nmdc:mga08y16_276277_c1 3300050511 Bacteria 1733
639 nmdc:mga08y16_27817_c1 3300050511 Bacteria 5959
640 nmdc:mga08y16_35398_c1 3300050511 Bacteria 5243
641 nmdc:mga0n895_312579_c1 3300050512 Bacteria 1592
642 nmdc:mga0n895_62476_c1 3300050512 Bacteria 3682
643 nmdc:mga0n895_810759_c1 3300050512 Bacteria 926
644 nmdc:mga0n895_87069_c1 3300050512 Bacteria 3121
645 nmdc:mga0rr50_58397_c1 3300050513 Bacteria 2891
646 nmdc:mga0a205_5205_c1 3300050515 Bacteria 11703
647 nmdc:mga0a205_84873_c1 3300050515 Bacteria 3059
648 Ga0495601_0003622 3300053077 Bacteria 8884
649 Ga0495601_0004768 3300053077 Bacteria 7866
650 Ga0495601_0024330 3300053077 Bacteria 3729
651 Ga0495601_0034664 3300053077 Bacteria 3149
652 Ga0495601_0158880 3300053077 Bacteria 1477
653 Ga0495612_0000198 3300053078 Bacteria 25551
654 Ga0495612_0001969 3300053078 Bacteria 8453
655 Ga0495612_0037600 3300053078 Bacteria 1966
656 Ga0495655_0030225 3300053083 Bacteria 1309
657 Ga0495595_0035439 3300053084 Bacteria 2261
658 Ga0495595_0149252 3300053084 Bacteria 1150
659 Ga0495619_0000285 3300053085 Bacteria 36505
660 Ga0495619_0002052 3300053085 Bacteria 13376
661 Ga0495619_0008863 3300053085 Bacteria 6358
662 Ga0495619_0029750 3300053085 Bacteria 3531
663 Ga0500641_0011550 3300053096 Bacteria 3206
664 Ga0500595_044764 3300053119 Bacteria 1401
665 Ga0500595_060733 3300053119 Unclassified 1142
666 Ga0501084_0002620 3300054114 Bacteria 14491
667 Ga0501084_0442801 3300054114 Bacteria 1098
668 Ga0501084_1004241 3300054114 Unclassified 701
669 Ga0501082_0001162 3300060353 Bacteria 23190
670 Ga0466962_0073360 3300061719 Bacteria 1635
671 Ga0530510_0002230 3300061734 Bacteria 13291
672 Ga0530510_0146667 3300061734 Bacteria 1741

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300038443 Ga0395901_1264614 Ga0395901_1264614_275_688 127
2 3300049581 Ga0501047_0227903 Ga0501047_0227903_1082_1633 132
3 3300005435 Ga0070714_100042858 Ga0070714_1000428582 133
4 3300009093 Ga0105240_10063125 Ga0105240_100631252 133
5 3300006847 Ga0075431_100531887 Ga0075431_1005318872 134
6 3300028558 Ga0265326_10000003 Ga0265326_100000034 134
7 3300028563 Ga0265319_1001029 Ga0265319_10010293 134
8 3300028573 Ga0265334_10000019 Ga0265334_1000001938 134
9 3300028666 Ga0265336_10071044 Ga0265336_100710442 134
10 3300028800 Ga0265338_10004357 Ga0265338_1000435714 134
11 3300029957 Ga0265324_10000344 Ga0265324_100003446 134
12 3300031251 Ga0265327_10046293 Ga0265327_100462932 134
13 3300006847 Ga0075431_100655129 Ga0075431_1006551292 139
14 3300006852 Ga0075433_10010256 Ga0075433_100102563 139
15 3300006871 Ga0075434_100003617 Ga0075434_1000036179 139
16 3300009147 Ga0114129_10002590 Ga0114129_100025909 139
17 3300050507 nmdc:mga05p37_3930_c1 nmdc:mga05p37_3930_c1_11593_12117 139
18 3300050512 nmdc:mga0n895_62476_c1 nmdc:mga0n895_62476_c1_2375_2899 139
19 3300050515 nmdc:mga0a205_5205_c1 nmdc:mga0a205_5205_c1_1179_1703 139
20 3300010375 Ga0105239_11561949 Ga0105239_115619492 140
21 3300048905 Ga0496102_1166496 Ga0496102_1166496_64_591 140
22 3300048906 Ga0496103_0284347 Ga0496103_0284347_132_659 140
23 3300049741 Ga0501079_0210422 Ga0501079_0210422_410_964 142
24 3300049743 Ga0501081_0310852 Ga0501081_0310852_314_868 142
25 3300054114 Ga0501084_0442801 Ga0501084_0442801_94_648 142
26 3300061734 Ga0530510_0146667 Ga0530510_0146667_650_1204 142
27 3300005356 Ga0070674_100000011 Ga0070674_10000001128 143
28 3300005718 Ga0068866_10000002 Ga0068866_1000000228 143
29 3300025899 Ga0207642_10000001 Ga0207642_10000001580 143
30 3300025899 Ga0207642_10000003 Ga0207642_10000003580 143
31 3300025937 Ga0207669_10000027 Ga0207669_1000002728 143
32 3300005535 Ga0070684_100406798 Ga0070684_1004067982 146
33 3300038443 Ga0395901_1687576 Ga0395901_1687576_37_561 146
34 3300046459 Ga0495629_0255943 Ga0495629_0255943_20_496 146
35 3300037418 Ga0395900_0063212 Ga0395900_0063212_2986_3537 147
36 3300046516 Ga0495628_0007060 Ga0495628_0007060_1227_1739 148
37 3300047471 Ga0495684_0481076 Ga0495684_0481076_12_524 148
38 3300005338 Ga0068868_100000630 Ga0068868_10000063017 149
39 3300005983 Ga0081540_1000197 Ga0081540_100019726 149
40 3300014326 Ga0157380_10000072 Ga0157380_1000007222 149
41 3300026023 Ga0207677_10000225 Ga0207677_100002257 149
42 3300044765 Ga0466970_0203787 Ga0466970_0203787_142_654 149
43 3300048910 Ga0496107_0139789 Ga0496107_0139789_216_740 149
44 3300049582 Ga0501048_0344963 Ga0501048_0344963_27_551 149
45 3300005435 Ga0070714_100047621 Ga0070714_1000476212 150
46 3300025933 Ga0207706_10591398 Ga0207706_105913982 150
47 3300046559 Ga0495667_0000044 Ga0495667_0000044_41635_42156 151
48 3300047322 Ga0495680_0008245 Ga0495680_0008245_4480_5001 151
49 3300047469 Ga0495673_0047463 Ga0495673_0047463_562_1071 151
50 3300044658 Ga0466972_0266297 Ga0466972_0266297_20_532 152
51 3300044693 Ga0466961_0203009 Ga0466961_0203009_367_879 152
52 3300044694 Ga0466963_0122868 Ga0466963_0122868_11_523 152
53 3300044842 Ga0466957_0202147 Ga0466957_0202147_241_753 152
54 3300044901 Ga0466960_0281825 Ga0466960_0281825_100_612 152
55 3300061719 Ga0466962_0073360 Ga0466962_0073360_605_1117 152
56 3300005985 Ga0081539_10028719 Ga0081539_100287193 153
57 3300014968 Ga0157379_10091796 Ga0157379_100917964 153
58 3300046454 Ga0495592_0000537 Ga0495592_0000537_13350_13862 153
59 3300005457 Ga0070662_100000008 Ga0070662_10000000841 154
60 3300025933 Ga0207706_10000016 Ga0207706_10000016134 154
61 3300005456 Ga0070678_100070973 Ga0070678_1000709734 155
62 3300005981 Ga0081538_10161820 Ga0081538_101618202 155
63 3300025919 Ga0207657_10257700 Ga0207657_102577002 155
64 3300026121 Ga0207683_10028543 Ga0207683_100285435 155
65 3300035120 Ga0373957_0067017 Ga0373957_0067017_495_1019 155
66 3300036401 Ga0373937_0027519 Ga0373937_0027519_1755_2279 155
67 3300046473 Ga0495582_0000022 Ga0495582_0000022_44387_44896 155
68 3300046511 Ga0495608_0080179 Ga0495608_0080179_1161_1685 155
69 3300046683 Ga0495658_0000008 Ga0495658_0000008_44827_45336 155
70 3300046809 Ga0495600_0017502 Ga0495600_0017502_1905_2429 155
71 3300047317 Ga0495604_0020213 Ga0495604_0020213_3631_4155 155
72 3300047444 Ga0495675_0313595 Ga0495675_0313595_261_785 155
73 3300053084 Ga0495595_0035439 Ga0495595_0035439_999_1523 155
74 3300053085 Ga0495619_0008863 Ga0495619_0008863_3276_3800 155
75 3300005983 Ga0081540_1000126 Ga0081540_100012656 156
76 3300006163 Ga0070715_10000015 Ga0070715_10000015139 156
77 3300025905 Ga0207685_10000001 Ga0207685_10000001288 156
78 3300045976 Ga0466967_0016981 Ga0466967_0016981_4622_5128 156
79 3300046529 Ga0495652_0025477 Ga0495652_0025477_2953_3465 156
80 3300046536 Ga0495587_0111489 Ga0495587_0111489_568_1077 156
81 3300048917 Ga0496114_0235275 Ga0496114_0235275_840_1358 156
82 3300048918 Ga0496115_0030971 Ga0496115_0030971_2088_2606 156
83 3300053077 Ga0495601_0004768 Ga0495601_0004768_3054_3566 156
84 3300005364 Ga0070673_100000804 Ga0070673_1000008043 157
85 3300005614 Ga0068856_101617584 Ga0068856_1016175842 157
86 3300025960 Ga0207651_10001207 Ga0207651_1000120710 157
87 3300044694 Ga0466963_0011130 Ga0466963_0011130_4364_4849 157
88 3300044694 Ga0466963_0132078 Ga0466963_0132078_1121_1606 157
89 3300044706 Ga0466964_0157631 Ga0466964_0157631_394_876 157
90 3300044842 Ga0466957_0043534 Ga0466957_0043534_981_1466 157
91 3300045976 Ga0466967_0034447 Ga0466967_0034447_399_884 157
92 3300045976 Ga0466967_0076943 Ga0466967_0076943_946_1428 157
93 3300046615 Ga0495656_0319829 Ga0495656_0319829_91_636 157
94 3300046681 Ga0495647_0000003 Ga0495647_0000003_74137_74649 157
95 3300048915 Ga0496112_0301035 Ga0496112_0301035_155_676 157
96 3300049576 Ga0501040_0581071 Ga0501040_0581071_38_523 157
97 3300050508 nmdc:mga09592_509687_c1 nmdc:mga09592_509687_c1_132_653 157
98 3300006846 Ga0075430_100022244 Ga0075430_1000222442 158
99 3300050509 nmdc:mga0qj67_115620_c1 nmdc:mga0qj67_115620_c1_866_1384 158
100 3300053085 Ga0495619_0002052 Ga0495619_0002052_3172_3681 158
101 3300005334 Ga0068869_100304890 Ga0068869_1003048902 159
102 3300005339 Ga0070660_101261583 Ga0070660_1012615831 159
103 3300005459 Ga0068867_101077033 Ga0068867_1010770332 159
104 3300005544 Ga0070686_100965392 Ga0070686_1009653921 159
105 3300005564 Ga0070664_100532737 Ga0070664_1005327372 159
106 3300005616 Ga0068852_100575123 Ga0068852_1005751232 159
107 3300005842 Ga0068858_101157919 Ga0068858_1011579191 159
108 3300009098 Ga0105245_10607744 Ga0105245_106077442 159
109 3300009551 Ga0105238_10000051 Ga0105238_100000517 159
110 3300009553 Ga0105249_10458693 Ga0105249_104586932 159
111 3300014325 Ga0163163_10634903 Ga0163163_106349032 159
112 3300025924 Ga0207694_10000035 Ga0207694_10000035130 159
113 3300025932 Ga0207690_10055624 Ga0207690_100556245 159
114 3300045976 Ga0466967_1150937 Ga0466967_1150937_174_683 159
115 3300046642 Ga0495634_0214518 Ga0495634_0214518_471_980 159
116 3300047320 Ga0495672_0240939 Ga0495672_0240939_86_610 159
117 3300048909 Ga0496106_0000147 Ga0496106_0000147_9172_9684 159
118 3300048909 Ga0496106_0537979 Ga0496106_0537979_183_707 159
119 3300048910 Ga0496107_0037005 Ga0496107_0037005_2391_2903 159
120 3300013306 Ga0163162_10252839 Ga0163162_102528392 160
121 3300025929 Ga0207664_10258909 Ga0207664_102589092 160
122 3300037466 Ga0395898_0005594 Ga0395898_0005594_12807_13352 160
123 3300037471 Ga0395905_0010070 Ga0395905_0010070_244_789 160
124 3300038443 Ga0395901_0169820 Ga0395901_0169820_202_747 160
125 3300041512 Ga0451853_1508810 Ga0451853_1508810_706_1254 160
126 3300045976 Ga0466967_0591584 Ga0466967_0591584_116_634 160
127 3300046460 Ga0495638_0180848 Ga0495638_0180848_615_1133 160
128 3300046499 Ga0495594_0000005 Ga0495594_0000005_54741_55280 160
129 3300046516 Ga0495628_0000194 Ga0495628_0000194_33791_34306 160
130 3300046557 Ga0495622_0000026 Ga0495622_0000026_16988_17527 160
131 3300053096 Ga0500641_0011550 Ga0500641_0011550_2256_2774 160
132 3300045976 Ga0466967_0206678 Ga0466967_0206678_902_1420 161
133 3300046533 Ga0495640_0014191 Ga0495640_0014191_2248_2757 161
134 3300046642 Ga0495634_0058197 Ga0495634_0058197_383_892 161
135 3300005355 Ga0070671_100042553 Ga0070671_1000425532 162
136 3300047472 Ga0495686_0036681 Ga0495686_0036681_1589_2107 162
137 3300048905 Ga0496102_0261101 Ga0496102_0261101_637_1155 162
138 3300049578 Ga0501042_0033220 Ga0501042_0033220_1250_1768 162
139 3300039453 Ga0436362_0988173 Ga0436362_0988173_476_1015 163
140 3300046533 Ga0495640_0031717 Ga0495640_0031717_320_838 163
141 3300047319 Ga0495674_0000027 Ga0495674_0000027_2677_3195 163
142 3300048088 Ga0495602_0001509 Ga0495602_0001509_9109_9624 163
143 3300049578 Ga0501042_0022841 Ga0501042_0022841_3401_3916 163
144 3300005444 Ga0070694_100113332 Ga0070694_1001133322 164
145 3300005545 Ga0070695_100442849 Ga0070695_1004428492 164
146 3300005546 Ga0070696_100281907 Ga0070696_1002819072 164
147 3300005549 Ga0070704_100491076 Ga0070704_1004910761 164
148 3300005615 Ga0070702_100144761 Ga0070702_1001447612 164
149 3300009098 Ga0105245_11238130 Ga0105245_112381302 164
150 3300009148 Ga0105243_10430997 Ga0105243_104309972 164
151 3300009176 Ga0105242_10395813 Ga0105242_103958132 164
152 3300025934 Ga0207686_10983465 Ga0207686_109834651 164
153 3300025937 Ga0207669_10837942 Ga0207669_108379422 164
154 3300025938 Ga0207704_10311339 Ga0207704_103113392 164
155 3300028381 Ga0268264_10654475 Ga0268264_106544752 164
156 3300032002 Ga0307416_101355612 Ga0307416_1013556122 164
157 3300048908 Ga0496105_0653889 Ga0496105_0653889_231_755 164
158 3300048909 Ga0496106_0757346 Ga0496106_0757346_234_761 164
159 3300048912 Ga0496109_0382369 Ga0496109_0382369_193_717 164
160 3300005329 Ga0070683_100011292 Ga0070683_1000112927 165
161 3300005535 Ga0070684_100036375 Ga0070684_1000363753 165
162 3300005564 Ga0070664_100114129 Ga0070664_1001141293 165
163 3300025944 Ga0207661_10000145 Ga0207661_100001456 165
164 3300025945 Ga0207679_10088214 Ga0207679_100882143 165
165 3300044694 Ga0466963_0139994 Ga0466963_0139994_1021_1527 165
166 3300045976 Ga0466967_0077728 Ga0466967_0077728_2238_2747 165
167 3300045976 Ga0466967_0085176 Ga0466967_0085176_1747_2253 165
168 3300045976 Ga0466967_0513106 Ga0466967_0513106_346_852 165
169 3300005981 Ga0081538_10047438 Ga0081538_100474385 166
170 3300028379 Ga0268266_10369633 Ga0268266_103696332 166
171 3300031548 Ga0307408_100433638 Ga0307408_1004336382 166
172 3300031731 Ga0307405_10015592 Ga0307405_100155922 166
173 3300031731 Ga0307405_10216365 Ga0307405_102163652 166
174 3300031824 Ga0307413_10028803 Ga0307413_100288032 166
175 3300031852 Ga0307410_10034172 Ga0307410_100341723 166
176 3300031901 Ga0307406_10018027 Ga0307406_100180272 166
177 3300031903 Ga0307407_10007021 Ga0307407_100070215 166
178 3300031911 Ga0307412_10323890 Ga0307412_103238902 166
179 3300031995 Ga0307409_100163018 Ga0307409_1001630182 166
180 3300032002 Ga0307416_100010981 Ga0307416_1000109813 166
181 3300032002 Ga0307416_100114106 Ga0307416_1001141063 166
182 3300032005 Ga0307411_10037829 Ga0307411_100378294 166
183 3300032005 Ga0307411_10435597 Ga0307411_104355972 166
184 3300032126 Ga0307415_100000902 Ga0307415_1000009024 166
185 3300032126 Ga0307415_100018798 Ga0307415_1000187982 166
186 3300032126 Ga0307415_100392427 Ga0307415_1003924272 166
187 3300003203 JGI25406J46586_10018654 JGI25406J46586_100186545 167
188 3300005327 Ga0070658_11225640 Ga0070658_112256401 167
189 3300005329 Ga0070683_100132025 Ga0070683_1001320253 167
190 3300005338 Ga0068868_100581851 Ga0068868_1005818512 167
191 3300005345 Ga0070692_10085595 Ga0070692_100855951 167
192 3300005438 Ga0070701_10318101 Ga0070701_103181012 167
193 3300005543 Ga0070672_100000003 Ga0070672_10000000314 167
194 3300005546 Ga0070696_100997958 Ga0070696_1009979582 167
195 3300005578 Ga0068854_100506719 Ga0068854_1005067192 167
196 3300005615 Ga0070702_100089804 Ga0070702_1000898042 167
197 3300005618 Ga0068864_101297641 Ga0068864_1012976412 167
198 3300005937 Ga0081455_10013749 Ga0081455_100137492 167
199 3300005985 Ga0081539_10028605 Ga0081539_100286055 167
200 3300006058 Ga0075432_10090093 Ga0075432_100900931 167
201 3300006844 Ga0075428_100045652 Ga0075428_1000456523 167
202 3300006847 Ga0075431_100534343 Ga0075431_1005343431 167
203 3300009094 Ga0111539_10009234 Ga0111539_100092348 167
204 3300009094 Ga0111539_10332640 Ga0111539_103326402 167
205 3300009148 Ga0105243_10355068 Ga0105243_103550682 167
206 3300009176 Ga0105242_11470223 Ga0105242_114702232 167
207 3300009551 Ga0105238_10855761 Ga0105238_108557612 167
208 3300010375 Ga0105239_10837492 Ga0105239_108374922 167
209 3300011119 Ga0105246_10545038 Ga0105246_105450382 167
210 3300013306 Ga0163162_10723612 Ga0163162_107236122 167
211 3300014326 Ga0157380_10558060 Ga0157380_105580602 167
212 3300025908 Ga0207643_10145792 Ga0207643_101457922 167
213 3300025933 Ga0207706_10576692 Ga0207706_105766921 167
214 3300025940 Ga0207691_10000005 Ga0207691_1000000516 167
215 3300025944 Ga0207661_10030094 Ga0207661_100300945 167
216 3300025945 Ga0207679_11364670 Ga0207679_113646702 167
217 3300025961 Ga0207712_10620335 Ga0207712_106203352 167
218 3300026067 Ga0207678_10217878 Ga0207678_102178782 167
219 3300027907 Ga0207428_10043985 Ga0207428_100439855 167
220 3300031852 Ga0307410_10138507 Ga0307410_101385072 167
221 3300031995 Ga0307409_100403306 Ga0307409_1004033062 167
222 3300032005 Ga0307411_10234816 Ga0307411_102348162 167
223 3300032126 Ga0307415_100179335 Ga0307415_1001793352 167
224 3300032126 Ga0307415_100450932 Ga0307415_1004509322 167
225 3300037418 Ga0395900_0675323 Ga0395900_0675323_183_734 167
226 3300037466 Ga0395898_0076838 Ga0395898_0076838_502_1050 167
227 3300037466 Ga0395898_1028707 Ga0395898_1028707_11_559 167
228 3300037471 Ga0395905_0132251 Ga0395905_0132251_1558_2106 167
229 3300038443 Ga0395901_0565201 Ga0395901_0565201_82_594 167
230 3300046500 Ga0495596_0091803 Ga0495596_0091803_469_984 167
231 3300046518 Ga0495631_0179932 Ga0495631_0179932_34_549 167
232 3300046537 Ga0495598_0304441 Ga0495598_0304441_72_587 167
233 3300046539 Ga0495621_0392720 Ga0495621_0392720_12_527 167
234 3300048913 Ga0496110_0742544 Ga0496110_0742544_234_749 167
235 3300048914 Ga0496111_0340594 Ga0496111_0340594_227_742 167
236 3300049583 Ga0501067_0227383 Ga0501067_0227383_485_1000 167
237 3300049741 Ga0501079_0604150 Ga0501079_0604150_201_716 167
238 3300050510 nmdc:mga06r32_789405_c1 nmdc:mga06r32_789405_c1_370_885 167
239 3300050511 nmdc:mga08y16_2067_c1 nmdc:mga08y16_2067_c1_8841_9356 167
240 3300050511 nmdc:mga08y16_244087_c1 nmdc:mga08y16_244087_c1_652_1167 167
241 3300053083 Ga0495655_0030225 Ga0495655_0030225_766_1281 167
242 3300003373 JGI25407J50210_10031519 JGI25407J50210_100315192 168
243 3300005329 Ga0070683_100204451 Ga0070683_1002044513 168
244 3300005331 Ga0070670_100795377 Ga0070670_1007953771 168
245 3300005339 Ga0070660_100360022 Ga0070660_1003600222 168
246 3300005339 Ga0070660_100881979 Ga0070660_1008819791 168
247 3300005356 Ga0070674_100606498 Ga0070674_1006064982 168
248 3300005366 Ga0070659_100304430 Ga0070659_1003044302 168
249 3300005366 Ga0070659_100773351 Ga0070659_1007733511 168
250 3300005441 Ga0070700_100057935 Ga0070700_1000579354 168
251 3300005455 Ga0070663_100634852 Ga0070663_1006348522 168
252 3300005456 Ga0070678_100159308 Ga0070678_1001593082 168
253 3300005466 Ga0070685_10089592 Ga0070685_100895922 168
254 3300005535 Ga0070684_100730482 Ga0070684_1007304822 168
255 3300005539 Ga0068853_101544668 Ga0068853_1015446681 168
256 3300005564 Ga0070664_100808496 Ga0070664_1008084962 168
257 3300005577 Ga0068857_101018018 Ga0068857_1010180181 168
258 3300005615 Ga0070702_100582319 Ga0070702_1005823192 168
259 3300005616 Ga0068852_101446079 Ga0068852_1014460792 168
260 3300005937 Ga0081455_10077124 Ga0081455_100771245 168
261 3300005981 Ga0081538_10000672 Ga0081538_100006729 168
262 3300006175 Ga0070712_100058438 Ga0070712_1000584384 168
263 3300006358 Ga0068871_101435956 Ga0068871_1014359561 168
264 3300025899 Ga0207642_10358057 Ga0207642_103580572 168
265 3300025901 Ga0207688_10020234 Ga0207688_100202342 168
266 3300025901 Ga0207688_10324552 Ga0207688_103245522 168
267 3300025907 Ga0207645_10134516 Ga0207645_101345162 168
268 3300025908 Ga0207643_10053322 Ga0207643_100533223 168
269 3300025915 Ga0207693_10025456 Ga0207693_100254564 168
270 3300025923 Ga0207681_10605440 Ga0207681_106054402 168
271 3300025925 Ga0207650_10451257 Ga0207650_104512572 168
272 3300025932 Ga0207690_10368001 Ga0207690_103680012 168
273 3300025940 Ga0207691_10322078 Ga0207691_103220782 168
274 3300025945 Ga0207679_10395543 Ga0207679_103955432 168
275 3300026023 Ga0207677_10712381 Ga0207677_107123811 168
276 3300026075 Ga0207708_10141957 Ga0207708_101419573 168
277 3300026089 Ga0207648_10030680 Ga0207648_100306804 168
278 3300026116 Ga0207674_10675608 Ga0207674_106756082 168
279 3300026118 Ga0207675_100014322 Ga0207675_1000143222 168
280 3300026121 Ga0207683_10086377 Ga0207683_100863773 168
281 3300026142 Ga0207698_11309018 Ga0207698_113090181 168
282 3300031995 Ga0307409_100400896 Ga0307409_1004008962 168
283 3300032126 Ga0307415_101340856 Ga0307415_1013408562 168
284 3300037466 Ga0395898_0741479 Ga0395898_0741479_301_819 168
285 3300042011 Ga0439454_033148 Ga0439454_033148_68_586 168
286 3300042438 Ga0439459_0171988 Ga0439459_0171988_43_561 168
287 3300050511 nmdc:mga08y16_276277_c1 nmdc:mga08y16_276277_c1_950_1468 168
288 3300005329 Ga0070683_100200901 Ga0070683_1002009012 169
289 3300005335 Ga0070666_10130504 Ga0070666_101305042 169
290 3300005338 Ga0068868_100007830 Ga0068868_1000078306 169
291 3300005338 Ga0068868_100013387 Ga0068868_1000133876 169
292 3300005340 Ga0070689_100118366 Ga0070689_1001183663 169
293 3300005340 Ga0070689_100275718 Ga0070689_1002757182 169
294 3300005341 Ga0070691_10121755 Ga0070691_101217552 169
295 3300005344 Ga0070661_100000045 Ga0070661_10000004522 169
296 3300005347 Ga0070668_100430500 Ga0070668_1004305002 169
297 3300005347 Ga0070668_100789921 Ga0070668_1007899212 169
298 3300005353 Ga0070669_100431524 Ga0070669_1004315242 169
299 3300005354 Ga0070675_100251789 Ga0070675_1002517892 169
300 3300005356 Ga0070674_100427065 Ga0070674_1004270651 169
301 3300005364 Ga0070673_100246723 Ga0070673_1002467232 169
302 3300005366 Ga0070659_100063795 Ga0070659_1000637952 169
303 3300005366 Ga0070659_100457757 Ga0070659_1004577572 169
304 3300005439 Ga0070711_100037276 Ga0070711_1000372764 169
305 3300005440 Ga0070705_100338113 Ga0070705_1003381132 169
306 3300005441 Ga0070700_100024596 Ga0070700_1000245963 169
307 3300005444 Ga0070694_100178997 Ga0070694_1001789972 169
308 3300005455 Ga0070663_100015088 Ga0070663_1000150883 169
309 3300005456 Ga0070678_100213808 Ga0070678_1002138082 169
310 3300005458 Ga0070681_10469373 Ga0070681_104693732 169
311 3300005459 Ga0068867_100640815 Ga0068867_1006408152 169
312 3300005466 Ga0070685_10038181 Ga0070685_100381812 169
313 3300005466 Ga0070685_10476139 Ga0070685_104761392 169
314 3300005468 Ga0070707_100509138 Ga0070707_1005091382 169
315 3300005530 Ga0070679_100562483 Ga0070679_1005624832 169
316 3300005535 Ga0070684_100014039 Ga0070684_1000140394 169
317 3300005539 Ga0068853_100092136 Ga0068853_1000921363 169
318 3300005545 Ga0070695_100325927 Ga0070695_1003259272 169
319 3300005545 Ga0070695_100496326 Ga0070695_1004963261 169
320 3300005546 Ga0070696_101187887 Ga0070696_1011878871 169
321 3300005547 Ga0070693_100711599 Ga0070693_1007115991 169
322 3300005549 Ga0070704_100044190 Ga0070704_1000441902 169
323 3300005563 Ga0068855_100629730 Ga0068855_1006297301 169
324 3300005564 Ga0070664_100017819 Ga0070664_1000178194 169
325 3300005577 Ga0068857_100044619 Ga0068857_1000446195 169
326 3300005578 Ga0068854_100210015 Ga0068854_1002100152 169
327 3300005614 Ga0068856_100016706 Ga0068856_1000167064 169
328 3300005618 Ga0068864_100035240 Ga0068864_1000352403 169
329 3300005844 Ga0068862_100192889 Ga0068862_1001928893 169
330 3300005937 Ga0081455_10023617 Ga0081455_100236174 169
331 3300005937 Ga0081455_10122076 Ga0081455_101220764 169
332 3300005981 Ga0081538_10138040 Ga0081538_101380401 169
333 3300006038 Ga0075365_10001083 Ga0075365_100010835 169
334 3300006038 Ga0075365_10007080 Ga0075365_100070805 169
335 3300006051 Ga0075364_10022106 Ga0075364_100221063 169
336 3300006173 Ga0070716_100166796 Ga0070716_1001667962 169
337 3300006175 Ga0070712_100028261 Ga0070712_1000282614 169
338 3300006175 Ga0070712_100114183 Ga0070712_1001141832 169
339 3300006178 Ga0075367_10071294 Ga0075367_100712941 169
340 3300006844 Ga0075428_100082542 Ga0075428_1000825425 169
341 3300006846 Ga0075430_100255751 Ga0075430_1002557511 169
342 3300006847 Ga0075431_100000960 Ga0075431_10000096014 169
343 3300006871 Ga0075434_100189946 Ga0075434_1001899462 169
344 3300006871 Ga0075434_100296494 Ga0075434_1002964942 169
345 3300006871 Ga0075434_100872329 Ga0075434_1008723292 169
346 3300006881 Ga0068865_100062494 Ga0068865_1000624942 169
347 3300006881 Ga0068865_101469688 Ga0068865_1014696881 169
348 3300006914 Ga0075436_100065903 Ga0075436_1000659035 169
349 3300009093 Ga0105240_10450313 Ga0105240_104503132 169
350 3300009094 Ga0111539_10021383 Ga0111539_100213837 169
351 3300009094 Ga0111539_10065292 Ga0111539_100652922 169
352 3300009098 Ga0105245_10003240 Ga0105245_1000324013 169
353 3300009098 Ga0105245_10011445 Ga0105245_100114457 169
354 3300009147 Ga0114129_10032655 Ga0114129_100326553 169
355 3300009147 Ga0114129_10794606 Ga0114129_107946062 169
356 3300009147 Ga0114129_10840677 Ga0114129_108406771 169
357 3300009148 Ga0105243_10021302 Ga0105243_100213021 169
358 3300009148 Ga0105243_10028552 Ga0105243_100285523 169
359 3300009176 Ga0105242_10218215 Ga0105242_102182152 169
360 3300009177 Ga0105248_10181516 Ga0105248_101815164 169
361 3300009545 Ga0105237_10193645 Ga0105237_101936452 169
362 3300009553 Ga0105249_10390570 Ga0105249_103905702 169
363 3300010375 Ga0105239_10014993 Ga0105239_100149939 169
364 3300010375 Ga0105239_11320221 Ga0105239_113202212 169
365 3300011119 Ga0105246_11111435 Ga0105246_111114352 169
366 3300013296 Ga0157374_10030601 Ga0157374_100306018 169
367 3300013307 Ga0157372_10021012 Ga0157372_100210128 169
368 3300013308 Ga0157375_10071918 Ga0157375_100719183 169
369 3300013308 Ga0157375_10282617 Ga0157375_102826172 169
370 3300014325 Ga0163163_10132820 Ga0163163_101328204 169
371 3300014745 Ga0157377_10000202 Ga0157377_1000020215 169
372 3300014968 Ga0157379_10438288 Ga0157379_104382882 169
373 3300014969 Ga0157376_10121005 Ga0157376_101210052 169
374 3300017792 Ga0163161_10142522 Ga0163161_101425222 169
375 3300025901 Ga0207688_10004236 Ga0207688_100042369 169
376 3300025903 Ga0207680_10411618 Ga0207680_104116182 169
377 3300025908 Ga0207643_10371112 Ga0207643_103711122 169
378 3300025915 Ga0207693_10008956 Ga0207693_100089567 169
379 3300025915 Ga0207693_10018190 Ga0207693_100181908 169
380 3300025916 Ga0207663_10047827 Ga0207663_100478273 169
381 3300025920 Ga0207649_10000021 Ga0207649_1000002169 169
382 3300025922 Ga0207646_10252262 Ga0207646_102522622 169
383 3300025926 Ga0207659_10055358 Ga0207659_100553584 169
384 3300025927 Ga0207687_10012274 Ga0207687_100122743 169
385 3300025927 Ga0207687_10020408 Ga0207687_100204086 169
386 3300025932 Ga0207690_10457079 Ga0207690_104570792 169
387 3300025933 Ga0207706_10044210 Ga0207706_100442102 169
388 3300025934 Ga0207686_10373022 Ga0207686_103730222 169
389 3300025935 Ga0207709_10027029 Ga0207709_100270295 169
390 3300025938 Ga0207704_10021680 Ga0207704_100216802 169
391 3300025938 Ga0207704_10487627 Ga0207704_104876271 169
392 3300025939 Ga0207665_10105338 Ga0207665_101053384 169
393 3300025941 Ga0207711_10220126 Ga0207711_102201262 169
394 3300025942 Ga0207689_10007500 Ga0207689_100075009 169
395 3300025944 Ga0207661_10097221 Ga0207661_100972213 169
396 3300025945 Ga0207679_10057576 Ga0207679_100575762 169
397 3300025961 Ga0207712_10184686 Ga0207712_101846862 169
398 3300025961 Ga0207712_10217501 Ga0207712_102175012 169
399 3300025972 Ga0207668_10061962 Ga0207668_100619622 169
400 3300025981 Ga0207640_10411148 Ga0207640_104111482 169
401 3300026023 Ga0207677_10009775 Ga0207677_100097755 169
402 3300026023 Ga0207677_10267664 Ga0207677_102676642 169
403 3300026041 Ga0207639_10266062 Ga0207639_102660622 169
404 3300026067 Ga0207678_10014936 Ga0207678_100149368 169
405 3300026075 Ga0207708_10000869 Ga0207708_1000086910 169
406 3300026078 Ga0207702_10177134 Ga0207702_101771342 169
407 3300026089 Ga0207648_10482944 Ga0207648_104829442 169
408 3300026116 Ga0207674_10377087 Ga0207674_103770872 169
409 3300026118 Ga0207675_100155247 Ga0207675_1001552472 169
410 3300026121 Ga0207683_10202143 Ga0207683_102021432 169
411 3300026142 Ga0207698_10398578 Ga0207698_103985782 169
412 3300027907 Ga0207428_10007412 Ga0207428_100074127 169
413 3300027907 Ga0207428_10019314 Ga0207428_100193147 169
414 3300028379 Ga0268266_11149997 Ga0268266_111499972 169
415 3300031901 Ga0307406_10227359 Ga0307406_102273592 169
416 3300032126 Ga0307415_101286024 Ga0307415_1012860241 169
417 3300037312 Ga0395899_0735148 Ga0395899_0735148_11_559 169
418 3300037418 Ga0395900_0625959 Ga0395900_0625959_369_917 169
419 3300037466 Ga0395898_0242946 Ga0395898_0242946_29_574 169
420 3300038443 Ga0395901_0014858 Ga0395901_0014858_5538_6083 169
421 3300041460 Ga0451802_0700236 Ga0451802_0700236_35_583 169
422 3300045976 Ga0466967_0094559 Ga0466967_0094559_948_1493 169
423 3300046455 Ga0495603_0044142 Ga0495603_0044142_698_1243 169
424 3300046461 Ga0495641_0037143 Ga0495641_0037143_774_1319 169
425 3300046473 Ga0495582_0038704 Ga0495582_0038704_605_1150 169
426 3300046491 Ga0495584_0172878 Ga0495584_0172878_83_604 169
427 3300046499 Ga0495594_0104820 Ga0495594_0104820_823_1368 169
428 3300046514 Ga0495618_0000004 Ga0495618_0000004_21909_22418 169
429 3300046517 Ga0495630_0020577 Ga0495630_0020577_3965_4474 169
430 3300046663 Ga0495635_0000063 Ga0495635_0000063_46485_46994 169
431 3300046683 Ga0495658_0064364 Ga0495658_0064364_1364_1909 169
432 3300046689 Ga0495613_0000369 Ga0495613_0000369_11706_12215 169
433 3300046809 Ga0495600_0002253 Ga0495600_0002253_6038_6547 169
434 3300047317 Ga0495604_0000033 Ga0495604_0000033_95553_96062 169
435 3300047321 Ga0495676_0008602 Ga0495676_0008602_1847_2392 169
436 3300047322 Ga0495680_0309582 Ga0495680_0309582_172_681 169
437 3300048903 Ga0496100_0330969 Ga0496100_0330969_360_899 169
438 3300048904 Ga0496101_0039050 Ga0496101_0039050_1388_1933 169
439 3300048904 Ga0496101_0169979 Ga0496101_0169979_1058_1597 169
440 3300048905 Ga0496102_0029058 Ga0496102_0029058_2189_2728 169
441 3300048905 Ga0496102_0045086 Ga0496102_0045086_3146_3691 169
442 3300048906 Ga0496103_0020698 Ga0496103_0020698_660_1205 169
443 3300048906 Ga0496103_0487612 Ga0496103_0487612_31_570 169
444 3300048906 Ga0496103_0552623 Ga0496103_0552623_185_712 169
445 3300048907 Ga0496104_0007632 Ga0496104_0007632_5707_6246 169
446 3300048907 Ga0496104_0171027 Ga0496104_0171027_548_1093 169
447 3300048908 Ga0496105_0047857 Ga0496105_0047857_965_1510 169
448 3300048908 Ga0496105_0049913 Ga0496105_0049913_2006_2545 169
449 3300048909 Ga0496106_0012504 Ga0496106_0012504_2182_2727 169
450 3300048909 Ga0496106_0033927 Ga0496106_0033927_1554_2093 169
451 3300048910 Ga0496107_0004466 Ga0496107_0004466_6267_6812 169
452 3300048910 Ga0496107_0027536 Ga0496107_0027536_2221_2760 169
453 3300048911 Ga0496108_0024788 Ga0496108_0024788_2767_3312 169
454 3300048911 Ga0496108_0030574 Ga0496108_0030574_3847_4386 169
455 3300048912 Ga0496109_0055073 Ga0496109_0055073_1310_1849 169
456 3300048912 Ga0496109_0232746 Ga0496109_0232746_892_1437 169
457 3300048913 Ga0496110_0071200 Ga0496110_0071200_437_976 169
458 3300048913 Ga0496110_0192970 Ga0496110_0192970_1101_1646 169
459 3300048914 Ga0496111_0049802 Ga0496111_0049802_314_859 169
460 3300048915 Ga0496112_0069733 Ga0496112_0069733_2658_3203 169
461 3300048916 Ga0496113_0021763 Ga0496113_0021763_2210_2749 169
462 3300048917 Ga0496114_0076181 Ga0496114_0076181_1793_2338 169
463 3300048918 Ga0496115_0010437 Ga0496115_0010437_4035_4580 169
464 3300048919 Ga0496116_0000383 Ga0496116_0000383_53534_54049 169
465 3300048920 Ga0496117_0172358 Ga0496117_0172358_728_1243 169
466 3300048922 Ga0496119_0001491 Ga0496119_0001491_9622_10137 169
467 3300049570 Ga0501033_0290880 Ga0501033_0290880_404_946 169
468 3300049572 Ga0501036_0072455 Ga0501036_0072455_1527_2069 169
469 3300049574 Ga0501038_0074699 Ga0501038_0074699_461_1003 169
470 3300049575 Ga0501039_0058119 Ga0501039_0058119_1645_2187 169
471 3300049576 Ga0501040_0403839 Ga0501040_0403839_165_704 169
472 3300049582 Ga0501048_0014802 Ga0501048_0014802_1775_2317 169
473 3300049584 Ga0501068_0204358 Ga0501068_0204358_416_958 169
474 3300049586 Ga0501070_0305179 Ga0501070_0305179_256_798 169
475 3300049588 Ga0501072_0002808 Ga0501072_0002808_2909_3451 169
476 3300049590 Ga0501074_0172762 Ga0501074_0172762_218_760 169
477 3300049591 Ga0501075_0017405 Ga0501075_0017405_456_998 169
478 3300049591 Ga0501075_0102000 Ga0501075_0102000_60_569 169
479 3300049592 Ga0501076_0001340 Ga0501076_0001340_6438_6980 169
480 3300049593 Ga0501077_0157549 Ga0501077_0157549_281_823 169
481 3300049741 Ga0501079_0072035 Ga0501079_0072035_269_811 169
482 3300049743 Ga0501081_0003237 Ga0501081_0003237_5319_5861 169
483 3300049822 Ga0501035_0178443 Ga0501035_0178443_200_742 169
484 3300049824 Ga0501045_0004663 Ga0501045_0004663_6729_7271 169
485 3300050491 nmdc:mga00v17_25864_c1 nmdc:mga00v17_25864_c1_1435_1980 169
486 3300050492 nmdc:mga0yw44_5034_c1 nmdc:mga0yw44_5034_c1_1489_2034 169
487 3300050492 nmdc:mga0yw44_5381_c1 nmdc:mga0yw44_5381_c1_4975_5520 169
488 3300050507 nmdc:mga05p37_1191423_c1 nmdc:mga05p37_1191423_c1_167_724 169
489 3300050507 nmdc:mga05p37_22454_c1 nmdc:mga05p37_22454_c1_5751_6311 169
490 3300050507 nmdc:mga05p37_805080_c1 nmdc:mga05p37_805080_c1_155_700 169
491 3300050507 nmdc:mga05p37_84577_c1 nmdc:mga05p37_84577_c1_2481_3062 169
492 3300050509 nmdc:mga0qj67_324025_c1 nmdc:mga0qj67_324025_c1_651_1196 169
493 3300050509 nmdc:mga0qj67_537711_c1 nmdc:mga0qj67_537711_c1_98_643 169
494 3300050510 nmdc:mga06r32_14654_c1 nmdc:mga06r32_14654_c1_6329_6874 169
495 3300050510 nmdc:mga06r32_1531_c1 nmdc:mga06r32_1531_c1_8140_8700 169
496 3300050510 nmdc:mga06r32_19865_c1 nmdc:mga06r32_19865_c1_1785_2324 169
497 3300050511 nmdc:mga08y16_27817_c1 nmdc:mga08y16_27817_c1_4298_4837 169
498 3300050511 nmdc:mga08y16_35398_c1 nmdc:mga08y16_35398_c1_3301_3861 169
499 3300050512 nmdc:mga0n895_312579_c1 nmdc:mga0n895_312579_c1_485_1024 169
500 3300050512 nmdc:mga0n895_810759_c1 nmdc:mga0n895_810759_c1_104_649 169
501 3300050512 nmdc:mga0n895_87069_c1 nmdc:mga0n895_87069_c1_1650_2189 169
502 3300050513 nmdc:mga0rr50_58397_c1 nmdc:mga0rr50_58397_c1_2197_2736 169
503 3300050515 nmdc:mga0a205_84873_c1 nmdc:mga0a205_84873_c1_1095_1634 169
504 3300053119 Ga0500595_044764 Ga0500595_044764_427_942 169
505 3300054114 Ga0501084_0002620 Ga0501084_0002620_9577_10119 169
506 3300054114 Ga0501084_1004241 Ga0501084_1004241_94_636 169
507 3300060353 Ga0501082_0001162 Ga0501082_0001162_9992_10534 169
508 3300061734 Ga0530510_0002230 Ga0530510_0002230_1691_2233 169
509 3300005331 Ga0070670_100661160 Ga0070670_1006611602 170
510 3300005841 Ga0068863_100000042 Ga0068863_10000004273 170
511 3300044694 Ga0466963_0000034 Ga0466963_0000034_9054_9566 170
512 3300046515 Ga0495620_0000388 Ga0495620_0000388_7274_7786 170
513 3300046523 Ga0495644_0003763 Ga0495644_0003763_1460_1972 170
514 3300046535 Ga0495586_0004988 Ga0495586_0004988_863_1375 170
515 3300046543 Ga0495645_0004732 Ga0495645_0004732_7305_7817 170
516 3300046690 Ga0495624_0003530 Ga0495624_0003530_7918_8430 170
517 3300048088 Ga0495602_0707031 Ga0495602_0707031_29_541 170
518 3300001979 JGI24740J21852_10000392 JGI24740J21852_1000039218 171
519 3300005329 Ga0070683_100218918 Ga0070683_1002189182 171
520 3300005341 Ga0070691_10000124 Ga0070691_100001248 171
521 3300005347 Ga0070668_100065392 Ga0070668_1000653924 171
522 3300005354 Ga0070675_100000187 Ga0070675_10000018718 171
523 3300005437 Ga0070710_10321379 Ga0070710_103213792 171
524 3300005455 Ga0070663_100000698 Ga0070663_1000006985 171
525 3300005455 Ga0070663_100459301 Ga0070663_1004593012 171
526 3300005455 Ga0070663_101416483 Ga0070663_1014164831 171
527 3300005466 Ga0070685_10002681 Ga0070685_100026816 171
528 3300005530 Ga0070679_100006106 Ga0070679_1000061065 171
529 3300005578 Ga0068854_100005403 Ga0068854_1000054037 171
530 3300005614 Ga0068856_100005550 Ga0068856_1000055509 171
531 3300005617 Ga0068859_100703707 Ga0068859_1007037072 171
532 3300005834 Ga0068851_10022018 Ga0068851_100220184 171
533 3300005840 Ga0068870_10102758 Ga0068870_101027583 171
534 3300005841 Ga0068863_100282913 Ga0068863_1002829131 171
535 3300005985 Ga0081539_10003805 Ga0081539_1000380515 171
536 3300006358 Ga0068871_100544773 Ga0068871_1005447732 171
537 3300006881 Ga0068865_101299922 Ga0068865_1012999222 171
538 3300006931 Ga0097620_100703675 Ga0097620_1007036751 171
539 3300009098 Ga0105245_10000425 Ga0105245_1000042513 171
540 3300009148 Ga0105243_10479133 Ga0105243_104791332 171
541 3300009176 Ga0105242_10000975 Ga0105242_1000097517 171
542 3300009553 Ga0105249_10000085 Ga0105249_1000008557 171
543 3300013296 Ga0157374_10008161 Ga0157374_100081618 171
544 3300013297 Ga0157378_10009908 Ga0157378_100099088 171
545 3300013297 Ga0157378_10144750 Ga0157378_101447503 171
546 3300014326 Ga0157380_10000017 Ga0157380_1000001723 171
547 3300014968 Ga0157379_10002830 Ga0157379_1000283013 171
548 3300014968 Ga0157379_10120078 Ga0157379_101200782 171
549 3300025893 Ga0207682_10000457 Ga0207682_1000045711 171
550 3300025898 Ga0207692_10419080 Ga0207692_104190802 171
551 3300025908 Ga0207643_10045902 Ga0207643_100459022 171
552 3300025921 Ga0207652_10008471 Ga0207652_100084715 171
553 3300025926 Ga0207659_10000074 Ga0207659_1000007429 171
554 3300025927 Ga0207687_10000021 Ga0207687_10000021191 171
555 3300025934 Ga0207686_10000418 Ga0207686_1000041820 171
556 3300025935 Ga0207709_10562161 Ga0207709_105621612 171
557 3300025938 Ga0207704_10896565 Ga0207704_108965652 171
558 3300025961 Ga0207712_10000033 Ga0207712_1000003365 171
559 3300025972 Ga0207668_10062042 Ga0207668_100620422 171
560 3300025981 Ga0207640_10023696 Ga0207640_100236964 171
561 3300026067 Ga0207678_10008262 Ga0207678_100082625 171
562 3300026078 Ga0207702_10001072 Ga0207702_1000107214 171
563 3300026088 Ga0207641_10973440 Ga0207641_109734402 171
564 3300028379 Ga0268266_10476464 Ga0268266_104764642 171
565 3300035172 Ga0373955_0197218 Ga0373955_0197218_48_563 171
566 3300044694 Ga0466963_0150559 Ga0466963_0150559_1067_1585 171
567 3300045976 Ga0466967_0000007 Ga0466967_0000007_12633_13148 171
568 3300045976 Ga0466967_0355069 Ga0466967_0355069_288_806 171
569 3300046454 Ga0495592_0404695 Ga0495592_0404695_94_609 171
570 3300046459 Ga0495629_0000746 Ga0495629_0000746_16785_17300 171
571 3300046459 Ga0495629_0110986 Ga0495629_0110986_863_1378 171
572 3300046461 Ga0495641_0061685 Ga0495641_0061685_627_1142 171
573 3300046461 Ga0495641_0115829 Ga0495641_0115829_325_840 171
574 3300046507 Ga0495606_0000131 Ga0495606_0000131_37427_37942 171
575 3300046516 Ga0495628_0295102 Ga0495628_0295102_643_1167 171
576 3300046517 Ga0495630_0000168 Ga0495630_0000168_14268_14792 171
577 3300046517 Ga0495630_0000416 Ga0495630_0000416_24886_25401 171
578 3300046517 Ga0495630_0414810 Ga0495630_0414810_389_913 171
579 3300046642 Ga0495634_0013021 Ga0495634_0013021_403_921 171
580 3300046642 Ga0495634_0666406 Ga0495634_0666406_12_527 171
581 3300046660 Ga0495625_0000204 Ga0495625_0000204_10494_11012 171
582 3300046663 Ga0495635_0040045 Ga0495635_0040045_2621_3145 171
583 3300046675 Ga0495657_0068360 Ga0495657_0068360_745_1269 171
584 3300046683 Ga0495658_0317603 Ga0495658_0317603_260_784 171
585 3300046684 Ga0495669_0000169 Ga0495669_0000169_11323_11841 171
586 3300046690 Ga0495624_0000305 Ga0495624_0000305_844_1359 171
587 3300046694 Ga0495649_0001488 Ga0495649_0001488_2595_3110 171
588 3300047317 Ga0495604_0444852 Ga0495604_0444852_122_637 171
589 3300047444 Ga0495675_0029691 Ga0495675_0029691_2615_3130 171
590 3300048903 Ga0496100_0000003 Ga0496100_0000003_153151_153666 171
591 3300048904 Ga0496101_0000003 Ga0496101_0000003_153151_153666 171
592 3300048906 Ga0496103_0063823 Ga0496103_0063823_1430_1951 171
593 3300048907 Ga0496104_0000007 Ga0496104_0000007_338286_338801 171
594 3300048907 Ga0496104_0000066 Ga0496104_0000066_65617_66132 171
595 3300048908 Ga0496105_0000002 Ga0496105_0000002_541225_541740 171
596 3300048908 Ga0496105_0000020 Ga0496105_0000020_115353_115868 171
597 3300048908 Ga0496105_0066557 Ga0496105_0066557_84_617 171
598 3300048909 Ga0496106_0000015 Ga0496106_0000015_108911_109426 171
599 3300048910 Ga0496107_0000008 Ga0496107_0000008_44211_44726 171
600 3300048911 Ga0496108_0000002 Ga0496108_0000002_25588_26103 171
601 3300048912 Ga0496109_0000001 Ga0496109_0000001_25550_26065 171
602 3300048912 Ga0496109_0372894 Ga0496109_0372894_411_926 171
603 3300048912 Ga0496109_0470305 Ga0496109_0470305_83_616 171
604 3300048914 Ga0496111_0140244 Ga0496111_0140244_1095_1610 171
605 3300048917 Ga0496114_0105636 Ga0496114_0105636_1139_1654 171
606 3300048920 Ga0496117_0006252 Ga0496117_0006252_3315_3836 171
607 3300048920 Ga0496117_0251798 Ga0496117_0251798_430_948 171
608 3300048921 Ga0496118_0000151 Ga0496118_0000151_105891_106412 171
609 3300048922 Ga0496119_0020645 Ga0496119_0020645_2837_3358 171
610 3300048922 Ga0496119_0191967 Ga0496119_0191967_123_644 171
611 3300048923 Ga0496120_0031801 Ga0496120_0031801_573_1094 171
612 3300048927 Ga0496124_0370730 Ga0496124_0370730_238_759 171
613 3300048928 Ga0496125_0023449 Ga0496125_0023449_455_976 171
614 3300048929 Ga0496126_0041631 Ga0496126_0041631_977_1492 171
615 3300048929 Ga0496126_0101084 Ga0496126_0101084_1162_1677 171
616 3300049579 Ga0501043_0441120 Ga0501043_0441120_335_850 171
617 3300049581 Ga0501047_0006642 Ga0501047_0006642_3414_3929 171
618 3300049581 Ga0501047_0047086 Ga0501047_0047086_1223_1738 171
619 3300049581 Ga0501047_0081451 Ga0501047_0081451_37_558 171
620 3300049585 Ga0501069_0064796 Ga0501069_0064796_1288_1803 171
621 3300049585 Ga0501069_0435247 Ga0501069_0435247_35_550 171
622 3300049586 Ga0501070_0007643 Ga0501070_0007643_8358_8879 171
623 3300049586 Ga0501070_0217273 Ga0501070_0217273_956_1471 171
624 3300049586 Ga0501070_0237462 Ga0501070_0237462_740_1255 171
625 3300049586 Ga0501070_0624377 Ga0501070_0624377_292_807 171
626 3300049586 Ga0501070_0751237 Ga0501070_0751237_35_550 171
627 3300049590 Ga0501074_0016615 Ga0501074_0016615_2252_2767 171
628 3300049741 Ga0501079_0032683 Ga0501079_0032683_2545_3060 171
629 3300049742 Ga0501080_0156454 Ga0501080_0156454_941_1456 171
630 3300049744 Ga0501083_0229773 Ga0501083_0229773_49_564 171
631 3300049822 Ga0501035_0399070 Ga0501035_0399070_39_554 171
632 3300053077 Ga0495601_0003622 Ga0495601_0003622_4063_4578 171
633 3300053077 Ga0495601_0024330 Ga0495601_0024330_2297_2821 171
634 3300053077 Ga0495601_0034664 Ga0495601_0034664_156_689 171
635 3300053078 Ga0495612_0001969 Ga0495612_0001969_7162_7677 171
636 3300053078 Ga0495612_0037600 Ga0495612_0037600_1240_1755 171
637 3300053084 Ga0495595_0149252 Ga0495595_0149252_26_550 171
638 3300053085 Ga0495619_0000285 Ga0495619_0000285_16073_16597 171
639 3300053085 Ga0495619_0029750 Ga0495619_0029750_2980_3504 171
640 3300053119 Ga0500595_060733 Ga0500595_060733_591_1106 171
641 3300005329 Ga0070683_100166626 Ga0070683_1001666262 172
642 3300005347 Ga0070668_100019444 Ga0070668_1000194444 172
643 3300005367 Ga0070667_100000374 Ga0070667_10000037412 172
644 3300005535 Ga0070684_100902870 Ga0070684_1009028701 172
645 3300005564 Ga0070664_100579871 Ga0070664_1005798712 172
646 3300005577 Ga0068857_100633759 Ga0068857_1006337592 172
647 3300005842 Ga0068858_100119035 Ga0068858_1001190352 172
648 3300005843 Ga0068860_100100342 Ga0068860_1001003422 172
649 3300005844 Ga0068862_100000278 Ga0068862_10000027815 172
650 3300005937 Ga0081455_10008890 Ga0081455_100088904 172
651 3300009553 Ga0105249_10004260 Ga0105249_100042608 172
652 3300010375 Ga0105239_11644988 Ga0105239_116449882 172
653 3300014325 Ga0163163_10383221 Ga0163163_103832212 172
654 3300014968 Ga0157379_10106090 Ga0157379_101060903 172
655 3300025945 Ga0207679_10544814 Ga0207679_105448141 172
656 3300025961 Ga0207712_10002885 Ga0207712_100028858 172
657 3300025972 Ga0207668_10014146 Ga0207668_100141462 172
658 3300025986 Ga0207658_10001722 Ga0207658_1000172215 172
659 3300026035 Ga0207703_10169181 Ga0207703_101691812 172
660 3300026116 Ga0207674_11358656 Ga0207674_113586562 172
661 3300028380 Ga0268265_10012654 Ga0268265_100126542 172
662 3300028381 Ga0268264_10073004 Ga0268264_100730042 172
663 3300028381 Ga0268264_10967225 Ga0268264_109672252 172
664 3300046660 Ga0495625_0321034 Ga0495625_0321034_95_619 172
665 3300048912 Ga0496109_0368335 Ga0496109_0368335_550_1080 172
666 3300048913 Ga0496110_0746208 Ga0496110_0746208_150_674 172
667 3300048914 Ga0496111_0051254 Ga0496111_0051254_784_1314 172
668 3300048915 Ga0496112_0565644 Ga0496112_0565644_109_639 172
669 3300001977 JGI24746J21847_1001937 JGI24746J21847_10019371 173
670 3300047319 Ga0495674_0334653 Ga0495674_0334653_280_813 173
671 3300053077 Ga0495601_0158880 Ga0495601_0158880_719_1252 173
672 3300053078 Ga0495612_0000198 Ga0495612_0000198_3031_3564 173

Structural Annotation

Top 5 Hits

ID Description Score Start End
4f7g-assembly1.cif.gz_B crystal structure of talin autoinhibition complex 0.3596 1 141
8dl6-assembly1.cif.gz_A cryo-em structure of human ferroportin/slc40 bound to ca2+ in nanodisc 0.3365 4 141
7tao-assembly1.cif.gz_C cryo-em structure of bafilomycin a1 bound to yeast vo v-atpase 0.3247 1 131
8eas-assembly1.cif.gz_h yeast vo in complex with vma12-22p 0.3127 4 139
7uzh-assembly1.cif.gz_m rat kidney v-atpase with sidk, state 2 0.3075 4 138
ID Description Score Start End Superfamily
af_A0A1D6KZ31_3_135_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5057 6 139 1.20.1250.20
af_I1KNR1_88_323_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5057 2 138 1.20.1250.20
af_A0A1D6KZ31_3_135_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4729 6 139 1.20.1250.20
af_P56557_4_157_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.4379 1 132 1.20.140.150
af_A0A0R0HQM5_173_409_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4368 4 131 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A640Y0V4-F1-model_v4 Uncharacterized protein 0.9814 1 164 GO:0016020
AF-A0A7V9ADJ7-F1-model_v4 MFS transporter 0.9583 1 150 GO:0016020
AF-A0A7V9ADJ7-F1-model_v4 MFS transporter 0.9522 1 150 GO:0016020
AF-A0A1Q3NKS2-F1-model_v4 deleted 0.9473 1 165
AF-A0A7W0TJ08-F1-model_v4 Isoprenylcysteine carboxylmethyltransferase family protein 0.9307 1 165 GO:0016020

Feature Viewer

pLDDT pTM Quality
89.41 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map