F474210
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 672 | 314 | 672 | 170 |
Family's Representative Sequence
| Representative Sequence | 3300005353|Ga0070669_100431524|Ga0070669_1004315242 |
| Length | 186 |
| Sequence | MLFVDLLRLTVLVIGGSATALGAVTVIAAKLEADDATLIFAGAWWLVAAALGIFLGASSRAGEAMARALASARTATALPTESPGRIAFLRLWPVGAFSLLVGGVAWLFPQVAAVGAGFAVLNALAWRNRERAVTAIEERDGVRFYVEPTSALEPIKLIRTPGLGRDRMPAGHPDEATRLIRMPDGR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 36 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 41 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 48 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 50 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 51 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 52 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 54 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 55 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 56 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 57 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 58 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 59 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 60 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 61 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 62 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 63 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 64 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 65 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 66 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 67 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 68 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 69 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 70 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 74 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 75 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 76 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 77 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 78 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 79 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 80 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 81 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 82 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 156 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 160 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 161 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 162 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 163 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 164 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 165 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 166 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 167 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 168 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 169 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 170 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 171 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 172 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 173 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 174 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 175 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 176 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 177 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 178 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 179 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 180 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 181 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 182 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 183 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 184 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 185 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 186 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 187 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 188 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 189 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 190 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 191 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 192 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 193 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 194 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 195 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 196 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 197 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 198 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 247 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 248 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 249 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 250 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 251 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 252 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 253 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 254 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 255 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 256 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 257 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 258 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 259 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 260 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 261 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 262 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 263 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 264 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 265 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 266 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 267 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 268 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 269 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 270 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 295 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 296 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 310 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 311 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 314 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.49 |
| Nodule | 0 |
| Rhizoplane | 9.38 |
| Rhizosphere | 87.05 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.08 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1001937 | 3300001977 | Bacteria | 3296 |
| 2 | JGI24740J21852_10000392 | 3300001979 | Bacteria | 18771 |
| 3 | JGI25406J46586_10018654 | 3300003203 | Bacteria | 2847 |
| 4 | JGI25407J50210_10031519 | 3300003373 | Bacteria | 1372 |
| 5 | Ga0070658_11225640 | 3300005327 | Bacteria | 652 |
| 6 | Ga0070683_100011292 | 3300005329 | Bacteria | 7711 |
| 7 | Ga0070683_100132025 | 3300005329 | Bacteria | 2364 |
| 8 | Ga0070683_100166626 | 3300005329 | Bacteria | 2091 |
| 9 | Ga0070683_100200901 | 3300005329 | Bacteria | 1893 |
| 10 | Ga0070683_100204451 | 3300005329 | Bacteria | 1876 |
| 11 | Ga0070683_100218918 | 3300005329 | Bacteria | 1809 |
| 12 | Ga0070670_100661160 | 3300005331 | Unclassified | 938 |
| 13 | Ga0070670_100795377 | 3300005331 | Bacteria | 854 |
| 14 | Ga0068869_100304890 | 3300005334 | Bacteria | 1287 |
| 15 | Ga0070666_10130504 | 3300005335 | Bacteria | 1746 |
| 16 | Ga0068868_100000630 | 3300005338 | Bacteria | 23709 |
| 17 | Ga0068868_100007830 | 3300005338 | Bacteria | 7627 |
| 18 | Ga0068868_100013387 | 3300005338 | Bacteria | 6016 |
| 19 | Ga0068868_100581851 | 3300005338 | Bacteria | 990 |
| 20 | Ga0070660_100360022 | 3300005339 | Bacteria | 1199 |
| 21 | Ga0070660_100881979 | 3300005339 | Bacteria | 754 |
| 22 | Ga0070660_101261583 | 3300005339 | Unclassified | 627 |
| 23 | Ga0070689_100118366 | 3300005340 | Bacteria | 2113 |
| 24 | Ga0070689_100275718 | 3300005340 | Bacteria | 1394 |
| 25 | Ga0070691_10000124 | 3300005341 | Bacteria | 23289 |
| 26 | Ga0070691_10121755 | 3300005341 | Bacteria | 1314 |
| 27 | Ga0070661_100000045 | 3300005344 | Bacteria | 94702 |
| 28 | Ga0070692_10085595 | 3300005345 | Bacteria | 1705 |
| 29 | Ga0070668_100019444 | 3300005347 | Bacteria | 5112 |
| 30 | Ga0070668_100065392 | 3300005347 | Bacteria | 2821 |
| 31 | Ga0070668_100430500 | 3300005347 | Bacteria | 1131 |
| 32 | Ga0070668_100789921 | 3300005347 | Unclassified | 843 |
| 33 | Ga0070669_100431524 | 3300005353 | Bacteria | 1083 |
| 34 | Ga0070675_100000187 | 3300005354 | Bacteria | 38675 |
| 35 | Ga0070675_100251789 | 3300005354 | Bacteria | 1546 |
| 36 | Ga0070671_100042553 | 3300005355 | Bacteria | 3776 |
| 37 | Ga0070674_100000011 | 3300005356 | Bacteria | 134886 |
| 38 | Ga0070674_100427065 | 3300005356 | Bacteria | 1089 |
| 39 | Ga0070674_100606498 | 3300005356 | Bacteria | 925 |
| 40 | Ga0070673_100000804 | 3300005364 | Bacteria | 17538 |
| 41 | Ga0070673_100246723 | 3300005364 | Bacteria | 1555 |
| 42 | Ga0070659_100063795 | 3300005366 | Bacteria | 2915 |
| 43 | Ga0070659_100304430 | 3300005366 | Bacteria | 1330 |
| 44 | Ga0070659_100457757 | 3300005366 | Bacteria | 1083 |
| 45 | Ga0070659_100773351 | 3300005366 | Bacteria | 834 |
| 46 | Ga0070667_100000374 | 3300005367 | Bacteria | 48918 |
| 47 | Ga0070714_100042858 | 3300005435 | Bacteria | 3825 |
| 48 | Ga0070714_100047621 | 3300005435 | Bacteria | 3643 |
| 49 | Ga0070710_10321379 | 3300005437 | Unclassified | 1016 |
| 50 | Ga0070701_10318101 | 3300005438 | Bacteria | 962 |
| 51 | Ga0070711_100037276 | 3300005439 | Bacteria | 3262 |
| 52 | Ga0070705_100338113 | 3300005440 | Bacteria | 1093 |
| 53 | Ga0070700_100024596 | 3300005441 | Bacteria | 3538 |
| 54 | Ga0070700_100057935 | 3300005441 | Bacteria | 2432 |
| 55 | Ga0070694_100113332 | 3300005444 | Bacteria | 1935 |
| 56 | Ga0070694_100178997 | 3300005444 | Bacteria | 1567 |
| 57 | Ga0070663_100000698 | 3300005455 | Bacteria | 18086 |
| 58 | Ga0070663_100015088 | 3300005455 | Bacteria | 4974 |
| 59 | Ga0070663_100459301 | 3300005455 | Bacteria | 1051 |
| 60 | Ga0070663_100634852 | 3300005455 | Bacteria | 902 |
| 61 | Ga0070663_101416483 | 3300005455 | Unclassified | 616 |
| 62 | Ga0070678_100070973 | 3300005456 | Bacteria | 2606 |
| 63 | Ga0070678_100159308 | 3300005456 | Bacteria | 1827 |
| 64 | Ga0070678_100213808 | 3300005456 | Bacteria | 1599 |
| 65 | Ga0070662_100000008 | 3300005457 | Bacteria | 168754 |
| 66 | Ga0070681_10469373 | 3300005458 | Bacteria | 1171 |
| 67 | Ga0068867_100640815 | 3300005459 | Bacteria | 931 |
| 68 | Ga0068867_101077033 | 3300005459 | Bacteria | 733 |
| 69 | Ga0070685_10002681 | 3300005466 | Bacteria | 9110 |
| 70 | Ga0070685_10038181 | 3300005466 | Bacteria | 2723 |
| 71 | Ga0070685_10089592 | 3300005466 | Bacteria | 1860 |
| 72 | Ga0070685_10476139 | 3300005466 | Bacteria | 879 |
| 73 | Ga0070707_100509138 | 3300005468 | Bacteria | 1166 |
| 74 | Ga0070679_100006106 | 3300005530 | Bacteria | 11207 |
| 75 | Ga0070679_100562483 | 3300005530 | Bacteria | 1084 |
| 76 | Ga0070684_100014039 | 3300005535 | Bacteria | 6477 |
| 77 | Ga0070684_100036375 | 3300005535 | Bacteria | 4218 |
| 78 | Ga0070684_100406798 | 3300005535 | Bacteria | 1255 |
| 79 | Ga0070684_100730482 | 3300005535 | Bacteria | 924 |
| 80 | Ga0070684_100902870 | 3300005535 | Bacteria | 828 |
| 81 | Ga0068853_100092136 | 3300005539 | Bacteria | 2666 |
| 82 | Ga0068853_101544668 | 3300005539 | Bacteria | 643 |
| 83 | Ga0070672_100000003 | 3300005543 | Bacteria | 159532 |
| 84 | Ga0070686_100965392 | 3300005544 | Bacteria | 697 |
| 85 | Ga0070695_100325927 | 3300005545 | Bacteria | 1143 |
| 86 | Ga0070695_100442849 | 3300005545 | Bacteria | 994 |
| 87 | Ga0070695_100496326 | 3300005545 | Bacteria | 943 |
| 88 | Ga0070696_100281907 | 3300005546 | Bacteria | 1267 |
| 89 | Ga0070696_100997958 | 3300005546 | Bacteria | 699 |
| 90 | Ga0070696_101187887 | 3300005546 | Bacteria | 644 |
| 91 | Ga0070693_100711599 | 3300005547 | Bacteria | 736 |
| 92 | Ga0070704_100044190 | 3300005549 | Bacteria | 3094 |
| 93 | Ga0070704_100491076 | 3300005549 | Bacteria | 1064 |
| 94 | Ga0068855_100629730 | 3300005563 | Bacteria | 1154 |
| 95 | Ga0070664_100017819 | 3300005564 | Bacteria | 5832 |
| 96 | Ga0070664_100114129 | 3300005564 | Bacteria | 2360 |
| 97 | Ga0070664_100532737 | 3300005564 | Bacteria | 1085 |
| 98 | Ga0070664_100579871 | 3300005564 | Bacteria | 1039 |
| 99 | Ga0070664_100808496 | 3300005564 | Bacteria | 877 |
| 100 | Ga0068857_100044619 | 3300005577 | Bacteria | 3933 |
| 101 | Ga0068857_100633759 | 3300005577 | Bacteria | 1012 |
| 102 | Ga0068857_101018018 | 3300005577 | Unclassified | 798 |
| 103 | Ga0068854_100005403 | 3300005578 | Bacteria | 8067 |
| 104 | Ga0068854_100210015 | 3300005578 | Bacteria | 1535 |
| 105 | Ga0068854_100506719 | 3300005578 | Bacteria | 1017 |
| 106 | Ga0068856_100005550 | 3300005614 | Bacteria | 12425 |
| 107 | Ga0068856_100016706 | 3300005614 | Bacteria | 7108 |
| 108 | Ga0068856_101617584 | 3300005614 | Bacteria | 661 |
| 109 | Ga0070702_100089804 | 3300005615 | Bacteria | 1861 |
| 110 | Ga0070702_100144761 | 3300005615 | Bacteria | 1518 |
| 111 | Ga0070702_100582319 | 3300005615 | Bacteria | 836 |
| 112 | Ga0068852_100575123 | 3300005616 | Bacteria | 1129 |
| 113 | Ga0068852_101446079 | 3300005616 | Bacteria | 710 |
| 114 | Ga0068859_100703707 | 3300005617 | Bacteria | 1101 |
| 115 | Ga0068864_100035240 | 3300005618 | Bacteria | 4259 |
| 116 | Ga0068864_101297641 | 3300005618 | Unclassified | 728 |
| 117 | Ga0068866_10000002 | 3300005718 | Bacteria | 394090 |
| 118 | Ga0068851_10022018 | 3300005834 | Bacteria | 3100 |
| 119 | Ga0068870_10102758 | 3300005840 | Bacteria | 1618 |
| 120 | Ga0068863_100000042 | 3300005841 | Bacteria | 154459 |
| 121 | Ga0068863_100282913 | 3300005841 | Bacteria | 1607 |
| 122 | Ga0068858_100119035 | 3300005842 | Bacteria | 2469 |
| 123 | Ga0068858_101157919 | 3300005842 | Bacteria | 760 |
| 124 | Ga0068860_100100342 | 3300005843 | Bacteria | 2762 |
| 125 | Ga0068862_100000278 | 3300005844 | Bacteria | 57006 |
| 126 | Ga0068862_100192889 | 3300005844 | Bacteria | 1834 |
| 127 | Ga0081455_10008890 | 3300005937 | Bacteria | 10385 |
| 128 | Ga0081455_10013749 | 3300005937 | Bacteria | 7967 |
| 129 | Ga0081455_10023617 | 3300005937 | Bacteria | 5716 |
| 130 | Ga0081455_10077124 | 3300005937 | Unclassified | 2743 |
| 131 | Ga0081455_10122076 | 3300005937 | Bacteria | 2051 |
| 132 | Ga0081538_10000672 | 3300005981 | Bacteria | 37620 |
| 133 | Ga0081538_10047438 | 3300005981 | Bacteria | 2634 |
| 134 | Ga0081538_10138040 | 3300005981 | Bacteria | 1130 |
| 135 | Ga0081538_10161820 | 3300005981 | Unclassified | 993 |
| 136 | Ga0081540_1000126 | 3300005983 | Bacteria | 81203 |
| 137 | Ga0081540_1000197 | 3300005983 | Bacteria | 62537 |
| 138 | Ga0081539_10003805 | 3300005985 | Bacteria | 17759 |
| 139 | Ga0081539_10028605 | 3300005985 | Bacteria | 3501 |
| 140 | Ga0081539_10028719 | 3300005985 | Unclassified | 3493 |
| 141 | Ga0075365_10001083 | 3300006038 | Bacteria | 11826 |
| 142 | Ga0075365_10007080 | 3300006038 | Bacteria | 6250 |
| 143 | Ga0075364_10022106 | 3300006051 | Bacteria | 4014 |
| 144 | Ga0075432_10090093 | 3300006058 | Bacteria | 1122 |
| 145 | Ga0070715_10000015 | 3300006163 | Bacteria | 152816 |
| 146 | Ga0070716_100166796 | 3300006173 | Bacteria | 1433 |
| 147 | Ga0070712_100028261 | 3300006175 | Bacteria | 3750 |
| 148 | Ga0070712_100058438 | 3300006175 | Bacteria | 2713 |
| 149 | Ga0070712_100114183 | 3300006175 | Bacteria | 2021 |
| 150 | Ga0075367_10071294 | 3300006178 | Bacteria | 2090 |
| 151 | Ga0068871_100544773 | 3300006358 | Bacteria | 1050 |
| 152 | Ga0068871_101435956 | 3300006358 | Bacteria | 651 |
| 153 | Ga0075428_100045652 | 3300006844 | Bacteria | 4813 |
| 154 | Ga0075428_100082542 | 3300006844 | Bacteria | 3507 |
| 155 | Ga0075430_100022244 | 3300006846 | Bacteria | 5393 |
| 156 | Ga0075430_100255751 | 3300006846 | Unclassified | 1451 |
| 157 | Ga0075431_100000960 | 3300006847 | Bacteria | 25567 |
| 158 | Ga0075431_100531887 | 3300006847 | Unclassified | 1164 |
| 159 | Ga0075431_100534343 | 3300006847 | Bacteria | 1161 |
| 160 | Ga0075431_100655129 | 3300006847 | Bacteria | 1030 |
| 161 | Ga0075433_10010256 | 3300006852 | Bacteria | 7515 |
| 162 | Ga0075434_100003617 | 3300006871 | Bacteria | 13797 |
| 163 | Ga0075434_100189946 | 3300006871 | Bacteria | 2074 |
| 164 | Ga0075434_100296494 | 3300006871 | Bacteria | 1637 |
| 165 | Ga0075434_100872329 | 3300006871 | Bacteria | 915 |
| 166 | Ga0068865_100062494 | 3300006881 | Bacteria | 2614 |
| 167 | Ga0068865_101299922 | 3300006881 | Unclassified | 647 |
| 168 | Ga0068865_101469688 | 3300006881 | Bacteria | 610 |
| 169 | Ga0075436_100065903 | 3300006914 | Bacteria | 2503 |
| 170 | Ga0097620_100703675 | 3300006931 | Bacteria | 1101 |
| 171 | Ga0105240_10063125 | 3300009093 | Bacteria | 4609 |
| 172 | Ga0105240_10450313 | 3300009093 | Bacteria | 1441 |
| 173 | Ga0111539_10009234 | 3300009094 | Bacteria | 12462 |
| 174 | Ga0111539_10021383 | 3300009094 | Bacteria | 7964 |
| 175 | Ga0111539_10065292 | 3300009094 | Bacteria | 4301 |
| 176 | Ga0111539_10332640 | 3300009094 | Bacteria | 1768 |
| 177 | Ga0105245_10000425 | 3300009098 | Bacteria | 39393 |
| 178 | Ga0105245_10003240 | 3300009098 | Bacteria | 14580 |
| 179 | Ga0105245_10011445 | 3300009098 | Bacteria | 7727 |
| 180 | Ga0105245_10607744 | 3300009098 | Bacteria | 1120 |
| 181 | Ga0105245_11238130 | 3300009098 | Bacteria | 794 |
| 182 | Ga0114129_10002590 | 3300009147 | Bacteria | 25131 |
| 183 | Ga0114129_10032655 | 3300009147 | Bacteria | 7355 |
| 184 | Ga0114129_10794606 | 3300009147 | Bacteria | 1208 |
| 185 | Ga0114129_10840677 | 3300009147 | Unclassified | 1168 |
| 186 | Ga0105243_10021302 | 3300009148 | Bacteria | 4919 |
| 187 | Ga0105243_10028552 | 3300009148 | Bacteria | 4283 |
| 188 | Ga0105243_10355068 | 3300009148 | Bacteria | 1347 |
| 189 | Ga0105243_10430997 | 3300009148 | Bacteria | 1232 |
| 190 | Ga0105243_10479133 | 3300009148 | Unclassified | 1174 |
| 191 | Ga0105242_10000975 | 3300009176 | Bacteria | 22368 |
| 192 | Ga0105242_10218215 | 3300009176 | Bacteria | 1703 |
| 193 | Ga0105242_10395813 | 3300009176 | Bacteria | 1288 |
| 194 | Ga0105242_11470223 | 3300009176 | Bacteria | 711 |
| 195 | Ga0105248_10181516 | 3300009177 | Bacteria | 2371 |
| 196 | Ga0105237_10193645 | 3300009545 | Bacteria | 2033 |
| 197 | Ga0105238_10000051 | 3300009551 | Bacteria | 141705 |
| 198 | Ga0105238_10855761 | 3300009551 | Bacteria | 926 |
| 199 | Ga0105249_10000085 | 3300009553 | Bacteria | 133497 |
| 200 | Ga0105249_10004260 | 3300009553 | Bacteria | 12366 |
| 201 | Ga0105249_10390570 | 3300009553 | Bacteria | 1420 |
| 202 | Ga0105249_10458693 | 3300009553 | Bacteria | 1314 |
| 203 | Ga0105239_10014993 | 3300010375 | Bacteria | 8591 |
| 204 | Ga0105239_10837492 | 3300010375 | Bacteria | 1054 |
| 205 | Ga0105239_11320221 | 3300010375 | Bacteria | 832 |
| 206 | Ga0105239_11561949 | 3300010375 | Bacteria | 763 |
| 207 | Ga0105239_11644988 | 3300010375 | Bacteria | 743 |
| 208 | Ga0105246_10545038 | 3300011119 | Bacteria | 993 |
| 209 | Ga0105246_11111435 | 3300011119 | Bacteria | 722 |
| 210 | Ga0157374_10008161 | 3300013296 | Bacteria | 8949 |
| 211 | Ga0157374_10030601 | 3300013296 | Unclassified | 4889 |
| 212 | Ga0157378_10009908 | 3300013297 | Bacteria | 8306 |
| 213 | Ga0157378_10144750 | 3300013297 | Bacteria | 2210 |
| 214 | Ga0163162_10252839 | 3300013306 | Bacteria | 1894 |
| 215 | Ga0163162_10723612 | 3300013306 | Bacteria | 1116 |
| 216 | Ga0157372_10021012 | 3300013307 | Bacteria | 7047 |
| 217 | Ga0157375_10071918 | 3300013308 | Bacteria | 3473 |
| 218 | Ga0157375_10282617 | 3300013308 | Bacteria | 1822 |
| 219 | Ga0163163_10132820 | 3300014325 | Bacteria | 2529 |
| 220 | Ga0163163_10383221 | 3300014325 | Bacteria | 1463 |
| 221 | Ga0163163_10634903 | 3300014325 | Bacteria | 1131 |
| 222 | Ga0157380_10000017 | 3300014326 | Bacteria | 119468 |
| 223 | Ga0157380_10000072 | 3300014326 | Bacteria | 56363 |
| 224 | Ga0157380_10558060 | 3300014326 | Unclassified | 1125 |
| 225 | Ga0157377_10000202 | 3300014745 | Bacteria | 33023 |
| 226 | Ga0157379_10002830 | 3300014968 | Bacteria | 14625 |
| 227 | Ga0157379_10091796 | 3300014968 | Bacteria | 2724 |
| 228 | Ga0157379_10106090 | 3300014968 | Bacteria | 2522 |
| 229 | Ga0157379_10120078 | 3300014968 | Bacteria | 2364 |
| 230 | Ga0157379_10438288 | 3300014968 | Bacteria | 1205 |
| 231 | Ga0157376_10121005 | 3300014969 | Bacteria | 2320 |
| 232 | Ga0163161_10142522 | 3300017792 | Bacteria | 1815 |
| 233 | Ga0207682_10000457 | 3300025893 | Bacteria | 18841 |
| 234 | Ga0207692_10419080 | 3300025898 | Unclassified | 838 |
| 235 | Ga0207642_10000001 | 3300025899 | Bacteria | 714030 |
| 236 | Ga0207642_10000003 | 3300025899 | Bacteria | 650651 |
| 237 | Ga0207642_10358057 | 3300025899 | Bacteria | 863 |
| 238 | Ga0207688_10004236 | 3300025901 | Bacteria | 7819 |
| 239 | Ga0207688_10020234 | 3300025901 | Bacteria | 3633 |
| 240 | Ga0207688_10324552 | 3300025901 | Bacteria | 945 |
| 241 | Ga0207680_10411618 | 3300025903 | Bacteria | 957 |
| 242 | Ga0207685_10000001 | 3300025905 | Bacteria | 604473 |
| 243 | Ga0207645_10134516 | 3300025907 | Bacteria | 1610 |
| 244 | Ga0207643_10045902 | 3300025908 | Bacteria | 2469 |
| 245 | Ga0207643_10053322 | 3300025908 | Bacteria | 2297 |
| 246 | Ga0207643_10145792 | 3300025908 | Bacteria | 1416 |
| 247 | Ga0207643_10371112 | 3300025908 | Bacteria | 901 |
| 248 | Ga0207693_10008956 | 3300025915 | Bacteria | 8168 |
| 249 | Ga0207693_10018190 | 3300025915 | Bacteria | 5599 |
| 250 | Ga0207693_10025456 | 3300025915 | Bacteria | 4692 |
| 251 | Ga0207663_10047827 | 3300025916 | Bacteria | 2643 |
| 252 | Ga0207657_10257700 | 3300025919 | Bacteria | 1389 |
| 253 | Ga0207649_10000021 | 3300025920 | Bacteria | 209660 |
| 254 | Ga0207652_10008471 | 3300025921 | Bacteria | 8274 |
| 255 | Ga0207646_10252262 | 3300025922 | Bacteria | 1594 |
| 256 | Ga0207681_10605440 | 3300025923 | Bacteria | 906 |
| 257 | Ga0207694_10000035 | 3300025924 | Bacteria | 195870 |
| 258 | Ga0207650_10451257 | 3300025925 | Bacteria | 1070 |
| 259 | Ga0207659_10000074 | 3300025926 | Bacteria | 63348 |
| 260 | Ga0207659_10055358 | 3300025926 | Bacteria | 2837 |
| 261 | Ga0207687_10000021 | 3300025927 | Bacteria | 226396 |
| 262 | Ga0207687_10012274 | 3300025927 | Bacteria | 5603 |
| 263 | Ga0207687_10020408 | 3300025927 | Bacteria | 4395 |
| 264 | Ga0207664_10258909 | 3300025929 | Bacteria | 1521 |
| 265 | Ga0207690_10055624 | 3300025932 | Bacteria | 2666 |
| 266 | Ga0207690_10368001 | 3300025932 | Bacteria | 1140 |
| 267 | Ga0207690_10457079 | 3300025932 | Bacteria | 1027 |
| 268 | Ga0207706_10000016 | 3300025933 | Bacteria | 170697 |
| 269 | Ga0207706_10044210 | 3300025933 | Bacteria | 3948 |
| 270 | Ga0207706_10576692 | 3300025933 | Bacteria | 967 |
| 271 | Ga0207706_10591398 | 3300025933 | Bacteria | 954 |
| 272 | Ga0207686_10000418 | 3300025934 | Bacteria | 28994 |
| 273 | Ga0207686_10373022 | 3300025934 | Bacteria | 1080 |
| 274 | Ga0207686_10983465 | 3300025934 | Bacteria | 684 |
| 275 | Ga0207709_10027029 | 3300025935 | Bacteria | 3302 |
| 276 | Ga0207709_10562161 | 3300025935 | Unclassified | 898 |
| 277 | Ga0207669_10000027 | 3300025937 | Bacteria | 91216 |
| 278 | Ga0207669_10837942 | 3300025937 | Bacteria | 765 |
| 279 | Ga0207704_10021680 | 3300025938 | Bacteria | 3427 |
| 280 | Ga0207704_10311339 | 3300025938 | Bacteria | 1211 |
| 281 | Ga0207704_10487627 | 3300025938 | Bacteria | 991 |
| 282 | Ga0207704_10896565 | 3300025938 | Unclassified | 745 |
| 283 | Ga0207665_10105338 | 3300025939 | Bacteria | 1975 |
| 284 | Ga0207691_10000005 | 3300025940 | Bacteria | 163117 |
| 285 | Ga0207691_10322078 | 3300025940 | Bacteria | 1325 |
| 286 | Ga0207711_10220126 | 3300025941 | Bacteria | 1736 |
| 287 | Ga0207689_10007500 | 3300025942 | Bacteria | 9562 |
| 288 | Ga0207661_10000145 | 3300025944 | Bacteria | 45007 |
| 289 | Ga0207661_10030094 | 3300025944 | Bacteria | 4178 |
| 290 | Ga0207661_10097221 | 3300025944 | Bacteria | 2465 |
| 291 | Ga0207679_10057576 | 3300025945 | Bacteria | 2875 |
| 292 | Ga0207679_10088214 | 3300025945 | Bacteria | 2391 |
| 293 | Ga0207679_10395543 | 3300025945 | Bacteria | 1214 |
| 294 | Ga0207679_10544814 | 3300025945 | Bacteria | 1040 |
| 295 | Ga0207679_11364670 | 3300025945 | Bacteria | 650 |
| 296 | Ga0207651_10001207 | 3300025960 | Bacteria | 11569 |
| 297 | Ga0207712_10000033 | 3300025961 | Bacteria | 209336 |
| 298 | Ga0207712_10002885 | 3300025961 | Bacteria | 10989 |
| 299 | Ga0207712_10184686 | 3300025961 | Bacteria | 1641 |
| 300 | Ga0207712_10217501 | 3300025961 | Bacteria | 1525 |
| 301 | Ga0207712_10620335 | 3300025961 | Bacteria | 937 |
| 302 | Ga0207668_10014146 | 3300025972 | Bacteria | 4934 |
| 303 | Ga0207668_10061962 | 3300025972 | Bacteria | 2633 |
| 304 | Ga0207668_10062042 | 3300025972 | Bacteria | 2631 |
| 305 | Ga0207640_10023696 | 3300025981 | Bacteria | 3693 |
| 306 | Ga0207640_10411148 | 3300025981 | Bacteria | 1104 |
| 307 | Ga0207658_10001722 | 3300025986 | Bacteria | 16531 |
| 308 | Ga0207677_10000225 | 3300026023 | Bacteria | 44520 |
| 309 | Ga0207677_10009775 | 3300026023 | Bacteria | 5405 |
| 310 | Ga0207677_10267664 | 3300026023 | Bacteria | 1396 |
| 311 | Ga0207677_10712381 | 3300026023 | Bacteria | 891 |
| 312 | Ga0207703_10169181 | 3300026035 | Bacteria | 1921 |
| 313 | Ga0207639_10266062 | 3300026041 | Bacteria | 1502 |
| 314 | Ga0207678_10008262 | 3300026067 | Bacteria | 9171 |
| 315 | Ga0207678_10014936 | 3300026067 | Bacteria | 6832 |
| 316 | Ga0207678_10217878 | 3300026067 | Bacteria | 1633 |
| 317 | Ga0207708_10000869 | 3300026075 | Bacteria | 22730 |
| 318 | Ga0207708_10141957 | 3300026075 | Bacteria | 1885 |
| 319 | Ga0207702_10001072 | 3300026078 | Bacteria | 28003 |
| 320 | Ga0207702_10177134 | 3300026078 | Bacteria | 1960 |
| 321 | Ga0207641_10973440 | 3300026088 | Bacteria | 844 |
| 322 | Ga0207648_10030680 | 3300026089 | Bacteria | 4758 |
| 323 | Ga0207648_10482944 | 3300026089 | Bacteria | 1132 |
| 324 | Ga0207674_10377087 | 3300026116 | Bacteria | 1371 |
| 325 | Ga0207674_10675608 | 3300026116 | Bacteria | 997 |
| 326 | Ga0207674_11358656 | 3300026116 | Bacteria | 680 |
| 327 | Ga0207675_100014322 | 3300026118 | Bacteria | 7392 |
| 328 | Ga0207675_100155247 | 3300026118 | Bacteria | 2181 |
| 329 | Ga0207683_10028543 | 3300026121 | Bacteria | 4825 |
| 330 | Ga0207683_10086377 | 3300026121 | Bacteria | 2789 |
| 331 | Ga0207683_10202143 | 3300026121 | Bacteria | 1806 |
| 332 | Ga0207698_10398578 | 3300026142 | Bacteria | 1314 |
| 333 | Ga0207698_11309018 | 3300026142 | Bacteria | 739 |
| 334 | Ga0207428_10007412 | 3300027907 | Bacteria | 10002 |
| 335 | Ga0207428_10019314 | 3300027907 | Bacteria | 5810 |
| 336 | Ga0207428_10043985 | 3300027907 | Bacteria | 3604 |
| 337 | Ga0268266_10369633 | 3300028379 | Bacteria | 1350 |
| 338 | Ga0268266_10476464 | 3300028379 | Bacteria | 1189 |
| 339 | Ga0268266_11149997 | 3300028379 | Bacteria | 751 |
| 340 | Ga0268265_10012654 | 3300028380 | Bacteria | 5724 |
| 341 | Ga0268264_10073004 | 3300028381 | Bacteria | 2911 |
| 342 | Ga0268264_10654475 | 3300028381 | Bacteria | 1040 |
| 343 | Ga0268264_10967225 | 3300028381 | Bacteria | 857 |
| 344 | Ga0265326_10000003 | 3300028558 | Bacteria | 479811 |
| 345 | Ga0265319_1001029 | 3300028563 | Bacteria | 17461 |
| 346 | Ga0265334_10000019 | 3300028573 | Bacteria | 143921 |
| 347 | Ga0265336_10071044 | 3300028666 | Bacteria | 1040 |
| 348 | Ga0265338_10004357 | 3300028800 | Bacteria | 19152 |
| 349 | Ga0265324_10000344 | 3300029957 | Bacteria | 33865 |
| 350 | Ga0265327_10046293 | 3300031251 | Bacteria | 2304 |
| 351 | Ga0307408_100433638 | 3300031548 | Bacteria | 1136 |
| 352 | Ga0307405_10015592 | 3300031731 | Bacteria | 4121 |
| 353 | Ga0307405_10216365 | 3300031731 | Unclassified | 1403 |
| 354 | Ga0307413_10028803 | 3300031824 | Bacteria | 3099 |
| 355 | Ga0307410_10034172 | 3300031852 | Bacteria | 3290 |
| 356 | Ga0307410_10138507 | 3300031852 | Bacteria | 1797 |
| 357 | Ga0307406_10018027 | 3300031901 | Bacteria | 4118 |
| 358 | Ga0307406_10227359 | 3300031901 | Unclassified | 1391 |
| 359 | Ga0307407_10007021 | 3300031903 | Bacteria | 5067 |
| 360 | Ga0307412_10323890 | 3300031911 | Bacteria | 1227 |
| 361 | Ga0307409_100163018 | 3300031995 | Bacteria | 1952 |
| 362 | Ga0307409_100400896 | 3300031995 | Bacteria | 1310 |
| 363 | Ga0307409_100403306 | 3300031995 | Bacteria | 1307 |
| 364 | Ga0307416_100010981 | 3300032002 | Bacteria | 6012 |
| 365 | Ga0307416_100114106 | 3300032002 | Bacteria | 2389 |
| 366 | Ga0307416_101355612 | 3300032002 | Bacteria | 817 |
| 367 | Ga0307411_10037829 | 3300032005 | Bacteria | 3038 |
| 368 | Ga0307411_10234816 | 3300032005 | Bacteria | 1432 |
| 369 | Ga0307411_10435597 | 3300032005 | Bacteria | 1093 |
| 370 | Ga0307415_100000902 | 3300032126 | Bacteria | 13600 |
| 371 | Ga0307415_100018798 | 3300032126 | Bacteria | 4182 |
| 372 | Ga0307415_100179335 | 3300032126 | Bacteria | 1660 |
| 373 | Ga0307415_100392427 | 3300032126 | Bacteria | 1182 |
| 374 | Ga0307415_100450932 | 3300032126 | Bacteria | 1112 |
| 375 | Ga0307415_101286024 | 3300032126 | Bacteria | 692 |
| 376 | Ga0307415_101340856 | 3300032126 | Bacteria | 679 |
| 377 | Ga0373957_0067017 | 3300035120 | Bacteria | 1399 |
| 378 | Ga0373955_0197218 | 3300035172 | Unclassified | 1198 |
| 379 | Ga0373937_0027519 | 3300036401 | Bacteria | 5141 |
| 380 | Ga0395899_0735148 | 3300037312 | Bacteria | 616 |
| 381 | Ga0395900_0063212 | 3300037418 | Bacteria | 3805 |
| 382 | Ga0395900_0625959 | 3300037418 | Bacteria | 1015 |
| 383 | Ga0395900_0675323 | 3300037418 | Bacteria | 968 |
| 384 | Ga0395898_0005594 | 3300037466 | Bacteria | 13554 |
| 385 | Ga0395898_0076838 | 3300037466 | Bacteria | 3224 |
| 386 | Ga0395898_0242946 | 3300037466 | Bacteria | 1717 |
| 387 | Ga0395898_0741479 | 3300037466 | Bacteria | 924 |
| 388 | Ga0395898_1028707 | 3300037466 | Unclassified | 759 |
| 389 | Ga0395905_0010070 | 3300037471 | Bacteria | 9215 |
| 390 | Ga0395905_0132251 | 3300037471 | Bacteria | 2347 |
| 391 | Ga0395901_0014858 | 3300038443 | Bacteria | 7910 |
| 392 | Ga0395901_0169820 | 3300038443 | Bacteria | 2288 |
| 393 | Ga0395901_0565201 | 3300038443 | Bacteria | 1151 |
| 394 | Ga0395901_1264614 | 3300038443 | Bacteria | 701 |
| 395 | Ga0395901_1687576 | 3300038443 | Bacteria | 585 |
| 396 | Ga0436362_0988173 | 3300039453 | Bacteria | 3558 |
| 397 | Ga0451802_0700236 | 3300041460 | Bacteria | 603 |
| 398 | Ga0451853_1508810 | 3300041512 | Bacteria | 2563 |
| 399 | Ga0439454_033148 | 3300042011 | Bacteria | 818 |
| 400 | Ga0439459_0171988 | 3300042438 | Bacteria | 578 |
| 401 | Ga0466972_0266297 | 3300044658 | Bacteria | 801 |
| 402 | Ga0466961_0203009 | 3300044693 | Bacteria | 1225 |
| 403 | Ga0466963_0000034 | 3300044694 | Bacteria | 44604 |
| 404 | Ga0466963_0011130 | 3300044694 | Bacteria | 5471 |
| 405 | Ga0466963_0122868 | 3300044694 | Bacteria | 1788 |
| 406 | Ga0466963_0132078 | 3300044694 | Bacteria | 1725 |
| 407 | Ga0466963_0139994 | 3300044694 | Bacteria | 1676 |
| 408 | Ga0466963_0150559 | 3300044694 | Bacteria | 1615 |
| 409 | Ga0466964_0157631 | 3300044706 | Bacteria | 1058 |
| 410 | Ga0466970_0203787 | 3300044765 | Bacteria | 1101 |
| 411 | Ga0466957_0043534 | 3300044842 | Bacteria | 2719 |
| 412 | Ga0466957_0202147 | 3300044842 | Bacteria | 1305 |
| 413 | Ga0466960_0281825 | 3300044901 | Bacteria | 932 |
| 414 | Ga0466967_0000007 | 3300045976 | Bacteria | 135597 |
| 415 | Ga0466967_0016981 | 3300045976 | Bacteria | 5758 |
| 416 | Ga0466967_0034447 | 3300045976 | Bacteria | 4298 |
| 417 | Ga0466967_0076943 | 3300045976 | Bacteria | 3002 |
| 418 | Ga0466967_0077728 | 3300045976 | Bacteria | 2988 |
| 419 | Ga0466967_0085176 | 3300045976 | Bacteria | 2861 |
| 420 | Ga0466967_0094559 | 3300045976 | Bacteria | 2722 |
| 421 | Ga0466967_0206678 | 3300045976 | Bacteria | 1861 |
| 422 | Ga0466967_0355069 | 3300045976 | Bacteria | 1419 |
| 423 | Ga0466967_0513106 | 3300045976 | Bacteria | 1177 |
| 424 | Ga0466967_0591584 | 3300045976 | Bacteria | 1094 |
| 425 | Ga0466967_1150937 | 3300045976 | Bacteria | 773 |
| 426 | Ga0495592_0000537 | 3300046454 | Bacteria | 27057 |
| 427 | Ga0495592_0404695 | 3300046454 | Bacteria | 864 |
| 428 | Ga0495603_0044142 | 3300046455 | Bacteria | 2660 |
| 429 | Ga0495629_0000746 | 3300046459 | Bacteria | 26275 |
| 430 | Ga0495629_0110986 | 3300046459 | Bacteria | 1912 |
| 431 | Ga0495629_0255943 | 3300046459 | Bacteria | 1204 |
| 432 | Ga0495638_0180848 | 3300046460 | Bacteria | 1203 |
| 433 | Ga0495641_0037143 | 3300046461 | Bacteria | 2285 |
| 434 | Ga0495641_0061685 | 3300046461 | Bacteria | 1692 |
| 435 | Ga0495641_0115829 | 3300046461 | Bacteria | 1195 |
| 436 | Ga0495582_0000022 | 3300046473 | Bacteria | 83315 |
| 437 | Ga0495582_0038704 | 3300046473 | Bacteria | 2625 |
| 438 | Ga0495584_0172878 | 3300046491 | Unclassified | 1098 |
| 439 | Ga0495594_0000005 | 3300046499 | Bacteria | 175437 |
| 440 | Ga0495594_0104820 | 3300046499 | Bacteria | 1592 |
| 441 | Ga0495596_0091803 | 3300046500 | Bacteria | 1179 |
| 442 | Ga0495606_0000131 | 3300046507 | Bacteria | 127298 |
| 443 | Ga0495608_0080179 | 3300046511 | Bacteria | 2122 |
| 444 | Ga0495618_0000004 | 3300046514 | Bacteria | 245690 |
| 445 | Ga0495620_0000388 | 3300046515 | Bacteria | 29740 |
| 446 | Ga0495628_0000194 | 3300046516 | Bacteria | 53139 |
| 447 | Ga0495628_0007060 | 3300046516 | Bacteria | 9725 |
| 448 | Ga0495628_0295102 | 3300046516 | Bacteria | 1201 |
| 449 | Ga0495630_0000168 | 3300046517 | Bacteria | 51209 |
| 450 | Ga0495630_0000416 | 3300046517 | Bacteria | 32826 |
| 451 | Ga0495630_0020577 | 3300046517 | Bacteria | 4866 |
| 452 | Ga0495630_0414810 | 3300046517 | Unclassified | 1032 |
| 453 | Ga0495631_0179932 | 3300046518 | Bacteria | 906 |
| 454 | Ga0495644_0003763 | 3300046523 | Bacteria | 5973 |
| 455 | Ga0495652_0025477 | 3300046529 | Bacteria | 5232 |
| 456 | Ga0495640_0014191 | 3300046533 | Bacteria | 6039 |
| 457 | Ga0495640_0031717 | 3300046533 | Bacteria | 3769 |
| 458 | Ga0495586_0004988 | 3300046535 | Bacteria | 7100 |
| 459 | Ga0495587_0111489 | 3300046536 | Bacteria | 1571 |
| 460 | Ga0495598_0304441 | 3300046537 | Bacteria | 604 |
| 461 | Ga0495621_0392720 | 3300046539 | Unclassified | 587 |
| 462 | Ga0495645_0004732 | 3300046543 | Bacteria | 9303 |
| 463 | Ga0495622_0000026 | 3300046557 | Bacteria | 137934 |
| 464 | Ga0495667_0000044 | 3300046559 | Bacteria | 121910 |
| 465 | Ga0495656_0319829 | 3300046615 | Bacteria | 799 |
| 466 | Ga0495634_0013021 | 3300046642 | Bacteria | 6017 |
| 467 | Ga0495634_0058197 | 3300046642 | Unclassified | 2577 |
| 468 | Ga0495634_0214518 | 3300046642 | Unclassified | 1190 |
| 469 | Ga0495634_0666406 | 3300046642 | Bacteria | 600 |
| 470 | Ga0495625_0000204 | 3300046660 | Bacteria | 94356 |
| 471 | Ga0495625_0321034 | 3300046660 | Unclassified | 986 |
| 472 | Ga0495635_0000063 | 3300046663 | Bacteria | 65304 |
| 473 | Ga0495635_0040045 | 3300046663 | Bacteria | 3239 |
| 474 | Ga0495657_0068360 | 3300046675 | Bacteria | 2328 |
| 475 | Ga0495647_0000003 | 3300046681 | Bacteria | 145235 |
| 476 | Ga0495658_0000008 | 3300046683 | Bacteria | 115426 |
| 477 | Ga0495658_0064364 | 3300046683 | Bacteria | 2113 |
| 478 | Ga0495658_0317603 | 3300046683 | Unclassified | 987 |
| 479 | Ga0495669_0000169 | 3300046684 | Bacteria | 41171 |
| 480 | Ga0495613_0000369 | 3300046689 | Bacteria | 39198 |
| 481 | Ga0495624_0000305 | 3300046690 | Bacteria | 38658 |
| 482 | Ga0495624_0003530 | 3300046690 | Bacteria | 11592 |
| 483 | Ga0495649_0001488 | 3300046694 | Bacteria | 17602 |
| 484 | Ga0495600_0002253 | 3300046809 | Bacteria | 10994 |
| 485 | Ga0495600_0017502 | 3300046809 | Bacteria | 4560 |
| 486 | Ga0495604_0000033 | 3300047317 | Bacteria | 134810 |
| 487 | Ga0495604_0020213 | 3300047317 | Bacteria | 5321 |
| 488 | Ga0495604_0444852 | 3300047317 | Bacteria | 847 |
| 489 | Ga0495674_0000027 | 3300047319 | Bacteria | 132744 |
| 490 | Ga0495674_0334653 | 3300047319 | Bacteria | 1231 |
| 491 | Ga0495672_0240939 | 3300047320 | Bacteria | 883 |
| 492 | Ga0495676_0008602 | 3300047321 | Bacteria | 9347 |
| 493 | Ga0495680_0008245 | 3300047322 | Bacteria | 9493 |
| 494 | Ga0495680_0309582 | 3300047322 | Unclassified | 1107 |
| 495 | Ga0495675_0029691 | 3300047444 | Bacteria | 3488 |
| 496 | Ga0495675_0313595 | 3300047444 | Bacteria | 929 |
| 497 | Ga0495673_0047463 | 3300047469 | Bacteria | 1898 |
| 498 | Ga0495684_0481076 | 3300047471 | Bacteria | 857 |
| 499 | Ga0495686_0036681 | 3300047472 | Bacteria | 3146 |
| 500 | Ga0495602_0001509 | 3300048088 | Bacteria | 23180 |
| 501 | Ga0495602_0707031 | 3300048088 | Bacteria | 683 |
| 502 | Ga0496100_0000003 | 3300048903 | Bacteria | 360802 |
| 503 | Ga0496100_0330969 | 3300048903 | Bacteria | 1146 |
| 504 | Ga0496101_0000003 | 3300048904 | Bacteria | 406565 |
| 505 | Ga0496101_0039050 | 3300048904 | Bacteria | 3373 |
| 506 | Ga0496101_0169979 | 3300048904 | Bacteria | 1675 |
| 507 | Ga0496102_0029058 | 3300048905 | Bacteria | 4943 |
| 508 | Ga0496102_0045086 | 3300048905 | Bacteria | 4002 |
| 509 | Ga0496102_0261101 | 3300048905 | Bacteria | 1633 |
| 510 | Ga0496102_1166496 | 3300048905 | Bacteria | 690 |
| 511 | Ga0496103_0020698 | 3300048906 | Bacteria | 3954 |
| 512 | Ga0496103_0063823 | 3300048906 | Bacteria | 2295 |
| 513 | Ga0496103_0284347 | 3300048906 | Bacteria | 1064 |
| 514 | Ga0496103_0487612 | 3300048906 | Bacteria | 789 |
| 515 | Ga0496103_0552623 | 3300048906 | Bacteria | 735 |
| 516 | Ga0496104_0000007 | 3300048907 | Bacteria | 524804 |
| 517 | Ga0496104_0000066 | 3300048907 | Bacteria | 108721 |
| 518 | Ga0496104_0007632 | 3300048907 | Bacteria | 9576 |
| 519 | Ga0496104_0171027 | 3300048907 | Bacteria | 2083 |
| 520 | Ga0496105_0000002 | 3300048908 | Bacteria | 753215 |
| 521 | Ga0496105_0000020 | 3300048908 | Bacteria | 181484 |
| 522 | Ga0496105_0047857 | 3300048908 | Bacteria | 3528 |
| 523 | Ga0496105_0049913 | 3300048908 | Bacteria | 3456 |
| 524 | Ga0496105_0066557 | 3300048908 | Bacteria | 2974 |
| 525 | Ga0496105_0653889 | 3300048908 | Bacteria | 811 |
| 526 | Ga0496106_0000015 | 3300048909 | Bacteria | 187570 |
| 527 | Ga0496106_0000147 | 3300048909 | Bacteria | 51986 |
| 528 | Ga0496106_0012504 | 3300048909 | Bacteria | 6270 |
| 529 | Ga0496106_0033927 | 3300048909 | Bacteria | 3810 |
| 530 | Ga0496106_0537979 | 3300048909 | Unclassified | 938 |
| 531 | Ga0496106_0757346 | 3300048909 | Bacteria | 772 |
| 532 | Ga0496107_0000008 | 3300048910 | Bacteria | 251874 |
| 533 | Ga0496107_0004466 | 3300048910 | Bacteria | 9484 |
| 534 | Ga0496107_0027536 | 3300048910 | Bacteria | 4036 |
| 535 | Ga0496107_0037005 | 3300048910 | Bacteria | 3502 |
| 536 | Ga0496107_0139789 | 3300048910 | Bacteria | 1790 |
| 537 | Ga0496108_0000002 | 3300048911 | Bacteria | 700890 |
| 538 | Ga0496108_0024788 | 3300048911 | Bacteria | 4939 |
| 539 | Ga0496108_0030574 | 3300048911 | Bacteria | 4463 |
| 540 | Ga0496109_0000001 | 3300048912 | Bacteria | 700852 |
| 541 | Ga0496109_0055073 | 3300048912 | Bacteria | 3628 |
| 542 | Ga0496109_0232746 | 3300048912 | Bacteria | 1733 |
| 543 | Ga0496109_0368335 | 3300048912 | Bacteria | 1357 |
| 544 | Ga0496109_0372894 | 3300048912 | Bacteria | 1348 |
| 545 | Ga0496109_0382369 | 3300048912 | Bacteria | 1330 |
| 546 | Ga0496109_0470305 | 3300048912 | Bacteria | 1187 |
| 547 | Ga0496110_0071200 | 3300048913 | Bacteria | 3082 |
| 548 | Ga0496110_0192970 | 3300048913 | Bacteria | 1849 |
| 549 | Ga0496110_0742544 | 3300048913 | Bacteria | 884 |
| 550 | Ga0496110_0746208 | 3300048913 | Bacteria | 882 |
| 551 | Ga0496111_0049802 | 3300048914 | Bacteria | 3020 |
| 552 | Ga0496111_0051254 | 3300048914 | Bacteria | 2979 |
| 553 | Ga0496111_0140244 | 3300048914 | Bacteria | 1791 |
| 554 | Ga0496111_0340594 | 3300048914 | Bacteria | 1110 |
| 555 | Ga0496112_0069733 | 3300048915 | Bacteria | 3472 |
| 556 | Ga0496112_0301035 | 3300048915 | Unclassified | 1549 |
| 557 | Ga0496112_0565644 | 3300048915 | Bacteria | 1070 |
| 558 | Ga0496113_0021763 | 3300048916 | Bacteria | 4527 |
| 559 | Ga0496114_0076181 | 3300048917 | Bacteria | 2826 |
| 560 | Ga0496114_0105636 | 3300048917 | Bacteria | 2409 |
| 561 | Ga0496114_0235275 | 3300048917 | Archaea | 1610 |
| 562 | Ga0496115_0010437 | 3300048918 | Bacteria | 6941 |
| 563 | Ga0496115_0030971 | 3300048918 | Bacteria | 4213 |
| 564 | Ga0496116_0000383 | 3300048919 | Bacteria | 65450 |
| 565 | Ga0496117_0006252 | 3300048920 | Bacteria | 12141 |
| 566 | Ga0496117_0172358 | 3300048920 | Bacteria | 1254 |
| 567 | Ga0496117_0251798 | 3300048920 | Bacteria | 963 |
| 568 | Ga0496118_0000151 | 3300048921 | Bacteria | 122978 |
| 569 | Ga0496119_0001491 | 3300048922 | Bacteria | 28020 |
| 570 | Ga0496119_0020645 | 3300048922 | Bacteria | 4795 |
| 571 | Ga0496119_0191967 | 3300048922 | Bacteria | 1063 |
| 572 | Ga0496120_0031801 | 3300048923 | Bacteria | 3190 |
| 573 | Ga0496124_0370730 | 3300048927 | Bacteria | 1005 |
| 574 | Ga0496125_0023449 | 3300048928 | Bacteria | 5696 |
| 575 | Ga0496126_0041631 | 3300048929 | Bacteria | 4249 |
| 576 | Ga0496126_0101084 | 3300048929 | Bacteria | 2522 |
| 577 | Ga0501033_0290880 | 3300049570 | Bacteria | 1152 |
| 578 | Ga0501036_0072455 | 3300049572 | Bacteria | 2912 |
| 579 | Ga0501038_0074699 | 3300049574 | Bacteria | 2867 |
| 580 | Ga0501039_0058119 | 3300049575 | Bacteria | 2995 |
| 581 | Ga0501040_0403839 | 3300049576 | Bacteria | 981 |
| 582 | Ga0501040_0581071 | 3300049576 | Bacteria | 809 |
| 583 | Ga0501042_0022841 | 3300049578 | Bacteria | 4371 |
| 584 | Ga0501042_0033220 | 3300049578 | Bacteria | 3657 |
| 585 | Ga0501043_0441120 | 3300049579 | Bacteria | 979 |
| 586 | Ga0501047_0006642 | 3300049581 | Bacteria | 10874 |
| 587 | Ga0501047_0047086 | 3300049581 | Bacteria | 4166 |
| 588 | Ga0501047_0081451 | 3300049581 | Bacteria | 3111 |
| 589 | Ga0501047_0227903 | 3300049581 | Bacteria | 1718 |
| 590 | Ga0501048_0014802 | 3300049582 | Bacteria | 5770 |
| 591 | Ga0501048_0344963 | 3300049582 | Bacteria | 1062 |
| 592 | Ga0501067_0227383 | 3300049583 | Bacteria | 1039 |
| 593 | Ga0501068_0204358 | 3300049584 | Unclassified | 1253 |
| 594 | Ga0501069_0064796 | 3300049585 | Bacteria | 2042 |
| 595 | Ga0501069_0435247 | 3300049585 | Bacteria | 778 |
| 596 | Ga0501070_0007643 | 3300049586 | Bacteria | 9177 |
| 597 | Ga0501070_0217273 | 3300049586 | Bacteria | 1568 |
| 598 | Ga0501070_0237462 | 3300049586 | Bacteria | 1492 |
| 599 | Ga0501070_0305179 | 3300049586 | Unclassified | 1296 |
| 600 | Ga0501070_0624377 | 3300049586 | Bacteria | 857 |
| 601 | Ga0501070_0751237 | 3300049586 | Unclassified | 768 |
| 602 | Ga0501072_0002808 | 3300049588 | Bacteria | 13068 |
| 603 | Ga0501074_0016615 | 3300049590 | Bacteria | 5341 |
| 604 | Ga0501074_0172762 | 3300049590 | Bacteria | 1542 |
| 605 | Ga0501075_0017405 | 3300049591 | Bacteria | 5192 |
| 606 | Ga0501075_0102000 | 3300049591 | Unclassified | 2179 |
| 607 | Ga0501076_0001340 | 3300049592 | Bacteria | 16472 |
| 608 | Ga0501077_0157549 | 3300049593 | Bacteria | 1441 |
| 609 | Ga0501079_0032683 | 3300049741 | Bacteria | 4001 |
| 610 | Ga0501079_0072035 | 3300049741 | Bacteria | 2670 |
| 611 | Ga0501079_0210422 | 3300049741 | Bacteria | 1519 |
| 612 | Ga0501079_0604150 | 3300049741 | Bacteria | 863 |
| 613 | Ga0501080_0156454 | 3300049742 | Bacteria | 2105 |
| 614 | Ga0501081_0003237 | 3300049743 | Bacteria | 10359 |
| 615 | Ga0501081_0310852 | 3300049743 | Bacteria | 1157 |
| 616 | Ga0501083_0229773 | 3300049744 | Bacteria | 1208 |
| 617 | Ga0501035_0178443 | 3300049822 | Bacteria | 1831 |
| 618 | Ga0501035_0399070 | 3300049822 | Bacteria | 1144 |
| 619 | Ga0501045_0004663 | 3300049824 | Bacteria | 9468 |
| 620 | nmdc:mga00v17_25864_c1 | 3300050491 | Bacteria | 3122 |
| 621 | nmdc:mga0yw44_5034_c1 | 3300050492 | Bacteria | 6175 |
| 622 | nmdc:mga0yw44_5381_c1 | 3300050492 | Bacteria | 6034 |
| 623 | nmdc:mga05p37_1191423_c1 | 3300050507 | Unclassified | 788 |
| 624 | nmdc:mga05p37_22454_c1 | 3300050507 | Bacteria | 7651 |
| 625 | nmdc:mga05p37_3930_c1 | 3300050507 | Bacteria | 17409 |
| 626 | nmdc:mga05p37_805080_c1 | 3300050507 | Bacteria | 1027 |
| 627 | nmdc:mga05p37_84577_c1 | 3300050507 | Bacteria | 3908 |
| 628 | nmdc:mga09592_509687_c1 | 3300050508 | Bacteria | 1035 |
| 629 | nmdc:mga0qj67_115620_c1 | 3300050509 | Bacteria | 2167 |
| 630 | nmdc:mga0qj67_324025_c1 | 3300050509 | Unclassified | 1247 |
| 631 | nmdc:mga0qj67_537711_c1 | 3300050509 | Unclassified | 938 |
| 632 | nmdc:mga06r32_14654_c1 | 3300050510 | Bacteria | 7115 |
| 633 | nmdc:mga06r32_1531_c1 | 3300050510 | Bacteria | 20797 |
| 634 | nmdc:mga06r32_19865_c1 | 3300050510 | Bacteria | 6174 |
| 635 | nmdc:mga06r32_789405_c1 | 3300050510 | Bacteria | 911 |
| 636 | nmdc:mga08y16_2067_c1 | 3300050511 | Bacteria | 20576 |
| 637 | nmdc:mga08y16_244087_c1 | 3300050511 | Bacteria | 1856 |
| 638 | nmdc:mga08y16_276277_c1 | 3300050511 | Bacteria | 1733 |
| 639 | nmdc:mga08y16_27817_c1 | 3300050511 | Bacteria | 5959 |
| 640 | nmdc:mga08y16_35398_c1 | 3300050511 | Bacteria | 5243 |
| 641 | nmdc:mga0n895_312579_c1 | 3300050512 | Bacteria | 1592 |
| 642 | nmdc:mga0n895_62476_c1 | 3300050512 | Bacteria | 3682 |
| 643 | nmdc:mga0n895_810759_c1 | 3300050512 | Bacteria | 926 |
| 644 | nmdc:mga0n895_87069_c1 | 3300050512 | Bacteria | 3121 |
| 645 | nmdc:mga0rr50_58397_c1 | 3300050513 | Bacteria | 2891 |
| 646 | nmdc:mga0a205_5205_c1 | 3300050515 | Bacteria | 11703 |
| 647 | nmdc:mga0a205_84873_c1 | 3300050515 | Bacteria | 3059 |
| 648 | Ga0495601_0003622 | 3300053077 | Bacteria | 8884 |
| 649 | Ga0495601_0004768 | 3300053077 | Bacteria | 7866 |
| 650 | Ga0495601_0024330 | 3300053077 | Bacteria | 3729 |
| 651 | Ga0495601_0034664 | 3300053077 | Bacteria | 3149 |
| 652 | Ga0495601_0158880 | 3300053077 | Bacteria | 1477 |
| 653 | Ga0495612_0000198 | 3300053078 | Bacteria | 25551 |
| 654 | Ga0495612_0001969 | 3300053078 | Bacteria | 8453 |
| 655 | Ga0495612_0037600 | 3300053078 | Bacteria | 1966 |
| 656 | Ga0495655_0030225 | 3300053083 | Bacteria | 1309 |
| 657 | Ga0495595_0035439 | 3300053084 | Bacteria | 2261 |
| 658 | Ga0495595_0149252 | 3300053084 | Bacteria | 1150 |
| 659 | Ga0495619_0000285 | 3300053085 | Bacteria | 36505 |
| 660 | Ga0495619_0002052 | 3300053085 | Bacteria | 13376 |
| 661 | Ga0495619_0008863 | 3300053085 | Bacteria | 6358 |
| 662 | Ga0495619_0029750 | 3300053085 | Bacteria | 3531 |
| 663 | Ga0500641_0011550 | 3300053096 | Bacteria | 3206 |
| 664 | Ga0500595_044764 | 3300053119 | Bacteria | 1401 |
| 665 | Ga0500595_060733 | 3300053119 | Unclassified | 1142 |
| 666 | Ga0501084_0002620 | 3300054114 | Bacteria | 14491 |
| 667 | Ga0501084_0442801 | 3300054114 | Bacteria | 1098 |
| 668 | Ga0501084_1004241 | 3300054114 | Unclassified | 701 |
| 669 | Ga0501082_0001162 | 3300060353 | Bacteria | 23190 |
| 670 | Ga0466962_0073360 | 3300061719 | Bacteria | 1635 |
| 671 | Ga0530510_0002230 | 3300061734 | Bacteria | 13291 |
| 672 | Ga0530510_0146667 | 3300061734 | Bacteria | 1741 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300038443 | Ga0395901_1264614 | Ga0395901_1264614_275_688 | 127 |
| 2 | 3300049581 | Ga0501047_0227903 | Ga0501047_0227903_1082_1633 | 132 |
| 3 | 3300005435 | Ga0070714_100042858 | Ga0070714_1000428582 | 133 |
| 4 | 3300009093 | Ga0105240_10063125 | Ga0105240_100631252 | 133 |
| 5 | 3300006847 | Ga0075431_100531887 | Ga0075431_1005318872 | 134 |
| 6 | 3300028558 | Ga0265326_10000003 | Ga0265326_100000034 | 134 |
| 7 | 3300028563 | Ga0265319_1001029 | Ga0265319_10010293 | 134 |
| 8 | 3300028573 | Ga0265334_10000019 | Ga0265334_1000001938 | 134 |
| 9 | 3300028666 | Ga0265336_10071044 | Ga0265336_100710442 | 134 |
| 10 | 3300028800 | Ga0265338_10004357 | Ga0265338_1000435714 | 134 |
| 11 | 3300029957 | Ga0265324_10000344 | Ga0265324_100003446 | 134 |
| 12 | 3300031251 | Ga0265327_10046293 | Ga0265327_100462932 | 134 |
| 13 | 3300006847 | Ga0075431_100655129 | Ga0075431_1006551292 | 139 |
| 14 | 3300006852 | Ga0075433_10010256 | Ga0075433_100102563 | 139 |
| 15 | 3300006871 | Ga0075434_100003617 | Ga0075434_1000036179 | 139 |
| 16 | 3300009147 | Ga0114129_10002590 | Ga0114129_100025909 | 139 |
| 17 | 3300050507 | nmdc:mga05p37_3930_c1 | nmdc:mga05p37_3930_c1_11593_12117 | 139 |
| 18 | 3300050512 | nmdc:mga0n895_62476_c1 | nmdc:mga0n895_62476_c1_2375_2899 | 139 |
| 19 | 3300050515 | nmdc:mga0a205_5205_c1 | nmdc:mga0a205_5205_c1_1179_1703 | 139 |
| 20 | 3300010375 | Ga0105239_11561949 | Ga0105239_115619492 | 140 |
| 21 | 3300048905 | Ga0496102_1166496 | Ga0496102_1166496_64_591 | 140 |
| 22 | 3300048906 | Ga0496103_0284347 | Ga0496103_0284347_132_659 | 140 |
| 23 | 3300049741 | Ga0501079_0210422 | Ga0501079_0210422_410_964 | 142 |
| 24 | 3300049743 | Ga0501081_0310852 | Ga0501081_0310852_314_868 | 142 |
| 25 | 3300054114 | Ga0501084_0442801 | Ga0501084_0442801_94_648 | 142 |
| 26 | 3300061734 | Ga0530510_0146667 | Ga0530510_0146667_650_1204 | 142 |
| 27 | 3300005356 | Ga0070674_100000011 | Ga0070674_10000001128 | 143 |
| 28 | 3300005718 | Ga0068866_10000002 | Ga0068866_1000000228 | 143 |
| 29 | 3300025899 | Ga0207642_10000001 | Ga0207642_10000001580 | 143 |
| 30 | 3300025899 | Ga0207642_10000003 | Ga0207642_10000003580 | 143 |
| 31 | 3300025937 | Ga0207669_10000027 | Ga0207669_1000002728 | 143 |
| 32 | 3300005535 | Ga0070684_100406798 | Ga0070684_1004067982 | 146 |
| 33 | 3300038443 | Ga0395901_1687576 | Ga0395901_1687576_37_561 | 146 |
| 34 | 3300046459 | Ga0495629_0255943 | Ga0495629_0255943_20_496 | 146 |
| 35 | 3300037418 | Ga0395900_0063212 | Ga0395900_0063212_2986_3537 | 147 |
| 36 | 3300046516 | Ga0495628_0007060 | Ga0495628_0007060_1227_1739 | 148 |
| 37 | 3300047471 | Ga0495684_0481076 | Ga0495684_0481076_12_524 | 148 |
| 38 | 3300005338 | Ga0068868_100000630 | Ga0068868_10000063017 | 149 |
| 39 | 3300005983 | Ga0081540_1000197 | Ga0081540_100019726 | 149 |
| 40 | 3300014326 | Ga0157380_10000072 | Ga0157380_1000007222 | 149 |
| 41 | 3300026023 | Ga0207677_10000225 | Ga0207677_100002257 | 149 |
| 42 | 3300044765 | Ga0466970_0203787 | Ga0466970_0203787_142_654 | 149 |
| 43 | 3300048910 | Ga0496107_0139789 | Ga0496107_0139789_216_740 | 149 |
| 44 | 3300049582 | Ga0501048_0344963 | Ga0501048_0344963_27_551 | 149 |
| 45 | 3300005435 | Ga0070714_100047621 | Ga0070714_1000476212 | 150 |
| 46 | 3300025933 | Ga0207706_10591398 | Ga0207706_105913982 | 150 |
| 47 | 3300046559 | Ga0495667_0000044 | Ga0495667_0000044_41635_42156 | 151 |
| 48 | 3300047322 | Ga0495680_0008245 | Ga0495680_0008245_4480_5001 | 151 |
| 49 | 3300047469 | Ga0495673_0047463 | Ga0495673_0047463_562_1071 | 151 |
| 50 | 3300044658 | Ga0466972_0266297 | Ga0466972_0266297_20_532 | 152 |
| 51 | 3300044693 | Ga0466961_0203009 | Ga0466961_0203009_367_879 | 152 |
| 52 | 3300044694 | Ga0466963_0122868 | Ga0466963_0122868_11_523 | 152 |
| 53 | 3300044842 | Ga0466957_0202147 | Ga0466957_0202147_241_753 | 152 |
| 54 | 3300044901 | Ga0466960_0281825 | Ga0466960_0281825_100_612 | 152 |
| 55 | 3300061719 | Ga0466962_0073360 | Ga0466962_0073360_605_1117 | 152 |
| 56 | 3300005985 | Ga0081539_10028719 | Ga0081539_100287193 | 153 |
| 57 | 3300014968 | Ga0157379_10091796 | Ga0157379_100917964 | 153 |
| 58 | 3300046454 | Ga0495592_0000537 | Ga0495592_0000537_13350_13862 | 153 |
| 59 | 3300005457 | Ga0070662_100000008 | Ga0070662_10000000841 | 154 |
| 60 | 3300025933 | Ga0207706_10000016 | Ga0207706_10000016134 | 154 |
| 61 | 3300005456 | Ga0070678_100070973 | Ga0070678_1000709734 | 155 |
| 62 | 3300005981 | Ga0081538_10161820 | Ga0081538_101618202 | 155 |
| 63 | 3300025919 | Ga0207657_10257700 | Ga0207657_102577002 | 155 |
| 64 | 3300026121 | Ga0207683_10028543 | Ga0207683_100285435 | 155 |
| 65 | 3300035120 | Ga0373957_0067017 | Ga0373957_0067017_495_1019 | 155 |
| 66 | 3300036401 | Ga0373937_0027519 | Ga0373937_0027519_1755_2279 | 155 |
| 67 | 3300046473 | Ga0495582_0000022 | Ga0495582_0000022_44387_44896 | 155 |
| 68 | 3300046511 | Ga0495608_0080179 | Ga0495608_0080179_1161_1685 | 155 |
| 69 | 3300046683 | Ga0495658_0000008 | Ga0495658_0000008_44827_45336 | 155 |
| 70 | 3300046809 | Ga0495600_0017502 | Ga0495600_0017502_1905_2429 | 155 |
| 71 | 3300047317 | Ga0495604_0020213 | Ga0495604_0020213_3631_4155 | 155 |
| 72 | 3300047444 | Ga0495675_0313595 | Ga0495675_0313595_261_785 | 155 |
| 73 | 3300053084 | Ga0495595_0035439 | Ga0495595_0035439_999_1523 | 155 |
| 74 | 3300053085 | Ga0495619_0008863 | Ga0495619_0008863_3276_3800 | 155 |
| 75 | 3300005983 | Ga0081540_1000126 | Ga0081540_100012656 | 156 |
| 76 | 3300006163 | Ga0070715_10000015 | Ga0070715_10000015139 | 156 |
| 77 | 3300025905 | Ga0207685_10000001 | Ga0207685_10000001288 | 156 |
| 78 | 3300045976 | Ga0466967_0016981 | Ga0466967_0016981_4622_5128 | 156 |
| 79 | 3300046529 | Ga0495652_0025477 | Ga0495652_0025477_2953_3465 | 156 |
| 80 | 3300046536 | Ga0495587_0111489 | Ga0495587_0111489_568_1077 | 156 |
| 81 | 3300048917 | Ga0496114_0235275 | Ga0496114_0235275_840_1358 | 156 |
| 82 | 3300048918 | Ga0496115_0030971 | Ga0496115_0030971_2088_2606 | 156 |
| 83 | 3300053077 | Ga0495601_0004768 | Ga0495601_0004768_3054_3566 | 156 |
| 84 | 3300005364 | Ga0070673_100000804 | Ga0070673_1000008043 | 157 |
| 85 | 3300005614 | Ga0068856_101617584 | Ga0068856_1016175842 | 157 |
| 86 | 3300025960 | Ga0207651_10001207 | Ga0207651_1000120710 | 157 |
| 87 | 3300044694 | Ga0466963_0011130 | Ga0466963_0011130_4364_4849 | 157 |
| 88 | 3300044694 | Ga0466963_0132078 | Ga0466963_0132078_1121_1606 | 157 |
| 89 | 3300044706 | Ga0466964_0157631 | Ga0466964_0157631_394_876 | 157 |
| 90 | 3300044842 | Ga0466957_0043534 | Ga0466957_0043534_981_1466 | 157 |
| 91 | 3300045976 | Ga0466967_0034447 | Ga0466967_0034447_399_884 | 157 |
| 92 | 3300045976 | Ga0466967_0076943 | Ga0466967_0076943_946_1428 | 157 |
| 93 | 3300046615 | Ga0495656_0319829 | Ga0495656_0319829_91_636 | 157 |
| 94 | 3300046681 | Ga0495647_0000003 | Ga0495647_0000003_74137_74649 | 157 |
| 95 | 3300048915 | Ga0496112_0301035 | Ga0496112_0301035_155_676 | 157 |
| 96 | 3300049576 | Ga0501040_0581071 | Ga0501040_0581071_38_523 | 157 |
| 97 | 3300050508 | nmdc:mga09592_509687_c1 | nmdc:mga09592_509687_c1_132_653 | 157 |
| 98 | 3300006846 | Ga0075430_100022244 | Ga0075430_1000222442 | 158 |
| 99 | 3300050509 | nmdc:mga0qj67_115620_c1 | nmdc:mga0qj67_115620_c1_866_1384 | 158 |
| 100 | 3300053085 | Ga0495619_0002052 | Ga0495619_0002052_3172_3681 | 158 |
| 101 | 3300005334 | Ga0068869_100304890 | Ga0068869_1003048902 | 159 |
| 102 | 3300005339 | Ga0070660_101261583 | Ga0070660_1012615831 | 159 |
| 103 | 3300005459 | Ga0068867_101077033 | Ga0068867_1010770332 | 159 |
| 104 | 3300005544 | Ga0070686_100965392 | Ga0070686_1009653921 | 159 |
| 105 | 3300005564 | Ga0070664_100532737 | Ga0070664_1005327372 | 159 |
| 106 | 3300005616 | Ga0068852_100575123 | Ga0068852_1005751232 | 159 |
| 107 | 3300005842 | Ga0068858_101157919 | Ga0068858_1011579191 | 159 |
| 108 | 3300009098 | Ga0105245_10607744 | Ga0105245_106077442 | 159 |
| 109 | 3300009551 | Ga0105238_10000051 | Ga0105238_100000517 | 159 |
| 110 | 3300009553 | Ga0105249_10458693 | Ga0105249_104586932 | 159 |
| 111 | 3300014325 | Ga0163163_10634903 | Ga0163163_106349032 | 159 |
| 112 | 3300025924 | Ga0207694_10000035 | Ga0207694_10000035130 | 159 |
| 113 | 3300025932 | Ga0207690_10055624 | Ga0207690_100556245 | 159 |
| 114 | 3300045976 | Ga0466967_1150937 | Ga0466967_1150937_174_683 | 159 |
| 115 | 3300046642 | Ga0495634_0214518 | Ga0495634_0214518_471_980 | 159 |
| 116 | 3300047320 | Ga0495672_0240939 | Ga0495672_0240939_86_610 | 159 |
| 117 | 3300048909 | Ga0496106_0000147 | Ga0496106_0000147_9172_9684 | 159 |
| 118 | 3300048909 | Ga0496106_0537979 | Ga0496106_0537979_183_707 | 159 |
| 119 | 3300048910 | Ga0496107_0037005 | Ga0496107_0037005_2391_2903 | 159 |
| 120 | 3300013306 | Ga0163162_10252839 | Ga0163162_102528392 | 160 |
| 121 | 3300025929 | Ga0207664_10258909 | Ga0207664_102589092 | 160 |
| 122 | 3300037466 | Ga0395898_0005594 | Ga0395898_0005594_12807_13352 | 160 |
| 123 | 3300037471 | Ga0395905_0010070 | Ga0395905_0010070_244_789 | 160 |
| 124 | 3300038443 | Ga0395901_0169820 | Ga0395901_0169820_202_747 | 160 |
| 125 | 3300041512 | Ga0451853_1508810 | Ga0451853_1508810_706_1254 | 160 |
| 126 | 3300045976 | Ga0466967_0591584 | Ga0466967_0591584_116_634 | 160 |
| 127 | 3300046460 | Ga0495638_0180848 | Ga0495638_0180848_615_1133 | 160 |
| 128 | 3300046499 | Ga0495594_0000005 | Ga0495594_0000005_54741_55280 | 160 |
| 129 | 3300046516 | Ga0495628_0000194 | Ga0495628_0000194_33791_34306 | 160 |
| 130 | 3300046557 | Ga0495622_0000026 | Ga0495622_0000026_16988_17527 | 160 |
| 131 | 3300053096 | Ga0500641_0011550 | Ga0500641_0011550_2256_2774 | 160 |
| 132 | 3300045976 | Ga0466967_0206678 | Ga0466967_0206678_902_1420 | 161 |
| 133 | 3300046533 | Ga0495640_0014191 | Ga0495640_0014191_2248_2757 | 161 |
| 134 | 3300046642 | Ga0495634_0058197 | Ga0495634_0058197_383_892 | 161 |
| 135 | 3300005355 | Ga0070671_100042553 | Ga0070671_1000425532 | 162 |
| 136 | 3300047472 | Ga0495686_0036681 | Ga0495686_0036681_1589_2107 | 162 |
| 137 | 3300048905 | Ga0496102_0261101 | Ga0496102_0261101_637_1155 | 162 |
| 138 | 3300049578 | Ga0501042_0033220 | Ga0501042_0033220_1250_1768 | 162 |
| 139 | 3300039453 | Ga0436362_0988173 | Ga0436362_0988173_476_1015 | 163 |
| 140 | 3300046533 | Ga0495640_0031717 | Ga0495640_0031717_320_838 | 163 |
| 141 | 3300047319 | Ga0495674_0000027 | Ga0495674_0000027_2677_3195 | 163 |
| 142 | 3300048088 | Ga0495602_0001509 | Ga0495602_0001509_9109_9624 | 163 |
| 143 | 3300049578 | Ga0501042_0022841 | Ga0501042_0022841_3401_3916 | 163 |
| 144 | 3300005444 | Ga0070694_100113332 | Ga0070694_1001133322 | 164 |
| 145 | 3300005545 | Ga0070695_100442849 | Ga0070695_1004428492 | 164 |
| 146 | 3300005546 | Ga0070696_100281907 | Ga0070696_1002819072 | 164 |
| 147 | 3300005549 | Ga0070704_100491076 | Ga0070704_1004910761 | 164 |
| 148 | 3300005615 | Ga0070702_100144761 | Ga0070702_1001447612 | 164 |
| 149 | 3300009098 | Ga0105245_11238130 | Ga0105245_112381302 | 164 |
| 150 | 3300009148 | Ga0105243_10430997 | Ga0105243_104309972 | 164 |
| 151 | 3300009176 | Ga0105242_10395813 | Ga0105242_103958132 | 164 |
| 152 | 3300025934 | Ga0207686_10983465 | Ga0207686_109834651 | 164 |
| 153 | 3300025937 | Ga0207669_10837942 | Ga0207669_108379422 | 164 |
| 154 | 3300025938 | Ga0207704_10311339 | Ga0207704_103113392 | 164 |
| 155 | 3300028381 | Ga0268264_10654475 | Ga0268264_106544752 | 164 |
| 156 | 3300032002 | Ga0307416_101355612 | Ga0307416_1013556122 | 164 |
| 157 | 3300048908 | Ga0496105_0653889 | Ga0496105_0653889_231_755 | 164 |
| 158 | 3300048909 | Ga0496106_0757346 | Ga0496106_0757346_234_761 | 164 |
| 159 | 3300048912 | Ga0496109_0382369 | Ga0496109_0382369_193_717 | 164 |
| 160 | 3300005329 | Ga0070683_100011292 | Ga0070683_1000112927 | 165 |
| 161 | 3300005535 | Ga0070684_100036375 | Ga0070684_1000363753 | 165 |
| 162 | 3300005564 | Ga0070664_100114129 | Ga0070664_1001141293 | 165 |
| 163 | 3300025944 | Ga0207661_10000145 | Ga0207661_100001456 | 165 |
| 164 | 3300025945 | Ga0207679_10088214 | Ga0207679_100882143 | 165 |
| 165 | 3300044694 | Ga0466963_0139994 | Ga0466963_0139994_1021_1527 | 165 |
| 166 | 3300045976 | Ga0466967_0077728 | Ga0466967_0077728_2238_2747 | 165 |
| 167 | 3300045976 | Ga0466967_0085176 | Ga0466967_0085176_1747_2253 | 165 |
| 168 | 3300045976 | Ga0466967_0513106 | Ga0466967_0513106_346_852 | 165 |
| 169 | 3300005981 | Ga0081538_10047438 | Ga0081538_100474385 | 166 |
| 170 | 3300028379 | Ga0268266_10369633 | Ga0268266_103696332 | 166 |
| 171 | 3300031548 | Ga0307408_100433638 | Ga0307408_1004336382 | 166 |
| 172 | 3300031731 | Ga0307405_10015592 | Ga0307405_100155922 | 166 |
| 173 | 3300031731 | Ga0307405_10216365 | Ga0307405_102163652 | 166 |
| 174 | 3300031824 | Ga0307413_10028803 | Ga0307413_100288032 | 166 |
| 175 | 3300031852 | Ga0307410_10034172 | Ga0307410_100341723 | 166 |
| 176 | 3300031901 | Ga0307406_10018027 | Ga0307406_100180272 | 166 |
| 177 | 3300031903 | Ga0307407_10007021 | Ga0307407_100070215 | 166 |
| 178 | 3300031911 | Ga0307412_10323890 | Ga0307412_103238902 | 166 |
| 179 | 3300031995 | Ga0307409_100163018 | Ga0307409_1001630182 | 166 |
| 180 | 3300032002 | Ga0307416_100010981 | Ga0307416_1000109813 | 166 |
| 181 | 3300032002 | Ga0307416_100114106 | Ga0307416_1001141063 | 166 |
| 182 | 3300032005 | Ga0307411_10037829 | Ga0307411_100378294 | 166 |
| 183 | 3300032005 | Ga0307411_10435597 | Ga0307411_104355972 | 166 |
| 184 | 3300032126 | Ga0307415_100000902 | Ga0307415_1000009024 | 166 |
| 185 | 3300032126 | Ga0307415_100018798 | Ga0307415_1000187982 | 166 |
| 186 | 3300032126 | Ga0307415_100392427 | Ga0307415_1003924272 | 166 |
| 187 | 3300003203 | JGI25406J46586_10018654 | JGI25406J46586_100186545 | 167 |
| 188 | 3300005327 | Ga0070658_11225640 | Ga0070658_112256401 | 167 |
| 189 | 3300005329 | Ga0070683_100132025 | Ga0070683_1001320253 | 167 |
| 190 | 3300005338 | Ga0068868_100581851 | Ga0068868_1005818512 | 167 |
| 191 | 3300005345 | Ga0070692_10085595 | Ga0070692_100855951 | 167 |
| 192 | 3300005438 | Ga0070701_10318101 | Ga0070701_103181012 | 167 |
| 193 | 3300005543 | Ga0070672_100000003 | Ga0070672_10000000314 | 167 |
| 194 | 3300005546 | Ga0070696_100997958 | Ga0070696_1009979582 | 167 |
| 195 | 3300005578 | Ga0068854_100506719 | Ga0068854_1005067192 | 167 |
| 196 | 3300005615 | Ga0070702_100089804 | Ga0070702_1000898042 | 167 |
| 197 | 3300005618 | Ga0068864_101297641 | Ga0068864_1012976412 | 167 |
| 198 | 3300005937 | Ga0081455_10013749 | Ga0081455_100137492 | 167 |
| 199 | 3300005985 | Ga0081539_10028605 | Ga0081539_100286055 | 167 |
| 200 | 3300006058 | Ga0075432_10090093 | Ga0075432_100900931 | 167 |
| 201 | 3300006844 | Ga0075428_100045652 | Ga0075428_1000456523 | 167 |
| 202 | 3300006847 | Ga0075431_100534343 | Ga0075431_1005343431 | 167 |
| 203 | 3300009094 | Ga0111539_10009234 | Ga0111539_100092348 | 167 |
| 204 | 3300009094 | Ga0111539_10332640 | Ga0111539_103326402 | 167 |
| 205 | 3300009148 | Ga0105243_10355068 | Ga0105243_103550682 | 167 |
| 206 | 3300009176 | Ga0105242_11470223 | Ga0105242_114702232 | 167 |
| 207 | 3300009551 | Ga0105238_10855761 | Ga0105238_108557612 | 167 |
| 208 | 3300010375 | Ga0105239_10837492 | Ga0105239_108374922 | 167 |
| 209 | 3300011119 | Ga0105246_10545038 | Ga0105246_105450382 | 167 |
| 210 | 3300013306 | Ga0163162_10723612 | Ga0163162_107236122 | 167 |
| 211 | 3300014326 | Ga0157380_10558060 | Ga0157380_105580602 | 167 |
| 212 | 3300025908 | Ga0207643_10145792 | Ga0207643_101457922 | 167 |
| 213 | 3300025933 | Ga0207706_10576692 | Ga0207706_105766921 | 167 |
| 214 | 3300025940 | Ga0207691_10000005 | Ga0207691_1000000516 | 167 |
| 215 | 3300025944 | Ga0207661_10030094 | Ga0207661_100300945 | 167 |
| 216 | 3300025945 | Ga0207679_11364670 | Ga0207679_113646702 | 167 |
| 217 | 3300025961 | Ga0207712_10620335 | Ga0207712_106203352 | 167 |
| 218 | 3300026067 | Ga0207678_10217878 | Ga0207678_102178782 | 167 |
| 219 | 3300027907 | Ga0207428_10043985 | Ga0207428_100439855 | 167 |
| 220 | 3300031852 | Ga0307410_10138507 | Ga0307410_101385072 | 167 |
| 221 | 3300031995 | Ga0307409_100403306 | Ga0307409_1004033062 | 167 |
| 222 | 3300032005 | Ga0307411_10234816 | Ga0307411_102348162 | 167 |
| 223 | 3300032126 | Ga0307415_100179335 | Ga0307415_1001793352 | 167 |
| 224 | 3300032126 | Ga0307415_100450932 | Ga0307415_1004509322 | 167 |
| 225 | 3300037418 | Ga0395900_0675323 | Ga0395900_0675323_183_734 | 167 |
| 226 | 3300037466 | Ga0395898_0076838 | Ga0395898_0076838_502_1050 | 167 |
| 227 | 3300037466 | Ga0395898_1028707 | Ga0395898_1028707_11_559 | 167 |
| 228 | 3300037471 | Ga0395905_0132251 | Ga0395905_0132251_1558_2106 | 167 |
| 229 | 3300038443 | Ga0395901_0565201 | Ga0395901_0565201_82_594 | 167 |
| 230 | 3300046500 | Ga0495596_0091803 | Ga0495596_0091803_469_984 | 167 |
| 231 | 3300046518 | Ga0495631_0179932 | Ga0495631_0179932_34_549 | 167 |
| 232 | 3300046537 | Ga0495598_0304441 | Ga0495598_0304441_72_587 | 167 |
| 233 | 3300046539 | Ga0495621_0392720 | Ga0495621_0392720_12_527 | 167 |
| 234 | 3300048913 | Ga0496110_0742544 | Ga0496110_0742544_234_749 | 167 |
| 235 | 3300048914 | Ga0496111_0340594 | Ga0496111_0340594_227_742 | 167 |
| 236 | 3300049583 | Ga0501067_0227383 | Ga0501067_0227383_485_1000 | 167 |
| 237 | 3300049741 | Ga0501079_0604150 | Ga0501079_0604150_201_716 | 167 |
| 238 | 3300050510 | nmdc:mga06r32_789405_c1 | nmdc:mga06r32_789405_c1_370_885 | 167 |
| 239 | 3300050511 | nmdc:mga08y16_2067_c1 | nmdc:mga08y16_2067_c1_8841_9356 | 167 |
| 240 | 3300050511 | nmdc:mga08y16_244087_c1 | nmdc:mga08y16_244087_c1_652_1167 | 167 |
| 241 | 3300053083 | Ga0495655_0030225 | Ga0495655_0030225_766_1281 | 167 |
| 242 | 3300003373 | JGI25407J50210_10031519 | JGI25407J50210_100315192 | 168 |
| 243 | 3300005329 | Ga0070683_100204451 | Ga0070683_1002044513 | 168 |
| 244 | 3300005331 | Ga0070670_100795377 | Ga0070670_1007953771 | 168 |
| 245 | 3300005339 | Ga0070660_100360022 | Ga0070660_1003600222 | 168 |
| 246 | 3300005339 | Ga0070660_100881979 | Ga0070660_1008819791 | 168 |
| 247 | 3300005356 | Ga0070674_100606498 | Ga0070674_1006064982 | 168 |
| 248 | 3300005366 | Ga0070659_100304430 | Ga0070659_1003044302 | 168 |
| 249 | 3300005366 | Ga0070659_100773351 | Ga0070659_1007733511 | 168 |
| 250 | 3300005441 | Ga0070700_100057935 | Ga0070700_1000579354 | 168 |
| 251 | 3300005455 | Ga0070663_100634852 | Ga0070663_1006348522 | 168 |
| 252 | 3300005456 | Ga0070678_100159308 | Ga0070678_1001593082 | 168 |
| 253 | 3300005466 | Ga0070685_10089592 | Ga0070685_100895922 | 168 |
| 254 | 3300005535 | Ga0070684_100730482 | Ga0070684_1007304822 | 168 |
| 255 | 3300005539 | Ga0068853_101544668 | Ga0068853_1015446681 | 168 |
| 256 | 3300005564 | Ga0070664_100808496 | Ga0070664_1008084962 | 168 |
| 257 | 3300005577 | Ga0068857_101018018 | Ga0068857_1010180181 | 168 |
| 258 | 3300005615 | Ga0070702_100582319 | Ga0070702_1005823192 | 168 |
| 259 | 3300005616 | Ga0068852_101446079 | Ga0068852_1014460792 | 168 |
| 260 | 3300005937 | Ga0081455_10077124 | Ga0081455_100771245 | 168 |
| 261 | 3300005981 | Ga0081538_10000672 | Ga0081538_100006729 | 168 |
| 262 | 3300006175 | Ga0070712_100058438 | Ga0070712_1000584384 | 168 |
| 263 | 3300006358 | Ga0068871_101435956 | Ga0068871_1014359561 | 168 |
| 264 | 3300025899 | Ga0207642_10358057 | Ga0207642_103580572 | 168 |
| 265 | 3300025901 | Ga0207688_10020234 | Ga0207688_100202342 | 168 |
| 266 | 3300025901 | Ga0207688_10324552 | Ga0207688_103245522 | 168 |
| 267 | 3300025907 | Ga0207645_10134516 | Ga0207645_101345162 | 168 |
| 268 | 3300025908 | Ga0207643_10053322 | Ga0207643_100533223 | 168 |
| 269 | 3300025915 | Ga0207693_10025456 | Ga0207693_100254564 | 168 |
| 270 | 3300025923 | Ga0207681_10605440 | Ga0207681_106054402 | 168 |
| 271 | 3300025925 | Ga0207650_10451257 | Ga0207650_104512572 | 168 |
| 272 | 3300025932 | Ga0207690_10368001 | Ga0207690_103680012 | 168 |
| 273 | 3300025940 | Ga0207691_10322078 | Ga0207691_103220782 | 168 |
| 274 | 3300025945 | Ga0207679_10395543 | Ga0207679_103955432 | 168 |
| 275 | 3300026023 | Ga0207677_10712381 | Ga0207677_107123811 | 168 |
| 276 | 3300026075 | Ga0207708_10141957 | Ga0207708_101419573 | 168 |
| 277 | 3300026089 | Ga0207648_10030680 | Ga0207648_100306804 | 168 |
| 278 | 3300026116 | Ga0207674_10675608 | Ga0207674_106756082 | 168 |
| 279 | 3300026118 | Ga0207675_100014322 | Ga0207675_1000143222 | 168 |
| 280 | 3300026121 | Ga0207683_10086377 | Ga0207683_100863773 | 168 |
| 281 | 3300026142 | Ga0207698_11309018 | Ga0207698_113090181 | 168 |
| 282 | 3300031995 | Ga0307409_100400896 | Ga0307409_1004008962 | 168 |
| 283 | 3300032126 | Ga0307415_101340856 | Ga0307415_1013408562 | 168 |
| 284 | 3300037466 | Ga0395898_0741479 | Ga0395898_0741479_301_819 | 168 |
| 285 | 3300042011 | Ga0439454_033148 | Ga0439454_033148_68_586 | 168 |
| 286 | 3300042438 | Ga0439459_0171988 | Ga0439459_0171988_43_561 | 168 |
| 287 | 3300050511 | nmdc:mga08y16_276277_c1 | nmdc:mga08y16_276277_c1_950_1468 | 168 |
| 288 | 3300005329 | Ga0070683_100200901 | Ga0070683_1002009012 | 169 |
| 289 | 3300005335 | Ga0070666_10130504 | Ga0070666_101305042 | 169 |
| 290 | 3300005338 | Ga0068868_100007830 | Ga0068868_1000078306 | 169 |
| 291 | 3300005338 | Ga0068868_100013387 | Ga0068868_1000133876 | 169 |
| 292 | 3300005340 | Ga0070689_100118366 | Ga0070689_1001183663 | 169 |
| 293 | 3300005340 | Ga0070689_100275718 | Ga0070689_1002757182 | 169 |
| 294 | 3300005341 | Ga0070691_10121755 | Ga0070691_101217552 | 169 |
| 295 | 3300005344 | Ga0070661_100000045 | Ga0070661_10000004522 | 169 |
| 296 | 3300005347 | Ga0070668_100430500 | Ga0070668_1004305002 | 169 |
| 297 | 3300005347 | Ga0070668_100789921 | Ga0070668_1007899212 | 169 |
| 298 | 3300005353 | Ga0070669_100431524 | Ga0070669_1004315242 | 169 |
| 299 | 3300005354 | Ga0070675_100251789 | Ga0070675_1002517892 | 169 |
| 300 | 3300005356 | Ga0070674_100427065 | Ga0070674_1004270651 | 169 |
| 301 | 3300005364 | Ga0070673_100246723 | Ga0070673_1002467232 | 169 |
| 302 | 3300005366 | Ga0070659_100063795 | Ga0070659_1000637952 | 169 |
| 303 | 3300005366 | Ga0070659_100457757 | Ga0070659_1004577572 | 169 |
| 304 | 3300005439 | Ga0070711_100037276 | Ga0070711_1000372764 | 169 |
| 305 | 3300005440 | Ga0070705_100338113 | Ga0070705_1003381132 | 169 |
| 306 | 3300005441 | Ga0070700_100024596 | Ga0070700_1000245963 | 169 |
| 307 | 3300005444 | Ga0070694_100178997 | Ga0070694_1001789972 | 169 |
| 308 | 3300005455 | Ga0070663_100015088 | Ga0070663_1000150883 | 169 |
| 309 | 3300005456 | Ga0070678_100213808 | Ga0070678_1002138082 | 169 |
| 310 | 3300005458 | Ga0070681_10469373 | Ga0070681_104693732 | 169 |
| 311 | 3300005459 | Ga0068867_100640815 | Ga0068867_1006408152 | 169 |
| 312 | 3300005466 | Ga0070685_10038181 | Ga0070685_100381812 | 169 |
| 313 | 3300005466 | Ga0070685_10476139 | Ga0070685_104761392 | 169 |
| 314 | 3300005468 | Ga0070707_100509138 | Ga0070707_1005091382 | 169 |
| 315 | 3300005530 | Ga0070679_100562483 | Ga0070679_1005624832 | 169 |
| 316 | 3300005535 | Ga0070684_100014039 | Ga0070684_1000140394 | 169 |
| 317 | 3300005539 | Ga0068853_100092136 | Ga0068853_1000921363 | 169 |
| 318 | 3300005545 | Ga0070695_100325927 | Ga0070695_1003259272 | 169 |
| 319 | 3300005545 | Ga0070695_100496326 | Ga0070695_1004963261 | 169 |
| 320 | 3300005546 | Ga0070696_101187887 | Ga0070696_1011878871 | 169 |
| 321 | 3300005547 | Ga0070693_100711599 | Ga0070693_1007115991 | 169 |
| 322 | 3300005549 | Ga0070704_100044190 | Ga0070704_1000441902 | 169 |
| 323 | 3300005563 | Ga0068855_100629730 | Ga0068855_1006297301 | 169 |
| 324 | 3300005564 | Ga0070664_100017819 | Ga0070664_1000178194 | 169 |
| 325 | 3300005577 | Ga0068857_100044619 | Ga0068857_1000446195 | 169 |
| 326 | 3300005578 | Ga0068854_100210015 | Ga0068854_1002100152 | 169 |
| 327 | 3300005614 | Ga0068856_100016706 | Ga0068856_1000167064 | 169 |
| 328 | 3300005618 | Ga0068864_100035240 | Ga0068864_1000352403 | 169 |
| 329 | 3300005844 | Ga0068862_100192889 | Ga0068862_1001928893 | 169 |
| 330 | 3300005937 | Ga0081455_10023617 | Ga0081455_100236174 | 169 |
| 331 | 3300005937 | Ga0081455_10122076 | Ga0081455_101220764 | 169 |
| 332 | 3300005981 | Ga0081538_10138040 | Ga0081538_101380401 | 169 |
| 333 | 3300006038 | Ga0075365_10001083 | Ga0075365_100010835 | 169 |
| 334 | 3300006038 | Ga0075365_10007080 | Ga0075365_100070805 | 169 |
| 335 | 3300006051 | Ga0075364_10022106 | Ga0075364_100221063 | 169 |
| 336 | 3300006173 | Ga0070716_100166796 | Ga0070716_1001667962 | 169 |
| 337 | 3300006175 | Ga0070712_100028261 | Ga0070712_1000282614 | 169 |
| 338 | 3300006175 | Ga0070712_100114183 | Ga0070712_1001141832 | 169 |
| 339 | 3300006178 | Ga0075367_10071294 | Ga0075367_100712941 | 169 |
| 340 | 3300006844 | Ga0075428_100082542 | Ga0075428_1000825425 | 169 |
| 341 | 3300006846 | Ga0075430_100255751 | Ga0075430_1002557511 | 169 |
| 342 | 3300006847 | Ga0075431_100000960 | Ga0075431_10000096014 | 169 |
| 343 | 3300006871 | Ga0075434_100189946 | Ga0075434_1001899462 | 169 |
| 344 | 3300006871 | Ga0075434_100296494 | Ga0075434_1002964942 | 169 |
| 345 | 3300006871 | Ga0075434_100872329 | Ga0075434_1008723292 | 169 |
| 346 | 3300006881 | Ga0068865_100062494 | Ga0068865_1000624942 | 169 |
| 347 | 3300006881 | Ga0068865_101469688 | Ga0068865_1014696881 | 169 |
| 348 | 3300006914 | Ga0075436_100065903 | Ga0075436_1000659035 | 169 |
| 349 | 3300009093 | Ga0105240_10450313 | Ga0105240_104503132 | 169 |
| 350 | 3300009094 | Ga0111539_10021383 | Ga0111539_100213837 | 169 |
| 351 | 3300009094 | Ga0111539_10065292 | Ga0111539_100652922 | 169 |
| 352 | 3300009098 | Ga0105245_10003240 | Ga0105245_1000324013 | 169 |
| 353 | 3300009098 | Ga0105245_10011445 | Ga0105245_100114457 | 169 |
| 354 | 3300009147 | Ga0114129_10032655 | Ga0114129_100326553 | 169 |
| 355 | 3300009147 | Ga0114129_10794606 | Ga0114129_107946062 | 169 |
| 356 | 3300009147 | Ga0114129_10840677 | Ga0114129_108406771 | 169 |
| 357 | 3300009148 | Ga0105243_10021302 | Ga0105243_100213021 | 169 |
| 358 | 3300009148 | Ga0105243_10028552 | Ga0105243_100285523 | 169 |
| 359 | 3300009176 | Ga0105242_10218215 | Ga0105242_102182152 | 169 |
| 360 | 3300009177 | Ga0105248_10181516 | Ga0105248_101815164 | 169 |
| 361 | 3300009545 | Ga0105237_10193645 | Ga0105237_101936452 | 169 |
| 362 | 3300009553 | Ga0105249_10390570 | Ga0105249_103905702 | 169 |
| 363 | 3300010375 | Ga0105239_10014993 | Ga0105239_100149939 | 169 |
| 364 | 3300010375 | Ga0105239_11320221 | Ga0105239_113202212 | 169 |
| 365 | 3300011119 | Ga0105246_11111435 | Ga0105246_111114352 | 169 |
| 366 | 3300013296 | Ga0157374_10030601 | Ga0157374_100306018 | 169 |
| 367 | 3300013307 | Ga0157372_10021012 | Ga0157372_100210128 | 169 |
| 368 | 3300013308 | Ga0157375_10071918 | Ga0157375_100719183 | 169 |
| 369 | 3300013308 | Ga0157375_10282617 | Ga0157375_102826172 | 169 |
| 370 | 3300014325 | Ga0163163_10132820 | Ga0163163_101328204 | 169 |
| 371 | 3300014745 | Ga0157377_10000202 | Ga0157377_1000020215 | 169 |
| 372 | 3300014968 | Ga0157379_10438288 | Ga0157379_104382882 | 169 |
| 373 | 3300014969 | Ga0157376_10121005 | Ga0157376_101210052 | 169 |
| 374 | 3300017792 | Ga0163161_10142522 | Ga0163161_101425222 | 169 |
| 375 | 3300025901 | Ga0207688_10004236 | Ga0207688_100042369 | 169 |
| 376 | 3300025903 | Ga0207680_10411618 | Ga0207680_104116182 | 169 |
| 377 | 3300025908 | Ga0207643_10371112 | Ga0207643_103711122 | 169 |
| 378 | 3300025915 | Ga0207693_10008956 | Ga0207693_100089567 | 169 |
| 379 | 3300025915 | Ga0207693_10018190 | Ga0207693_100181908 | 169 |
| 380 | 3300025916 | Ga0207663_10047827 | Ga0207663_100478273 | 169 |
| 381 | 3300025920 | Ga0207649_10000021 | Ga0207649_1000002169 | 169 |
| 382 | 3300025922 | Ga0207646_10252262 | Ga0207646_102522622 | 169 |
| 383 | 3300025926 | Ga0207659_10055358 | Ga0207659_100553584 | 169 |
| 384 | 3300025927 | Ga0207687_10012274 | Ga0207687_100122743 | 169 |
| 385 | 3300025927 | Ga0207687_10020408 | Ga0207687_100204086 | 169 |
| 386 | 3300025932 | Ga0207690_10457079 | Ga0207690_104570792 | 169 |
| 387 | 3300025933 | Ga0207706_10044210 | Ga0207706_100442102 | 169 |
| 388 | 3300025934 | Ga0207686_10373022 | Ga0207686_103730222 | 169 |
| 389 | 3300025935 | Ga0207709_10027029 | Ga0207709_100270295 | 169 |
| 390 | 3300025938 | Ga0207704_10021680 | Ga0207704_100216802 | 169 |
| 391 | 3300025938 | Ga0207704_10487627 | Ga0207704_104876271 | 169 |
| 392 | 3300025939 | Ga0207665_10105338 | Ga0207665_101053384 | 169 |
| 393 | 3300025941 | Ga0207711_10220126 | Ga0207711_102201262 | 169 |
| 394 | 3300025942 | Ga0207689_10007500 | Ga0207689_100075009 | 169 |
| 395 | 3300025944 | Ga0207661_10097221 | Ga0207661_100972213 | 169 |
| 396 | 3300025945 | Ga0207679_10057576 | Ga0207679_100575762 | 169 |
| 397 | 3300025961 | Ga0207712_10184686 | Ga0207712_101846862 | 169 |
| 398 | 3300025961 | Ga0207712_10217501 | Ga0207712_102175012 | 169 |
| 399 | 3300025972 | Ga0207668_10061962 | Ga0207668_100619622 | 169 |
| 400 | 3300025981 | Ga0207640_10411148 | Ga0207640_104111482 | 169 |
| 401 | 3300026023 | Ga0207677_10009775 | Ga0207677_100097755 | 169 |
| 402 | 3300026023 | Ga0207677_10267664 | Ga0207677_102676642 | 169 |
| 403 | 3300026041 | Ga0207639_10266062 | Ga0207639_102660622 | 169 |
| 404 | 3300026067 | Ga0207678_10014936 | Ga0207678_100149368 | 169 |
| 405 | 3300026075 | Ga0207708_10000869 | Ga0207708_1000086910 | 169 |
| 406 | 3300026078 | Ga0207702_10177134 | Ga0207702_101771342 | 169 |
| 407 | 3300026089 | Ga0207648_10482944 | Ga0207648_104829442 | 169 |
| 408 | 3300026116 | Ga0207674_10377087 | Ga0207674_103770872 | 169 |
| 409 | 3300026118 | Ga0207675_100155247 | Ga0207675_1001552472 | 169 |
| 410 | 3300026121 | Ga0207683_10202143 | Ga0207683_102021432 | 169 |
| 411 | 3300026142 | Ga0207698_10398578 | Ga0207698_103985782 | 169 |
| 412 | 3300027907 | Ga0207428_10007412 | Ga0207428_100074127 | 169 |
| 413 | 3300027907 | Ga0207428_10019314 | Ga0207428_100193147 | 169 |
| 414 | 3300028379 | Ga0268266_11149997 | Ga0268266_111499972 | 169 |
| 415 | 3300031901 | Ga0307406_10227359 | Ga0307406_102273592 | 169 |
| 416 | 3300032126 | Ga0307415_101286024 | Ga0307415_1012860241 | 169 |
| 417 | 3300037312 | Ga0395899_0735148 | Ga0395899_0735148_11_559 | 169 |
| 418 | 3300037418 | Ga0395900_0625959 | Ga0395900_0625959_369_917 | 169 |
| 419 | 3300037466 | Ga0395898_0242946 | Ga0395898_0242946_29_574 | 169 |
| 420 | 3300038443 | Ga0395901_0014858 | Ga0395901_0014858_5538_6083 | 169 |
| 421 | 3300041460 | Ga0451802_0700236 | Ga0451802_0700236_35_583 | 169 |
| 422 | 3300045976 | Ga0466967_0094559 | Ga0466967_0094559_948_1493 | 169 |
| 423 | 3300046455 | Ga0495603_0044142 | Ga0495603_0044142_698_1243 | 169 |
| 424 | 3300046461 | Ga0495641_0037143 | Ga0495641_0037143_774_1319 | 169 |
| 425 | 3300046473 | Ga0495582_0038704 | Ga0495582_0038704_605_1150 | 169 |
| 426 | 3300046491 | Ga0495584_0172878 | Ga0495584_0172878_83_604 | 169 |
| 427 | 3300046499 | Ga0495594_0104820 | Ga0495594_0104820_823_1368 | 169 |
| 428 | 3300046514 | Ga0495618_0000004 | Ga0495618_0000004_21909_22418 | 169 |
| 429 | 3300046517 | Ga0495630_0020577 | Ga0495630_0020577_3965_4474 | 169 |
| 430 | 3300046663 | Ga0495635_0000063 | Ga0495635_0000063_46485_46994 | 169 |
| 431 | 3300046683 | Ga0495658_0064364 | Ga0495658_0064364_1364_1909 | 169 |
| 432 | 3300046689 | Ga0495613_0000369 | Ga0495613_0000369_11706_12215 | 169 |
| 433 | 3300046809 | Ga0495600_0002253 | Ga0495600_0002253_6038_6547 | 169 |
| 434 | 3300047317 | Ga0495604_0000033 | Ga0495604_0000033_95553_96062 | 169 |
| 435 | 3300047321 | Ga0495676_0008602 | Ga0495676_0008602_1847_2392 | 169 |
| 436 | 3300047322 | Ga0495680_0309582 | Ga0495680_0309582_172_681 | 169 |
| 437 | 3300048903 | Ga0496100_0330969 | Ga0496100_0330969_360_899 | 169 |
| 438 | 3300048904 | Ga0496101_0039050 | Ga0496101_0039050_1388_1933 | 169 |
| 439 | 3300048904 | Ga0496101_0169979 | Ga0496101_0169979_1058_1597 | 169 |
| 440 | 3300048905 | Ga0496102_0029058 | Ga0496102_0029058_2189_2728 | 169 |
| 441 | 3300048905 | Ga0496102_0045086 | Ga0496102_0045086_3146_3691 | 169 |
| 442 | 3300048906 | Ga0496103_0020698 | Ga0496103_0020698_660_1205 | 169 |
| 443 | 3300048906 | Ga0496103_0487612 | Ga0496103_0487612_31_570 | 169 |
| 444 | 3300048906 | Ga0496103_0552623 | Ga0496103_0552623_185_712 | 169 |
| 445 | 3300048907 | Ga0496104_0007632 | Ga0496104_0007632_5707_6246 | 169 |
| 446 | 3300048907 | Ga0496104_0171027 | Ga0496104_0171027_548_1093 | 169 |
| 447 | 3300048908 | Ga0496105_0047857 | Ga0496105_0047857_965_1510 | 169 |
| 448 | 3300048908 | Ga0496105_0049913 | Ga0496105_0049913_2006_2545 | 169 |
| 449 | 3300048909 | Ga0496106_0012504 | Ga0496106_0012504_2182_2727 | 169 |
| 450 | 3300048909 | Ga0496106_0033927 | Ga0496106_0033927_1554_2093 | 169 |
| 451 | 3300048910 | Ga0496107_0004466 | Ga0496107_0004466_6267_6812 | 169 |
| 452 | 3300048910 | Ga0496107_0027536 | Ga0496107_0027536_2221_2760 | 169 |
| 453 | 3300048911 | Ga0496108_0024788 | Ga0496108_0024788_2767_3312 | 169 |
| 454 | 3300048911 | Ga0496108_0030574 | Ga0496108_0030574_3847_4386 | 169 |
| 455 | 3300048912 | Ga0496109_0055073 | Ga0496109_0055073_1310_1849 | 169 |
| 456 | 3300048912 | Ga0496109_0232746 | Ga0496109_0232746_892_1437 | 169 |
| 457 | 3300048913 | Ga0496110_0071200 | Ga0496110_0071200_437_976 | 169 |
| 458 | 3300048913 | Ga0496110_0192970 | Ga0496110_0192970_1101_1646 | 169 |
| 459 | 3300048914 | Ga0496111_0049802 | Ga0496111_0049802_314_859 | 169 |
| 460 | 3300048915 | Ga0496112_0069733 | Ga0496112_0069733_2658_3203 | 169 |
| 461 | 3300048916 | Ga0496113_0021763 | Ga0496113_0021763_2210_2749 | 169 |
| 462 | 3300048917 | Ga0496114_0076181 | Ga0496114_0076181_1793_2338 | 169 |
| 463 | 3300048918 | Ga0496115_0010437 | Ga0496115_0010437_4035_4580 | 169 |
| 464 | 3300048919 | Ga0496116_0000383 | Ga0496116_0000383_53534_54049 | 169 |
| 465 | 3300048920 | Ga0496117_0172358 | Ga0496117_0172358_728_1243 | 169 |
| 466 | 3300048922 | Ga0496119_0001491 | Ga0496119_0001491_9622_10137 | 169 |
| 467 | 3300049570 | Ga0501033_0290880 | Ga0501033_0290880_404_946 | 169 |
| 468 | 3300049572 | Ga0501036_0072455 | Ga0501036_0072455_1527_2069 | 169 |
| 469 | 3300049574 | Ga0501038_0074699 | Ga0501038_0074699_461_1003 | 169 |
| 470 | 3300049575 | Ga0501039_0058119 | Ga0501039_0058119_1645_2187 | 169 |
| 471 | 3300049576 | Ga0501040_0403839 | Ga0501040_0403839_165_704 | 169 |
| 472 | 3300049582 | Ga0501048_0014802 | Ga0501048_0014802_1775_2317 | 169 |
| 473 | 3300049584 | Ga0501068_0204358 | Ga0501068_0204358_416_958 | 169 |
| 474 | 3300049586 | Ga0501070_0305179 | Ga0501070_0305179_256_798 | 169 |
| 475 | 3300049588 | Ga0501072_0002808 | Ga0501072_0002808_2909_3451 | 169 |
| 476 | 3300049590 | Ga0501074_0172762 | Ga0501074_0172762_218_760 | 169 |
| 477 | 3300049591 | Ga0501075_0017405 | Ga0501075_0017405_456_998 | 169 |
| 478 | 3300049591 | Ga0501075_0102000 | Ga0501075_0102000_60_569 | 169 |
| 479 | 3300049592 | Ga0501076_0001340 | Ga0501076_0001340_6438_6980 | 169 |
| 480 | 3300049593 | Ga0501077_0157549 | Ga0501077_0157549_281_823 | 169 |
| 481 | 3300049741 | Ga0501079_0072035 | Ga0501079_0072035_269_811 | 169 |
| 482 | 3300049743 | Ga0501081_0003237 | Ga0501081_0003237_5319_5861 | 169 |
| 483 | 3300049822 | Ga0501035_0178443 | Ga0501035_0178443_200_742 | 169 |
| 484 | 3300049824 | Ga0501045_0004663 | Ga0501045_0004663_6729_7271 | 169 |
| 485 | 3300050491 | nmdc:mga00v17_25864_c1 | nmdc:mga00v17_25864_c1_1435_1980 | 169 |
| 486 | 3300050492 | nmdc:mga0yw44_5034_c1 | nmdc:mga0yw44_5034_c1_1489_2034 | 169 |
| 487 | 3300050492 | nmdc:mga0yw44_5381_c1 | nmdc:mga0yw44_5381_c1_4975_5520 | 169 |
| 488 | 3300050507 | nmdc:mga05p37_1191423_c1 | nmdc:mga05p37_1191423_c1_167_724 | 169 |
| 489 | 3300050507 | nmdc:mga05p37_22454_c1 | nmdc:mga05p37_22454_c1_5751_6311 | 169 |
| 490 | 3300050507 | nmdc:mga05p37_805080_c1 | nmdc:mga05p37_805080_c1_155_700 | 169 |
| 491 | 3300050507 | nmdc:mga05p37_84577_c1 | nmdc:mga05p37_84577_c1_2481_3062 | 169 |
| 492 | 3300050509 | nmdc:mga0qj67_324025_c1 | nmdc:mga0qj67_324025_c1_651_1196 | 169 |
| 493 | 3300050509 | nmdc:mga0qj67_537711_c1 | nmdc:mga0qj67_537711_c1_98_643 | 169 |
| 494 | 3300050510 | nmdc:mga06r32_14654_c1 | nmdc:mga06r32_14654_c1_6329_6874 | 169 |
| 495 | 3300050510 | nmdc:mga06r32_1531_c1 | nmdc:mga06r32_1531_c1_8140_8700 | 169 |
| 496 | 3300050510 | nmdc:mga06r32_19865_c1 | nmdc:mga06r32_19865_c1_1785_2324 | 169 |
| 497 | 3300050511 | nmdc:mga08y16_27817_c1 | nmdc:mga08y16_27817_c1_4298_4837 | 169 |
| 498 | 3300050511 | nmdc:mga08y16_35398_c1 | nmdc:mga08y16_35398_c1_3301_3861 | 169 |
| 499 | 3300050512 | nmdc:mga0n895_312579_c1 | nmdc:mga0n895_312579_c1_485_1024 | 169 |
| 500 | 3300050512 | nmdc:mga0n895_810759_c1 | nmdc:mga0n895_810759_c1_104_649 | 169 |
| 501 | 3300050512 | nmdc:mga0n895_87069_c1 | nmdc:mga0n895_87069_c1_1650_2189 | 169 |
| 502 | 3300050513 | nmdc:mga0rr50_58397_c1 | nmdc:mga0rr50_58397_c1_2197_2736 | 169 |
| 503 | 3300050515 | nmdc:mga0a205_84873_c1 | nmdc:mga0a205_84873_c1_1095_1634 | 169 |
| 504 | 3300053119 | Ga0500595_044764 | Ga0500595_044764_427_942 | 169 |
| 505 | 3300054114 | Ga0501084_0002620 | Ga0501084_0002620_9577_10119 | 169 |
| 506 | 3300054114 | Ga0501084_1004241 | Ga0501084_1004241_94_636 | 169 |
| 507 | 3300060353 | Ga0501082_0001162 | Ga0501082_0001162_9992_10534 | 169 |
| 508 | 3300061734 | Ga0530510_0002230 | Ga0530510_0002230_1691_2233 | 169 |
| 509 | 3300005331 | Ga0070670_100661160 | Ga0070670_1006611602 | 170 |
| 510 | 3300005841 | Ga0068863_100000042 | Ga0068863_10000004273 | 170 |
| 511 | 3300044694 | Ga0466963_0000034 | Ga0466963_0000034_9054_9566 | 170 |
| 512 | 3300046515 | Ga0495620_0000388 | Ga0495620_0000388_7274_7786 | 170 |
| 513 | 3300046523 | Ga0495644_0003763 | Ga0495644_0003763_1460_1972 | 170 |
| 514 | 3300046535 | Ga0495586_0004988 | Ga0495586_0004988_863_1375 | 170 |
| 515 | 3300046543 | Ga0495645_0004732 | Ga0495645_0004732_7305_7817 | 170 |
| 516 | 3300046690 | Ga0495624_0003530 | Ga0495624_0003530_7918_8430 | 170 |
| 517 | 3300048088 | Ga0495602_0707031 | Ga0495602_0707031_29_541 | 170 |
| 518 | 3300001979 | JGI24740J21852_10000392 | JGI24740J21852_1000039218 | 171 |
| 519 | 3300005329 | Ga0070683_100218918 | Ga0070683_1002189182 | 171 |
| 520 | 3300005341 | Ga0070691_10000124 | Ga0070691_100001248 | 171 |
| 521 | 3300005347 | Ga0070668_100065392 | Ga0070668_1000653924 | 171 |
| 522 | 3300005354 | Ga0070675_100000187 | Ga0070675_10000018718 | 171 |
| 523 | 3300005437 | Ga0070710_10321379 | Ga0070710_103213792 | 171 |
| 524 | 3300005455 | Ga0070663_100000698 | Ga0070663_1000006985 | 171 |
| 525 | 3300005455 | Ga0070663_100459301 | Ga0070663_1004593012 | 171 |
| 526 | 3300005455 | Ga0070663_101416483 | Ga0070663_1014164831 | 171 |
| 527 | 3300005466 | Ga0070685_10002681 | Ga0070685_100026816 | 171 |
| 528 | 3300005530 | Ga0070679_100006106 | Ga0070679_1000061065 | 171 |
| 529 | 3300005578 | Ga0068854_100005403 | Ga0068854_1000054037 | 171 |
| 530 | 3300005614 | Ga0068856_100005550 | Ga0068856_1000055509 | 171 |
| 531 | 3300005617 | Ga0068859_100703707 | Ga0068859_1007037072 | 171 |
| 532 | 3300005834 | Ga0068851_10022018 | Ga0068851_100220184 | 171 |
| 533 | 3300005840 | Ga0068870_10102758 | Ga0068870_101027583 | 171 |
| 534 | 3300005841 | Ga0068863_100282913 | Ga0068863_1002829131 | 171 |
| 535 | 3300005985 | Ga0081539_10003805 | Ga0081539_1000380515 | 171 |
| 536 | 3300006358 | Ga0068871_100544773 | Ga0068871_1005447732 | 171 |
| 537 | 3300006881 | Ga0068865_101299922 | Ga0068865_1012999222 | 171 |
| 538 | 3300006931 | Ga0097620_100703675 | Ga0097620_1007036751 | 171 |
| 539 | 3300009098 | Ga0105245_10000425 | Ga0105245_1000042513 | 171 |
| 540 | 3300009148 | Ga0105243_10479133 | Ga0105243_104791332 | 171 |
| 541 | 3300009176 | Ga0105242_10000975 | Ga0105242_1000097517 | 171 |
| 542 | 3300009553 | Ga0105249_10000085 | Ga0105249_1000008557 | 171 |
| 543 | 3300013296 | Ga0157374_10008161 | Ga0157374_100081618 | 171 |
| 544 | 3300013297 | Ga0157378_10009908 | Ga0157378_100099088 | 171 |
| 545 | 3300013297 | Ga0157378_10144750 | Ga0157378_101447503 | 171 |
| 546 | 3300014326 | Ga0157380_10000017 | Ga0157380_1000001723 | 171 |
| 547 | 3300014968 | Ga0157379_10002830 | Ga0157379_1000283013 | 171 |
| 548 | 3300014968 | Ga0157379_10120078 | Ga0157379_101200782 | 171 |
| 549 | 3300025893 | Ga0207682_10000457 | Ga0207682_1000045711 | 171 |
| 550 | 3300025898 | Ga0207692_10419080 | Ga0207692_104190802 | 171 |
| 551 | 3300025908 | Ga0207643_10045902 | Ga0207643_100459022 | 171 |
| 552 | 3300025921 | Ga0207652_10008471 | Ga0207652_100084715 | 171 |
| 553 | 3300025926 | Ga0207659_10000074 | Ga0207659_1000007429 | 171 |
| 554 | 3300025927 | Ga0207687_10000021 | Ga0207687_10000021191 | 171 |
| 555 | 3300025934 | Ga0207686_10000418 | Ga0207686_1000041820 | 171 |
| 556 | 3300025935 | Ga0207709_10562161 | Ga0207709_105621612 | 171 |
| 557 | 3300025938 | Ga0207704_10896565 | Ga0207704_108965652 | 171 |
| 558 | 3300025961 | Ga0207712_10000033 | Ga0207712_1000003365 | 171 |
| 559 | 3300025972 | Ga0207668_10062042 | Ga0207668_100620422 | 171 |
| 560 | 3300025981 | Ga0207640_10023696 | Ga0207640_100236964 | 171 |
| 561 | 3300026067 | Ga0207678_10008262 | Ga0207678_100082625 | 171 |
| 562 | 3300026078 | Ga0207702_10001072 | Ga0207702_1000107214 | 171 |
| 563 | 3300026088 | Ga0207641_10973440 | Ga0207641_109734402 | 171 |
| 564 | 3300028379 | Ga0268266_10476464 | Ga0268266_104764642 | 171 |
| 565 | 3300035172 | Ga0373955_0197218 | Ga0373955_0197218_48_563 | 171 |
| 566 | 3300044694 | Ga0466963_0150559 | Ga0466963_0150559_1067_1585 | 171 |
| 567 | 3300045976 | Ga0466967_0000007 | Ga0466967_0000007_12633_13148 | 171 |
| 568 | 3300045976 | Ga0466967_0355069 | Ga0466967_0355069_288_806 | 171 |
| 569 | 3300046454 | Ga0495592_0404695 | Ga0495592_0404695_94_609 | 171 |
| 570 | 3300046459 | Ga0495629_0000746 | Ga0495629_0000746_16785_17300 | 171 |
| 571 | 3300046459 | Ga0495629_0110986 | Ga0495629_0110986_863_1378 | 171 |
| 572 | 3300046461 | Ga0495641_0061685 | Ga0495641_0061685_627_1142 | 171 |
| 573 | 3300046461 | Ga0495641_0115829 | Ga0495641_0115829_325_840 | 171 |
| 574 | 3300046507 | Ga0495606_0000131 | Ga0495606_0000131_37427_37942 | 171 |
| 575 | 3300046516 | Ga0495628_0295102 | Ga0495628_0295102_643_1167 | 171 |
| 576 | 3300046517 | Ga0495630_0000168 | Ga0495630_0000168_14268_14792 | 171 |
| 577 | 3300046517 | Ga0495630_0000416 | Ga0495630_0000416_24886_25401 | 171 |
| 578 | 3300046517 | Ga0495630_0414810 | Ga0495630_0414810_389_913 | 171 |
| 579 | 3300046642 | Ga0495634_0013021 | Ga0495634_0013021_403_921 | 171 |
| 580 | 3300046642 | Ga0495634_0666406 | Ga0495634_0666406_12_527 | 171 |
| 581 | 3300046660 | Ga0495625_0000204 | Ga0495625_0000204_10494_11012 | 171 |
| 582 | 3300046663 | Ga0495635_0040045 | Ga0495635_0040045_2621_3145 | 171 |
| 583 | 3300046675 | Ga0495657_0068360 | Ga0495657_0068360_745_1269 | 171 |
| 584 | 3300046683 | Ga0495658_0317603 | Ga0495658_0317603_260_784 | 171 |
| 585 | 3300046684 | Ga0495669_0000169 | Ga0495669_0000169_11323_11841 | 171 |
| 586 | 3300046690 | Ga0495624_0000305 | Ga0495624_0000305_844_1359 | 171 |
| 587 | 3300046694 | Ga0495649_0001488 | Ga0495649_0001488_2595_3110 | 171 |
| 588 | 3300047317 | Ga0495604_0444852 | Ga0495604_0444852_122_637 | 171 |
| 589 | 3300047444 | Ga0495675_0029691 | Ga0495675_0029691_2615_3130 | 171 |
| 590 | 3300048903 | Ga0496100_0000003 | Ga0496100_0000003_153151_153666 | 171 |
| 591 | 3300048904 | Ga0496101_0000003 | Ga0496101_0000003_153151_153666 | 171 |
| 592 | 3300048906 | Ga0496103_0063823 | Ga0496103_0063823_1430_1951 | 171 |
| 593 | 3300048907 | Ga0496104_0000007 | Ga0496104_0000007_338286_338801 | 171 |
| 594 | 3300048907 | Ga0496104_0000066 | Ga0496104_0000066_65617_66132 | 171 |
| 595 | 3300048908 | Ga0496105_0000002 | Ga0496105_0000002_541225_541740 | 171 |
| 596 | 3300048908 | Ga0496105_0000020 | Ga0496105_0000020_115353_115868 | 171 |
| 597 | 3300048908 | Ga0496105_0066557 | Ga0496105_0066557_84_617 | 171 |
| 598 | 3300048909 | Ga0496106_0000015 | Ga0496106_0000015_108911_109426 | 171 |
| 599 | 3300048910 | Ga0496107_0000008 | Ga0496107_0000008_44211_44726 | 171 |
| 600 | 3300048911 | Ga0496108_0000002 | Ga0496108_0000002_25588_26103 | 171 |
| 601 | 3300048912 | Ga0496109_0000001 | Ga0496109_0000001_25550_26065 | 171 |
| 602 | 3300048912 | Ga0496109_0372894 | Ga0496109_0372894_411_926 | 171 |
| 603 | 3300048912 | Ga0496109_0470305 | Ga0496109_0470305_83_616 | 171 |
| 604 | 3300048914 | Ga0496111_0140244 | Ga0496111_0140244_1095_1610 | 171 |
| 605 | 3300048917 | Ga0496114_0105636 | Ga0496114_0105636_1139_1654 | 171 |
| 606 | 3300048920 | Ga0496117_0006252 | Ga0496117_0006252_3315_3836 | 171 |
| 607 | 3300048920 | Ga0496117_0251798 | Ga0496117_0251798_430_948 | 171 |
| 608 | 3300048921 | Ga0496118_0000151 | Ga0496118_0000151_105891_106412 | 171 |
| 609 | 3300048922 | Ga0496119_0020645 | Ga0496119_0020645_2837_3358 | 171 |
| 610 | 3300048922 | Ga0496119_0191967 | Ga0496119_0191967_123_644 | 171 |
| 611 | 3300048923 | Ga0496120_0031801 | Ga0496120_0031801_573_1094 | 171 |
| 612 | 3300048927 | Ga0496124_0370730 | Ga0496124_0370730_238_759 | 171 |
| 613 | 3300048928 | Ga0496125_0023449 | Ga0496125_0023449_455_976 | 171 |
| 614 | 3300048929 | Ga0496126_0041631 | Ga0496126_0041631_977_1492 | 171 |
| 615 | 3300048929 | Ga0496126_0101084 | Ga0496126_0101084_1162_1677 | 171 |
| 616 | 3300049579 | Ga0501043_0441120 | Ga0501043_0441120_335_850 | 171 |
| 617 | 3300049581 | Ga0501047_0006642 | Ga0501047_0006642_3414_3929 | 171 |
| 618 | 3300049581 | Ga0501047_0047086 | Ga0501047_0047086_1223_1738 | 171 |
| 619 | 3300049581 | Ga0501047_0081451 | Ga0501047_0081451_37_558 | 171 |
| 620 | 3300049585 | Ga0501069_0064796 | Ga0501069_0064796_1288_1803 | 171 |
| 621 | 3300049585 | Ga0501069_0435247 | Ga0501069_0435247_35_550 | 171 |
| 622 | 3300049586 | Ga0501070_0007643 | Ga0501070_0007643_8358_8879 | 171 |
| 623 | 3300049586 | Ga0501070_0217273 | Ga0501070_0217273_956_1471 | 171 |
| 624 | 3300049586 | Ga0501070_0237462 | Ga0501070_0237462_740_1255 | 171 |
| 625 | 3300049586 | Ga0501070_0624377 | Ga0501070_0624377_292_807 | 171 |
| 626 | 3300049586 | Ga0501070_0751237 | Ga0501070_0751237_35_550 | 171 |
| 627 | 3300049590 | Ga0501074_0016615 | Ga0501074_0016615_2252_2767 | 171 |
| 628 | 3300049741 | Ga0501079_0032683 | Ga0501079_0032683_2545_3060 | 171 |
| 629 | 3300049742 | Ga0501080_0156454 | Ga0501080_0156454_941_1456 | 171 |
| 630 | 3300049744 | Ga0501083_0229773 | Ga0501083_0229773_49_564 | 171 |
| 631 | 3300049822 | Ga0501035_0399070 | Ga0501035_0399070_39_554 | 171 |
| 632 | 3300053077 | Ga0495601_0003622 | Ga0495601_0003622_4063_4578 | 171 |
| 633 | 3300053077 | Ga0495601_0024330 | Ga0495601_0024330_2297_2821 | 171 |
| 634 | 3300053077 | Ga0495601_0034664 | Ga0495601_0034664_156_689 | 171 |
| 635 | 3300053078 | Ga0495612_0001969 | Ga0495612_0001969_7162_7677 | 171 |
| 636 | 3300053078 | Ga0495612_0037600 | Ga0495612_0037600_1240_1755 | 171 |
| 637 | 3300053084 | Ga0495595_0149252 | Ga0495595_0149252_26_550 | 171 |
| 638 | 3300053085 | Ga0495619_0000285 | Ga0495619_0000285_16073_16597 | 171 |
| 639 | 3300053085 | Ga0495619_0029750 | Ga0495619_0029750_2980_3504 | 171 |
| 640 | 3300053119 | Ga0500595_060733 | Ga0500595_060733_591_1106 | 171 |
| 641 | 3300005329 | Ga0070683_100166626 | Ga0070683_1001666262 | 172 |
| 642 | 3300005347 | Ga0070668_100019444 | Ga0070668_1000194444 | 172 |
| 643 | 3300005367 | Ga0070667_100000374 | Ga0070667_10000037412 | 172 |
| 644 | 3300005535 | Ga0070684_100902870 | Ga0070684_1009028701 | 172 |
| 645 | 3300005564 | Ga0070664_100579871 | Ga0070664_1005798712 | 172 |
| 646 | 3300005577 | Ga0068857_100633759 | Ga0068857_1006337592 | 172 |
| 647 | 3300005842 | Ga0068858_100119035 | Ga0068858_1001190352 | 172 |
| 648 | 3300005843 | Ga0068860_100100342 | Ga0068860_1001003422 | 172 |
| 649 | 3300005844 | Ga0068862_100000278 | Ga0068862_10000027815 | 172 |
| 650 | 3300005937 | Ga0081455_10008890 | Ga0081455_100088904 | 172 |
| 651 | 3300009553 | Ga0105249_10004260 | Ga0105249_100042608 | 172 |
| 652 | 3300010375 | Ga0105239_11644988 | Ga0105239_116449882 | 172 |
| 653 | 3300014325 | Ga0163163_10383221 | Ga0163163_103832212 | 172 |
| 654 | 3300014968 | Ga0157379_10106090 | Ga0157379_101060903 | 172 |
| 655 | 3300025945 | Ga0207679_10544814 | Ga0207679_105448141 | 172 |
| 656 | 3300025961 | Ga0207712_10002885 | Ga0207712_100028858 | 172 |
| 657 | 3300025972 | Ga0207668_10014146 | Ga0207668_100141462 | 172 |
| 658 | 3300025986 | Ga0207658_10001722 | Ga0207658_1000172215 | 172 |
| 659 | 3300026035 | Ga0207703_10169181 | Ga0207703_101691812 | 172 |
| 660 | 3300026116 | Ga0207674_11358656 | Ga0207674_113586562 | 172 |
| 661 | 3300028380 | Ga0268265_10012654 | Ga0268265_100126542 | 172 |
| 662 | 3300028381 | Ga0268264_10073004 | Ga0268264_100730042 | 172 |
| 663 | 3300028381 | Ga0268264_10967225 | Ga0268264_109672252 | 172 |
| 664 | 3300046660 | Ga0495625_0321034 | Ga0495625_0321034_95_619 | 172 |
| 665 | 3300048912 | Ga0496109_0368335 | Ga0496109_0368335_550_1080 | 172 |
| 666 | 3300048913 | Ga0496110_0746208 | Ga0496110_0746208_150_674 | 172 |
| 667 | 3300048914 | Ga0496111_0051254 | Ga0496111_0051254_784_1314 | 172 |
| 668 | 3300048915 | Ga0496112_0565644 | Ga0496112_0565644_109_639 | 172 |
| 669 | 3300001977 | JGI24746J21847_1001937 | JGI24746J21847_10019371 | 173 |
| 670 | 3300047319 | Ga0495674_0334653 | Ga0495674_0334653_280_813 | 173 |
| 671 | 3300053077 | Ga0495601_0158880 | Ga0495601_0158880_719_1252 | 173 |
| 672 | 3300053078 | Ga0495612_0000198 | Ga0495612_0000198_3031_3564 | 173 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4f7g-assembly1.cif.gz_B | crystal structure of talin autoinhibition complex | 0.3596 | 1 | 141 |
| 8dl6-assembly1.cif.gz_A | cryo-em structure of human ferroportin/slc40 bound to ca2+ in nanodisc | 0.3365 | 4 | 141 |
| 7tao-assembly1.cif.gz_C | cryo-em structure of bafilomycin a1 bound to yeast vo v-atpase | 0.3247 | 1 | 131 |
| 8eas-assembly1.cif.gz_h | yeast vo in complex with vma12-22p | 0.3127 | 4 | 139 |
| 7uzh-assembly1.cif.gz_m | rat kidney v-atpase with sidk, state 2 | 0.3075 | 4 | 138 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D6KZ31_3_135_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.5057 | 6 | 139 | 1.20.1250.20 |
| af_I1KNR1_88_323_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.5057 | 2 | 138 | 1.20.1250.20 |
| af_A0A1D6KZ31_3_135_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.4729 | 6 | 139 | 1.20.1250.20 |
| af_P56557_4_157_1.20.140.150 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; | 0.4379 | 1 | 132 | 1.20.140.150 |
| af_A0A0R0HQM5_173_409_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.4368 | 4 | 131 | 1.20.1250.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A640Y0V4-F1-model_v4 | Uncharacterized protein | 0.9814 | 1 | 164 |
GO:0016020
|
| AF-A0A7V9ADJ7-F1-model_v4 | MFS transporter | 0.9583 | 1 | 150 |
GO:0016020
|
| AF-A0A7V9ADJ7-F1-model_v4 | MFS transporter | 0.9522 | 1 | 150 |
GO:0016020
|
| AF-A0A1Q3NKS2-F1-model_v4 | deleted | 0.9473 | 1 | 165 |
|
| AF-A0A7W0TJ08-F1-model_v4 | Isoprenylcysteine carboxylmethyltransferase family protein | 0.9307 | 1 | 165 |
GO:0016020
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar