F474111

General Info

Members Datasets Scaffolds Average Seq Length
670 237 670 122

Family's Representative Sequence

Representative Sequence 3300048915|Ga0496112_0515617|Ga0496112_0515617_663_1091
Length 142
Sequence VDVVEYPAKSIGGVQCVFNEMNAKIHHVNITVPKSLEDAAKHFYGVVMGLEEVPKPEDSRGRGGAWYQLGPLQLHLSIENPVGENCISKRHVCYTVSDLAQAEERFRNAGVEIIPDDLPTPGWSRFYVRDPGGNRLEIAQAV

Samples

Sample ID Description Type Environment
1 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
81 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
107 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
159 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
162 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
163 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
164 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
165 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
166 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
167 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
168 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
169 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
170 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
171 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
172 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
173 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
174 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
175 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
176 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
177 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
178 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
179 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
180 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
181 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
182 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
183 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
184 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
185 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
186 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
187 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
188 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
189 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
190 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
191 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
192 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
193 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
194 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
195 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
196 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
197 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
198 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
199 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
200 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
201 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
202 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
203 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
205 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
206 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
207 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
208 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
209 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
210 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
211 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
212 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
213 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
214 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
215 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
216 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
217 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
218 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
219 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
220 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
221 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
222 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
223 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
224 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
225 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
226 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
227 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
228 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
229 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
230 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
231 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
232 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
233 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
234 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
235 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
236 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
237 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.84
Rhizosphere 96.87
Stem 0
Stem Tuber 0
Unclassified 0.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNAas_1000820 3300000532 Unclassified 2956
2 JGI24751J29686_10000101 3300002459 Bacteria 47517
3 rootL2_10112742 3300003322 Bacteria 1499
4 Ga0065714_10064522 3300005288 Bacteria 42339
5 Ga0065704_10658195 3300005289 Bacteria 579
6 Ga0065712_10000141 3300005290 Bacteria 57657
7 Ga0065712_10111906 3300005290 Bacteria 1809
8 Ga0065715_10002355 3300005293 Bacteria 6897
9 Ga0065715_10016019 3300005293 Bacteria 2832
10 Ga0065715_10034425 3300005293 Unclassified 1151
11 Ga0065715_10091022 3300005293 Bacteria 6202
12 Ga0065715_10127638 3300005293 Bacteria 2082
13 Ga0065715_10306252 3300005293 Bacteria 1030
14 Ga0065715_10332792 3300005293 Unclassified 961
15 Ga0065715_10451710 3300005293 Bacteria 803
16 Ga0065715_10651856 3300005293 Unclassified 678
17 Ga0065715_10819574 3300005293 Unclassified 594
18 Ga0065715_10960023 3300005293 Unclassified 556
19 Ga0065707_10021463 3300005295 Bacteria 1266
20 Ga0065707_10097033 3300005295 Bacteria 3207
21 Ga0065707_10154189 3300005295 Bacteria 1626
22 Ga0065707_10319752 3300005295 Bacteria 913
23 Ga0065707_10346491 3300005295 Bacteria 925
24 Ga0065707_11071872 3300005295 Bacteria 522
25 Ga0070676_10711942 3300005328 Unclassified 734
26 Ga0070676_11044825 3300005328 Unclassified 615
27 Ga0070683_100217404 3300005329 Bacteria 1816
28 Ga0070690_100776708 3300005330 Bacteria 741
29 Ga0070670_100000475 3300005331 Bacteria 32303
30 Ga0070670_100043591 3300005331 Bacteria 3856
31 Ga0070670_100106899 3300005331 Bacteria 2411
32 Ga0070670_100156139 3300005331 Bacteria 1976
33 Ga0070670_100519588 3300005331 Unclassified 1060
34 Ga0070670_100703186 3300005331 Unclassified 909
35 Ga0070670_100758658 3300005331 Bacteria 875
36 Ga0068869_100050373 3300005334 Bacteria 3018
37 Ga0068869_100085910 3300005334 Bacteria 2357
38 Ga0068869_100125983 3300005334 Bacteria 1964
39 Ga0068869_100192992 3300005334 Bacteria 1602
40 Ga0068869_100215780 3300005334 Bacteria 1519
41 Ga0068869_100302857 3300005334 Bacteria 1291
42 Ga0068869_101108666 3300005334 Unclassified 693
43 Ga0068869_101470142 3300005334 Bacteria 604
44 Ga0070680_100058911 3300005336 Bacteria 3141
45 Ga0070682_100006343 3300005337 Bacteria 6639
46 Ga0070682_100107073 3300005337 Bacteria 1856
47 Ga0068868_100218084 3300005338 Bacteria 1596
48 Ga0070660_100169414 3300005339 Bacteria 1763
49 Ga0070689_100022847 3300005340 Bacteria 4675
50 Ga0070689_100595295 3300005340 Bacteria 957
51 Ga0070689_101031655 3300005340 Unclassified 733
52 Ga0070689_101113840 3300005340 Unclassified 706
53 Ga0070689_101562495 3300005340 Unclassified 598
54 Ga0070687_100094232 3300005343 Bacteria 1663
55 Ga0070687_100173675 3300005343 Bacteria 1285
56 Ga0070687_100707606 3300005343 Unclassified 704
57 Ga0070661_100108210 3300005344 Bacteria 2074
58 Ga0070661_100419841 3300005344 Bacteria 1060
59 Ga0070692_10002398 3300005345 Bacteria 7259
60 Ga0070692_10052746 3300005345 Bacteria 2119
61 Ga0070692_10101340 3300005345 Bacteria 1579
62 Ga0070692_10326338 3300005345 Bacteria 946
63 Ga0070669_100282450 3300005353 Bacteria 1330
64 Ga0070669_100338258 3300005353 Unclassified 1219
65 Ga0070675_100494554 3300005354 Bacteria 1101
66 Ga0070675_101301953 3300005354 Unclassified 670
67 Ga0070675_101828585 3300005354 Unclassified 560
68 Ga0070671_100752360 3300005355 Bacteria 847
69 Ga0070674_100161611 3300005356 Bacteria 1700
70 Ga0070673_100034472 3300005364 Bacteria 3831
71 Ga0070673_100099071 3300005364 Bacteria 2397
72 Ga0070673_100810904 3300005364 Unclassified 865
73 Ga0070688_100597056 3300005365 Unclassified 844
74 Ga0070688_100927297 3300005365 Unclassified 688
75 Ga0070659_100000911 3300005366 Bacteria 21621
76 Ga0070659_100087826 3300005366 Unclassified 2490
77 Ga0070659_100915422 3300005366 Unclassified 767
78 Ga0070703_10001572 3300005406 Bacteria 6800
79 Ga0070703_10270434 3300005406 Unclassified 697
80 Ga0070701_10233041 3300005438 Bacteria 1104
81 Ga0070701_10614911 3300005438 Unclassified 721
82 Ga0070701_10860115 3300005438 Unclassified 623
83 Ga0070705_100052214 3300005440 Bacteria 2387
84 Ga0070705_101338611 3300005440 Unclassified 595
85 Ga0070700_100000123 3300005441 Bacteria 47619
86 Ga0070700_100011786 3300005441 Bacteria 4852
87 Ga0070700_100347720 3300005441 Unclassified 1098
88 Ga0070694_100007732 3300005444 Bacteria 6559
89 Ga0070694_100009290 3300005444 Bacteria 6034
90 Ga0070694_100038672 3300005444 Bacteria 3171
91 Ga0070694_100116574 3300005444 Bacteria 1910
92 Ga0070694_100447880 3300005444 Bacteria 1019
93 Ga0070694_100564578 3300005444 Bacteria 913
94 Ga0070694_100582609 3300005444 Bacteria 899
95 Ga0070694_100843083 3300005444 Unclassified 754
96 Ga0070708_100143759 3300005445 Bacteria 2214
97 Ga0070663_100328255 3300005455 Bacteria 1232
98 Ga0070662_100185724 3300005457 Bacteria 1641
99 Ga0070662_101717868 3300005457 Bacteria 542
100 Ga0070681_10000285 3300005458 Bacteria 40740
101 Ga0070681_10001668 3300005458 Bacteria 19805
102 Ga0070681_10004771 3300005458 Bacteria 12991
103 Ga0070681_10850046 3300005458 Bacteria 830
104 Ga0068867_100541932 3300005459 Unclassified 1006
105 Ga0070706_100000998 3300005467 Bacteria 30735
106 Ga0070706_100010344 3300005467 Bacteria 8667
107 Ga0070707_100000452 3300005468 Bacteria 40667
108 Ga0070707_100012015 3300005468 Bacteria 8082
109 Ga0070707_100251053 3300005468 Bacteria 1722
110 Ga0070698_100011196 3300005471 Bacteria 9531
111 Ga0070698_100067210 3300005471 Bacteria 3605
112 Ga0070698_100323623 3300005471 Bacteria 1473
113 Ga0070698_101775942 3300005471 Unclassified 569
114 Ga0070699_100000440 3300005518 Bacteria 39933
115 Ga0070699_100002112 3300005518 Bacteria 18025
116 Ga0070699_100148029 3300005518 Bacteria 2075
117 Ga0070699_100247135 3300005518 Bacteria 1593
118 Ga0070699_100292372 3300005518 Bacteria 1461
119 Ga0070699_100382353 3300005518 Bacteria 1271
120 Ga0070699_100664757 3300005518 Unclassified 951
121 Ga0070699_101497300 3300005518 Unclassified 619
122 Ga0070679_100000348 3300005530 Bacteria 39245
123 Ga0070679_100025802 3300005530 Bacteria 5767
124 Ga0070679_100457384 3300005530 Bacteria 1221
125 Ga0070697_100001682 3300005536 Bacteria 16890
126 Ga0070697_100089148 3300005536 Bacteria 2548
127 Ga0070697_100143354 3300005536 Bacteria 2010
128 Ga0070697_100688230 3300005536 Bacteria 902
129 Ga0070697_101557561 3300005536 Unclassified 591
130 Ga0070697_101796058 3300005536 Unclassified 548
131 Ga0068853_100004711 3300005539 Bacteria 10587
132 Ga0068853_100016076 3300005539 Bacteria 6155
133 Ga0068853_100715209 3300005539 Unclassified 956
134 Ga0068853_101412181 3300005539 Bacteria 673
135 Ga0070672_100567005 3300005543 Unclassified 987
136 Ga0070686_100022421 3300005544 Bacteria 3761
137 Ga0070695_100052711 3300005545 Bacteria 2615
138 Ga0070695_100338782 3300005545 Unclassified 1123
139 Ga0070695_101039125 3300005545 Bacteria 668
140 Ga0070696_100011189 3300005546 Bacteria 6005
141 Ga0070696_100275971 3300005546 Bacteria 1280
142 Ga0070696_100797318 3300005546 Unclassified 777
143 Ga0070696_101009132 3300005546 Bacteria 696
144 Ga0070693_100001087 3300005547 Bacteria 12187
145 Ga0070693_100095678 3300005547 Bacteria 1799
146 Ga0070693_100721699 3300005547 Unclassified 732
147 Ga0070693_101621598 3300005547 Unclassified 509
148 Ga0070704_100007720 3300005549 Bacteria 6413
149 Ga0070704_100504089 3300005549 Bacteria 1051
150 Ga0070704_100664130 3300005549 Unclassified 921
151 Ga0068855_100707764 3300005563 Bacteria 1077
152 Ga0070664_100001827 3300005564 Bacteria 17039
153 Ga0070664_100050933 3300005564 Bacteria 3505
154 Ga0070664_100244170 3300005564 Bacteria 1612
155 Ga0070664_100448947 3300005564 Bacteria 1184
156 Ga0070664_102356107 3300005564 Unclassified 505
157 Ga0068857_100001397 3300005577 Bacteria 19057
158 Ga0068857_100222149 3300005577 Bacteria 1726
159 Ga0068857_100273836 3300005577 Bacteria 1552
160 Ga0068857_100404449 3300005577 Bacteria 1271
161 Ga0068857_100467626 3300005577 Bacteria 1181
162 Ga0068857_100790504 3300005577 Unclassified 906
163 Ga0068857_101268337 3300005577 Bacteria 715
164 Ga0068857_101706882 3300005577 Unclassified 616
165 Ga0068854_100045048 3300005578 Bacteria 3135
166 Ga0068854_100166422 3300005578 Bacteria 1712
167 Ga0068854_100213665 3300005578 Bacteria 1523
168 Ga0068854_100403891 3300005578 Unclassified 1131
169 Ga0068854_100687219 3300005578 Unclassified 882
170 Ga0068856_100084062 3300005614 Unclassified 3161
171 Ga0070702_100010067 3300005615 Bacteria 4646
172 Ga0070702_100047116 3300005615 Bacteria 2447
173 Ga0070702_100129709 3300005615 Bacteria 1590
174 Ga0070702_100162800 3300005615 Unclassified 1444
175 Ga0070702_100249309 3300005615 Unclassified 1203
176 Ga0070702_100886563 3300005615 Bacteria 697
177 Ga0068852_102410758 3300005616 Unclassified 547
178 Ga0068859_100009209 3300005617 Bacteria 9973
179 Ga0068859_100037923 3300005617 Bacteria 4836
180 Ga0068859_100098139 3300005617 Bacteria 2984
181 Ga0068859_100136315 3300005617 Unclassified 2527
182 Ga0068859_100192228 3300005617 Bacteria 2125
183 Ga0068859_100222227 3300005617 Bacteria 1976
184 Ga0068859_100342820 3300005617 Bacteria 1588
185 Ga0068859_100446307 3300005617 Bacteria 1390
186 Ga0068859_100522093 3300005617 Bacteria 1282
187 Ga0068859_100606423 3300005617 Unclassified 1188
188 Ga0068859_100647243 3300005617 Bacteria 1149
189 Ga0068859_100765395 3300005617 Bacteria 1054
190 Ga0068859_101449483 3300005617 Unclassified 757
191 Ga0068859_101450387 3300005617 Bacteria 757
192 Ga0068859_101537346 3300005617 Unclassified 735
193 Ga0068864_100034755 3300005618 Bacteria 4289
194 Ga0068864_100087390 3300005618 Bacteria 2744
195 Ga0068864_100142795 3300005618 Bacteria 2161
196 Ga0068864_100161378 3300005618 Bacteria 2038
197 Ga0068864_100334778 3300005618 Bacteria 1425
198 Ga0068864_100514009 3300005618 Bacteria 1154
199 Ga0068864_100771211 3300005618 Unclassified 943
200 Ga0068864_100810254 3300005618 Unclassified 921
201 Ga0068864_100994297 3300005618 Bacteria 832
202 Ga0068864_102086743 3300005618 Bacteria 573
203 Ga0068861_100779045 3300005719 Unclassified 896
204 Ga0068861_101992317 3300005719 Unclassified 579
205 Ga0068851_10000589 3300005834 Bacteria 15769
206 Ga0068870_10077638 3300005840 Bacteria 1827
207 Ga0068870_10100569 3300005840 Bacteria 1633
208 Ga0068870_10173215 3300005840 Bacteria 1289
209 Ga0068870_10503433 3300005840 Bacteria 808
210 Ga0068870_10536240 3300005840 Unclassified 786
211 Ga0068870_11299631 3300005840 Unclassified 530
212 Ga0068863_100003484 3300005841 Bacteria 15523
213 Ga0068863_100130663 3300005841 Bacteria 2398
214 Ga0068863_100214776 3300005841 Bacteria 1852
215 Ga0068863_100452943 3300005841 Bacteria 1260
216 Ga0068863_100455727 3300005841 Bacteria 1255
217 Ga0068858_100027685 3300005842 Bacteria 5266
218 Ga0068858_100199259 3300005842 Unclassified 1893
219 Ga0068858_100391856 3300005842 Unclassified 1334
220 Ga0068858_100566653 3300005842 Bacteria 1100
221 Ga0068858_100738750 3300005842 Unclassified 958
222 Ga0068858_100940877 3300005842 Bacteria 846
223 Ga0068858_101295690 3300005842 Unclassified 717
224 Ga0068860_100130990 3300005843 Bacteria 2406
225 Ga0068860_100259981 3300005843 Unclassified 1692
226 Ga0068860_100423216 3300005843 Unclassified 1320
227 Ga0068860_100508157 3300005843 Bacteria 1204
228 Ga0068862_100169536 3300005844 Bacteria 1954
229 Ga0068862_100230906 3300005844 Unclassified 1678
230 Ga0068862_100289594 3300005844 Bacteria 1503
231 Ga0068862_100409096 3300005844 Bacteria 1271
232 Ga0068862_100699868 3300005844 Bacteria 981
233 Ga0068862_100889241 3300005844 Unclassified 875
234 Ga0068862_101563737 3300005844 Bacteria 666
235 Ga0068862_102514807 3300005844 Unclassified 527
236 Ga0081539_10001736 3300005985 Bacteria 34824
237 Ga0097621_100303917 3300006237 Bacteria 1410
238 Ga0068871_100423003 3300006358 Unclassified 1190
239 Ga0068871_100745640 3300006358 Unclassified 900
240 Ga0075428_100040175 3300006844 Bacteria 5149
241 Ga0075428_100929704 3300006844 Unclassified 922
242 Ga0075430_100026096 3300006846 Bacteria 4971
243 Ga0075430_100100527 3300006846 Bacteria 2415
244 Ga0075431_100086819 3300006847 Viruses 3228
245 Ga0075431_100094215 3300006847 Bacteria 3090
246 Ga0075431_100489721 3300006847 Unclassified 1222
247 Ga0075433_10017740 3300006852 Bacteria 5905
248 Ga0075433_10049877 3300006852 Bacteria 3642
249 Ga0075433_10125283 3300006852 Bacteria 2282
250 Ga0075433_10215142 3300006852 Bacteria 1708
251 Ga0075433_10408113 3300006852 Bacteria 1198
252 Ga0075433_10744717 3300006852 Bacteria 857
253 Ga0075433_11842829 3300006852 Bacteria 520
254 Ga0075434_100090367 3300006871 Bacteria 3064
255 Ga0075434_100204958 3300006871 Bacteria 1992
256 Ga0075434_100827817 3300006871 Bacteria 941
257 Ga0075434_100863757 3300006871 Unclassified 920
258 Ga0075429_100027099 3300006880 Bacteria 4974
259 Ga0075429_100324438 3300006880 Unclassified 1347
260 Ga0075436_100207715 3300006914 Unclassified 1388
261 Ga0075436_100333045 3300006914 Bacteria 1092
262 Ga0097620_100009209 3300006931 Bacteria 9973
263 Ga0097620_100037921 3300006931 Bacteria 4836
264 Ga0097620_100098139 3300006931 Bacteria 2984
265 Ga0097620_100136319 3300006931 Unclassified 2527
266 Ga0097620_100192223 3300006931 Bacteria 2125
267 Ga0097620_100222224 3300006931 Bacteria 1976
268 Ga0097620_100342830 3300006931 Bacteria 1588
269 Ga0097620_100446295 3300006931 Bacteria 1390
270 Ga0097620_100522082 3300006931 Bacteria 1282
271 Ga0097620_100606419 3300006931 Unclassified 1188
272 Ga0097620_100647226 3300006931 Bacteria 1149
273 Ga0097620_100765231 3300006931 Bacteria 1054
274 Ga0097620_101449519 3300006931 Unclassified 757
275 Ga0097620_101450818 3300006931 Bacteria 757
276 Ga0097620_101537547 3300006931 Unclassified 735
277 Ga0075435_100204664 3300007076 Bacteria 1673
278 Ga0105251_10143568 3300009011 Bacteria 1080
279 Ga0105244_10267622 3300009036 Unclassified 794
280 Ga0105240_10060053 3300009093 Bacteria 4741
281 Ga0111539_10137924 3300009094 Bacteria 2856
282 Ga0111539_11060744 3300009094 Bacteria 942
283 Ga0105245_11388868 3300009098 Unclassified 752
284 Ga0105245_12101708 3300009098 Bacteria 618
285 Ga0105245_12531042 3300009098 Unclassified 566
286 Ga0105247_10005790 3300009101 Bacteria 7740
287 Ga0105247_10091435 3300009101 Bacteria 1933
288 Ga0105247_10205168 3300009101 Bacteria 1327
289 Ga0105247_10339198 3300009101 Bacteria 1054
290 Ga0105247_10631914 3300009101 Unclassified 798
291 Ga0114129_10044807 3300009147 Bacteria 6222
292 Ga0114129_10071240 3300009147 Bacteria 4847
293 Ga0114129_10121949 3300009147 Bacteria 3587
294 Ga0114129_10178702 3300009147 Bacteria 2889
295 Ga0114129_10212484 3300009147 Bacteria 2615
296 Ga0114129_10413383 3300009147 Bacteria 1776
297 Ga0114129_10481177 3300009147 Bacteria 1624
298 Ga0114129_10658942 3300009147 Bacteria 1350
299 Ga0114129_10883816 3300009147 Unclassified 1134
300 Ga0114129_11052381 3300009147 Bacteria 1022
301 Ga0114129_11301993 3300009147 Bacteria 901
302 Ga0114129_11373546 3300009147 Unclassified 873
303 Ga0114129_12335066 3300009147 Unclassified 641
304 Ga0105243_10051584 3300009148 Bacteria 3254
305 Ga0105243_10114645 3300009148 Bacteria 2261
306 Ga0105243_10777061 3300009148 Bacteria 942
307 Ga0105243_12165098 3300009148 Unclassified 592
308 Ga0105241_10056018 3300009174 Bacteria 3022
309 Ga0105241_10125645 3300009174 Bacteria 2071
310 Ga0105241_10152074 3300009174 Bacteria 1894
311 Ga0105241_10162803 3300009174 Bacteria 1835
312 Ga0105241_10172507 3300009174 Bacteria 1787
313 Ga0105241_10743539 3300009174 Bacteria 899
314 Ga0105241_11082978 3300009174 Bacteria 754
315 Ga0105241_11143457 3300009174 Bacteria 735
316 Ga0105241_11335947 3300009174 Unclassified 684
317 Ga0105241_11480404 3300009174 Unclassified 653
318 Ga0105241_12103645 3300009174 Unclassified 558
319 Ga0105242_10011193 3300009176 Bacteria 6892
320 Ga0105242_10124083 3300009176 Bacteria 2220
321 Ga0105242_10888184 3300009176 Unclassified 890
322 Ga0105242_11317883 3300009176 Unclassified 746
323 Ga0105242_11607732 3300009176 Unclassified 684
324 Ga0105242_12867771 3300009176 Bacteria 532
325 Ga0105248_10069136 3300009177 Bacteria 3965
326 Ga0105248_10134451 3300009177 Bacteria 2790
327 Ga0105248_10201494 3300009177 Bacteria 2242
328 Ga0105248_10235158 3300009177 Bacteria 2063
329 Ga0105248_11503498 3300009177 Bacteria 762
330 Ga0105248_11842206 3300009177 Unclassified 686
331 Ga0105248_12348213 3300009177 Unclassified 607
332 Ga0105237_10014573 3300009545 Bacteria 8215
333 Ga0105237_10359600 3300009545 Bacteria 1460
334 Ga0105237_12639299 3300009545 Unclassified 513
335 Ga0105238_10017924 3300009551 Bacteria 7199
336 Ga0105238_10789842 3300009551 Bacteria 965
337 Ga0105249_10044076 3300009553 Bacteria 4057
338 Ga0105249_10066893 3300009553 Bacteria 3309
339 Ga0105249_10132631 3300009553 Bacteria 2380
340 Ga0105249_10185268 3300009553 Bacteria 2028
341 Ga0105249_10320253 3300009553 Unclassified 1562
342 Ga0105249_10383775 3300009553 Bacteria 1431
343 Ga0105249_10723168 3300009553 Bacteria 1057
344 Ga0105249_12005203 3300009553 Bacteria 651
345 Ga0105239_10423198 3300010375 Bacteria 1509
346 Ga0105239_12244095 3300010375 Unclassified 635
347 Ga0105239_13596447 3300010375 Unclassified 504
348 Ga0105246_10170606 3300011119 Bacteria 1666
349 Ga0105246_10207728 3300011119 Bacteria 1526
350 Ga0105246_10360069 3300011119 Unclassified 1195
351 Ga0105246_10418723 3300011119 Bacteria 1117
352 Ga0157373_10001816 3300013100 Bacteria 16250
353 Ga0157373_10033103 3300013100 Bacteria 3721
354 Ga0157373_10354989 3300013100 Unclassified 1046
355 Ga0157373_10491603 3300013100 Bacteria 886
356 Ga0157374_10041844 3300013296 Bacteria 4224
357 Ga0157374_11995922 3300013296 Bacteria 606
358 Ga0157378_10248542 3300013297 Unclassified 1702
359 Ga0157378_10411773 3300013297 Bacteria 1334
360 Ga0157378_10582518 3300013297 Unclassified 1128
361 Ga0157378_10974548 3300013297 Bacteria 881
362 Ga0157378_12159566 3300013297 Bacteria 608
363 Ga0163162_10085649 3300013306 Bacteria 3228
364 Ga0163162_10192363 3300013306 Bacteria 2168
365 Ga0163162_10616183 3300013306 Bacteria 1211
366 Ga0157372_10042101 3300013307 Bacteria 5050
367 Ga0157372_11037357 3300013307 Unclassified 949
368 Ga0157372_11374777 3300013307 Unclassified 814
369 Ga0157372_11420328 3300013307 Unclassified 800
370 Ga0157375_10052699 3300013308 Bacteria 4001
371 Ga0157375_10154114 3300013308 Bacteria 2435
372 Ga0157375_10893985 3300013308 Unclassified 1032
373 Ga0157375_11352986 3300013308 Bacteria 838
374 Ga0157375_12818519 3300013308 Unclassified 581
375 Ga0157375_13134379 3300013308 Unclassified 552
376 Ga0163163_10000579 3300014325 Bacteria 32232
377 Ga0163163_10003419 3300014325 Bacteria 13488
378 Ga0163163_10076791 3300014325 Bacteria 3336
379 Ga0163163_10308566 3300014325 Bacteria 1635
380 Ga0163163_10436954 3300014325 Bacteria 1368
381 Ga0163163_10514872 3300014325 Bacteria 1259
382 Ga0163163_11631156 3300014325 Unclassified 706
383 Ga0163163_11786558 3300014325 Bacteria 675
384 Ga0157380_10000349 3300014326 Bacteria 27635
385 Ga0157380_10064921 3300014326 Bacteria 2932
386 Ga0157380_10285760 3300014326 Bacteria 1512
387 Ga0157380_10706303 3300014326 Unclassified 1014
388 Ga0157380_12751604 3300014326 Unclassified 558
389 Ga0157377_10038794 3300014745 Bacteria 2632
390 Ga0157377_10165601 3300014745 Bacteria 1378
391 Ga0157377_10265805 3300014745 Bacteria 1118
392 Ga0157377_10461049 3300014745 Bacteria 880
393 Ga0157379_10408161 3300014968 Bacteria 1249
394 Ga0157379_11078224 3300014968 Unclassified 769
395 Ga0157379_11225945 3300014968 Unclassified 722
396 Ga0182007_10195680 3300015262 Unclassified 705
397 Ga0182007_10365838 3300015262 Bacteria 545
398 Ga0207656_10002824 3300025321 Bacteria 5912
399 Ga0207653_10002183 3300025885 Bacteria 6233
400 Ga0207682_10240422 3300025893 Bacteria 841
401 Ga0207642_10134335 3300025899 Bacteria 1296
402 Ga0207710_10000462 3300025900 Bacteria 26063
403 Ga0207710_10100183 3300025900 Unclassified 1365
404 Ga0207710_10124133 3300025900 Unclassified 1235
405 Ga0207647_10287545 3300025904 Bacteria 938
406 Ga0207645_10658921 3300025907 Unclassified 711
407 Ga0207643_10001491 3300025908 Bacteria 13402
408 Ga0207643_10296049 3300025908 Bacteria 1006
409 Ga0207643_10398853 3300025908 Bacteria 869
410 Ga0207643_10421868 3300025908 Bacteria 846
411 Ga0207684_10000286 3300025910 Bacteria 72634
412 Ga0207684_10071191 3300025910 Bacteria 2955
413 Ga0207654_10198487 3300025911 Unclassified 1319
414 Ga0207654_10297306 3300025911 Bacteria 1097
415 Ga0207707_10005408 3300025912 Bacteria 11167
416 Ga0207671_10004861 3300025914 Bacteria 12643
417 Ga0207671_10063785 3300025914 Bacteria 2738
418 Ga0207660_10303911 3300025917 Bacteria 1271
419 Ga0207660_10937540 3300025917 Unclassified 706
420 Ga0207662_10075960 3300025918 Bacteria 2041
421 Ga0207662_10110381 3300025918 Bacteria 1714
422 Ga0207662_10214098 3300025918 Bacteria 1252
423 Ga0207662_10767592 3300025918 Unclassified 678
424 Ga0207657_10194759 3300025919 Unclassified 1633
425 Ga0207649_10078720 3300025920 Bacteria 2128
426 Ga0207649_10360327 3300025920 Bacteria 1079
427 Ga0207652_10240545 3300025921 Bacteria 1632
428 Ga0207652_10350223 3300025921 Bacteria 1333
429 Ga0207652_11496882 3300025921 Unclassified 579
430 Ga0207646_10000798 3300025922 Bacteria 41005
431 Ga0207646_10020692 3300025922 Bacteria 6093
432 Ga0207681_10151330 3300025923 Bacteria 1739
433 Ga0207681_10173737 3300025923 Bacteria 1635
434 Ga0207694_10017522 3300025924 Bacteria 5415
435 Ga0207650_10000001 3300025925 Bacteria 1545726
436 Ga0207650_10056830 3300025925 Bacteria 2909
437 Ga0207650_10063854 3300025925 Bacteria 2755
438 Ga0207650_10123853 3300025925 Bacteria 2015
439 Ga0207650_10139770 3300025925 Bacteria 1903
440 Ga0207650_10240940 3300025925 Unclassified 1461
441 Ga0207650_10764126 3300025925 Unclassified 818
442 Ga0207659_10397869 3300025926 Unclassified 1151
443 Ga0207659_10887943 3300025926 Bacteria 766
444 Ga0207659_11384882 3300025926 Unclassified 603
445 Ga0207687_10449122 3300025927 Bacteria 1069
446 Ga0207687_10517873 3300025927 Unclassified 997
447 Ga0207690_10012439 3300025932 Bacteria 5090
448 Ga0207706_10418625 3300025933 Bacteria 1161
449 Ga0207686_10033760 3300025934 Bacteria 3056
450 Ga0207709_10016138 3300025935 Bacteria 4149
451 Ga0207670_10081832 3300025936 Bacteria 2261
452 Ga0207670_10344350 3300025936 Bacteria 1179
453 Ga0207704_11456031 3300025938 Unclassified 587
454 Ga0207691_10949511 3300025940 Bacteria 719
455 Ga0207711_10020954 3300025941 Bacteria 5458
456 Ga0207711_10135607 3300025941 Bacteria 2210
457 Ga0207711_10463332 3300025941 Bacteria 1180
458 Ga0207711_11958265 3300025941 Unclassified 529
459 Ga0207689_10041430 3300025942 Bacteria 3811
460 Ga0207689_10065895 3300025942 Bacteria 2979
461 Ga0207689_10270363 3300025942 Bacteria 1407
462 Ga0207689_10431196 3300025942 Bacteria 1101
463 Ga0207689_10736311 3300025942 Bacteria 832
464 Ga0207689_11107869 3300025942 Bacteria 667
465 Ga0207661_10387287 3300025944 Bacteria 1266
466 Ga0207679_10018390 3300025945 Bacteria 4681
467 Ga0207679_10072805 3300025945 Bacteria 2597
468 Ga0207679_10224085 3300025945 Bacteria 1583
469 Ga0207679_11019338 3300025945 Bacteria 759
470 Ga0207667_10507030 3300025949 Bacteria 1223
471 Ga0207667_11397057 3300025949 Unclassified 674
472 Ga0207651_10449190 3300025960 Unclassified 1106
473 Ga0207651_10575297 3300025960 Unclassified 982
474 Ga0207651_10949091 3300025960 Bacteria 767
475 Ga0207651_11037235 3300025960 Bacteria 734
476 Ga0207712_10003917 3300025961 Bacteria 9407
477 Ga0207712_10046583 3300025961 Bacteria 3007
478 Ga0207712_10068230 3300025961 Bacteria 2547
479 Ga0207712_10069153 3300025961 Bacteria 2533
480 Ga0207640_10056281 3300025981 Bacteria 2580
481 Ga0207640_10504681 3300025981 Unclassified 1008
482 Ga0207640_10634929 3300025981 Bacteria 908
483 Ga0207640_11026700 3300025981 Unclassified 726
484 Ga0207677_10062117 3300026023 Bacteria 2590
485 Ga0207703_10026878 3300026035 Bacteria 4531
486 Ga0207703_10075752 3300026035 Bacteria 2789
487 Ga0207703_10238465 3300026035 Unclassified 1634
488 Ga0207703_10398337 3300026035 Bacteria 1277
489 Ga0207703_10710903 3300026035 Bacteria 956
490 Ga0207639_10163036 3300026041 Bacteria 1880
491 Ga0207639_10291698 3300026041 Bacteria 1439
492 Ga0207639_11294731 3300026041 Unclassified 684
493 Ga0207678_10998761 3300026067 Bacteria 741
494 Ga0207708_10000085 3300026075 Bacteria 73335
495 Ga0207708_10015575 3300026075 Bacteria 5701
496 Ga0207708_10026157 3300026075 Bacteria 4414
497 Ga0207708_10807361 3300026075 Unclassified 808
498 Ga0207702_10029124 3300026078 Bacteria 4593
499 Ga0207702_10298692 3300026078 Bacteria 1528
500 Ga0207641_10028297 3300026088 Bacteria 4630
501 Ga0207641_10099923 3300026088 Bacteria 2554
502 Ga0207641_10133004 3300026088 Bacteria 2236
503 Ga0207641_10305211 3300026088 Bacteria 1505
504 Ga0207648_10059789 3300026089 Bacteria 3324
505 Ga0207648_10125448 3300026089 Bacteria 2258
506 Ga0207648_11843238 3300026089 Bacteria 566
507 Ga0207648_11981037 3300026089 Unclassified 544
508 Ga0207676_10051866 3300026095 Bacteria 3204
509 Ga0207676_10069499 3300026095 Bacteria 2820
510 Ga0207676_10290889 3300026095 Unclassified 1487
511 Ga0207676_10309829 3300026095 Bacteria 1445
512 Ga0207676_10699421 3300026095 Bacteria 982
513 Ga0207676_12254757 3300026095 Unclassified 542
514 Ga0207674_10000054 3300026116 Bacteria 114198
515 Ga0207674_10083214 3300026116 Bacteria 3200
516 Ga0207674_10175578 3300026116 Bacteria 2095
517 Ga0207674_10395009 3300026116 Bacteria 1336
518 Ga0207674_10406495 3300026116 Bacteria 1316
519 Ga0207674_10498416 3300026116 Unclassified 1177
520 Ga0207674_10868933 3300026116 Unclassified 869
521 Ga0207674_11626803 3300026116 Unclassified 614
522 Ga0207675_100102606 3300026118 Bacteria 2695
523 Ga0207675_100567366 3300026118 Bacteria 1135
524 Ga0207675_100969391 3300026118 Bacteria 868
525 Ga0207675_101476549 3300026118 Bacteria 701
526 Ga0207675_102657393 3300026118 Bacteria 510
527 Ga0207683_10866928 3300026121 Unclassified 838
528 Ga0207698_10024047 3300026142 Bacteria 4268
529 Ga0207698_11305551 3300026142 Unclassified 740
530 Ga0207428_10280585 3300027907 Bacteria 1237
531 Ga0268265_10065246 3300028380 Bacteria 2809
532 Ga0268265_10158216 3300028380 Bacteria 1920
533 Ga0268265_10312844 3300028380 Bacteria 1419
534 Ga0268265_10842954 3300028380 Bacteria 896
535 Ga0268265_10978025 3300028380 Bacteria 835
536 Ga0268265_10988145 3300028380 Bacteria 831
537 Ga0268265_11118972 3300028380 Unclassified 782
538 Ga0268265_11545157 3300028380 Bacteria 668
539 Ga0268264_10132949 3300028381 Bacteria 2208
540 Ga0268264_10264010 3300028381 Unclassified 1605
541 Ga0268264_10440643 3300028381 Unclassified 1260
542 Ga0268264_11506620 3300028381 Bacteria 683
543 Ga0268264_11512843 3300028381 Unclassified 682
544 Ga0268264_12115774 3300028381 Unclassified 571
545 Ga0314311_1022701 3300030733 Bacteria 1107
546 Ga0307513_10270470 3300031456 Bacteria 1483
547 Ga0307408_101146393 3300031548 Bacteria 723
548 Ga0307405_10072035 3300031731 Bacteria 2226
549 Ga0307405_10088899 3300031731 Bacteria 2040
550 Ga0307410_10040052 3300031852 Bacteria 3081
551 Ga0307410_11204056 3300031852 Unclassified 660
552 Ga0307406_10480832 3300031901 Bacteria 1003
553 Ga0307406_11196842 3300031901 Unclassified 660
554 Ga0307406_12133419 3300031901 Unclassified 502
555 Ga0307412_10006314 3300031911 Bacteria 6695
556 Ga0307412_10420901 3300031911 Unclassified 1093
557 Ga0307409_101734670 3300031995 Unclassified 653
558 Ga0307416_100012408 3300032002 Bacteria 5741
559 Ga0307414_10004189 3300032004 Bacteria 7799
560 Ga0307414_10127232 3300032004 Bacteria 1971
561 Ga0307414_10228081 3300032004 Bacteria 1534
562 Ga0307411_10003878 3300032005 Bacteria 7048
563 Ga0307411_11050740 3300032005 Unclassified 732
564 Ga0307411_11809504 3300032005 Unclassified 567
565 Ga0307415_100006092 3300032126 Bacteria 6467
566 Ga0373940_0159250 3300035088 Unclassified 724
567 Ga0373951_0003402 3300035091 Bacteria 3861
568 Ga0373951_0126864 3300035091 Bacteria 699
569 Ga0373941_0269257 3300035115 Unclassified 671
570 Ga0373942_0132429 3300035207 Bacteria 787
571 Ga0373962_0124907 3300035242 Bacteria 824
572 Ga0373931_0618527 3300035691 Bacteria 709
573 Ga0395899_0102363 3300037312 Bacteria 2067
574 Ga0395899_0643007 3300037312 Unclassified 671
575 Ga0395900_0270305 3300037418 Bacteria 1695
576 Ga0395900_0338677 3300037418 Bacteria 1480
577 Ga0395898_0100682 3300037466 Bacteria 2775
578 Ga0395898_0643991 3300037466 Bacteria 1002
579 Ga0395905_0616491 3300037471 Bacteria 987
580 Ga0395905_0717807 3300037471 Bacteria 902
581 Ga0395901_0255449 3300038443 Bacteria 1825
582 Ga0395901_0820740 3300038443 Unclassified 917
583 Ga0395901_0887700 3300038443 Unclassified 874
584 Ga0242420_001118 3300038996 Bacteria 3446
585 Ga0242420_129135 3300038996 Unclassified 556
586 Ga0439448_0060455 3300042005 Bacteria 1252
587 Ga0439455_0094036 3300042012 Unclassified 824
588 Ga0439458_0043564 3300042157 Bacteria 1095
589 Ga0451576_0442541 3300045051 Bacteria 1364
590 Ga0451576_0624807 3300045051 Unclassified 1132
591 Ga0495668_0315007 3300046616 Bacteria 858
592 Ga0496102_0007725 3300048905 Bacteria 9188
593 Ga0496104_0073281 3300048907 Unclassified 3258
594 Ga0496106_0013833 3300048909 Bacteria 5963
595 Ga0496106_0126579 3300048909 Bacteria 2001
596 Ga0496106_0163516 3300048909 Bacteria 1761
597 Ga0496107_0180798 3300048910 Bacteria 1566
598 Ga0496107_0299286 3300048910 Bacteria 1197
599 Ga0496108_0369471 3300048911 Bacteria 1252
600 Ga0496109_0250839 3300048912 Bacteria 1667
601 Ga0496109_0408675 3300048912 Bacteria 1283
602 Ga0496109_0655306 3300048912 Bacteria 987
603 Ga0496110_1107160 3300048913 Unclassified 700
604 Ga0496111_1273367 3300048914 Bacteria 519
605 Ga0496112_0297470 3300048915 Bacteria 1560
606 Ga0496112_0353215 3300048915 Bacteria 1412
607 Ga0496112_0515617 3300048915 Unclassified 1130
608 Ga0496112_0544488 3300048915 Bacteria 1095
609 Ga0496113_0131690 3300048916 Bacteria 1963
610 Ga0496113_0434520 3300048916 Bacteria 1055
611 Ga0501292_034870 3300049515 Bacteria 855
612 Ga0501297_006391 3300049520 Bacteria 1256
613 Ga0501298_023712 3300049521 Bacteria 1164
614 Ga0501040_0165430 3300049576 Bacteria 1565
615 Ga0501072_0840081 3300049588 Unclassified 718
616 Ga0501202_087007 3300049652 Unclassified 742
617 Ga0501208_007211 3300049655 Bacteria 1449
618 Ga0501216_012693 3300049660 Bacteria 1386
619 Ga0501217_000320 3300049661 Bacteria 7642
620 Ga0501223_023218 3300049663 Bacteria 1210
621 Ga0501224_002538 3300049664 Bacteria 2500
622 Ga0501227_002226 3300049665 Bacteria 4291
623 Ga0501228_030644 3300049666 Unclassified 658
624 Ga0501230_058471 3300049667 Unclassified 777
625 Ga0501233_020921 3300049668 Bacteria 1400
626 Ga0501233_096500 3300049668 Unclassified 777
627 Ga0501233_111765 3300049668 Unclassified 731
628 Ga0501235_009548 3300049669 Bacteria 2120
629 Ga0501243_004261 3300049675 Unclassified 2143
630 Ga0501249_036643 3300049679 Bacteria 1105
631 Ga0501260_002731 3300049689 Bacteria 1547
632 Ga0501225_0027916 3300049705 Bacteria 1551
633 Ga0501225_0031001 3300049705 Bacteria 1471
634 Ga0501234_007938 3300049707 Bacteria 1658
635 Ga0501079_1181518 3300049741 Unclassified 603
636 Ga0501081_0396861 3300049743 Bacteria 1021
637 Ga0501241_084319 3300049758 Unclassified 665
638 Ga0501270_061719 3300049767 Unclassified 705
639 Ga0501272_023279 3300049769 Unclassified 754
640 Ga0501280_009885 3300049776 Bacteria 1329
641 Ga0501212_039444 3300049851 Unclassified 778
642 nmdc:mga05p37_115257_c1 3300050507 Bacteria 3303
643 nmdc:mga05p37_1477241_c1 3300050507 Unclassified 678
644 nmdc:mga05p37_303167_c1 3300050507 Unclassified 1897
645 nmdc:mga05p37_351180_c1 3300050507 Bacteria 1736
646 nmdc:mga05p37_926513_c1 3300050507 Bacteria 936
647 nmdc:mga09592_1525705_c1 3300050508 Unclassified 543
648 nmdc:mga09592_207672_c1 3300050508 Bacteria 1696
649 nmdc:mga09592_443827_c1 3300050508 Bacteria 1120
650 nmdc:mga09592_878230_c1 3300050508 Unclassified 755
651 nmdc:mga0qj67_201808_c1 3300050509 Bacteria 1616
652 nmdc:mga06r32_1022417_c1 3300050510 Unclassified 778
653 nmdc:mga06r32_1230180_c1 3300050510 Unclassified 694
654 nmdc:mga06r32_927427_c1 3300050510 Unclassified 826
655 nmdc:mga08y16_13053_c1 3300050511 Bacteria 8740
656 nmdc:mga0n895_1195222_c1 3300050512 Bacteria 734
657 nmdc:mga0n895_139674_c1 3300050512 Bacteria 2450
658 nmdc:mga0n895_1397284_c1 3300050512 Unclassified 669
659 nmdc:mga0n895_196172_c1 3300050512 Unclassified 2050
660 nmdc:mga0n895_216901_c1 3300050512 Bacteria 1943
661 nmdc:mga0rr50_263850_c1 3300050513 Unclassified 1433
662 nmdc:mga0rr50_36554_c1 3300050513 Bacteria 3538
663 nmdc:mga0a205_116123_c1 3300050515 Bacteria 2575
664 nmdc:mga0a205_123556_c1 3300050515 Bacteria 2488
665 nmdc:mga0a205_30170_c1 3300050515 Bacteria 5191
666 nmdc:mga0a205_65263_c1 3300050515 Bacteria 3517
667 nmdc:mga0a205_78761_c1 3300050515 Bacteria 3184
668 nmdc:mga0a205_843117_c1 3300050515 Bacteria 764
669 Ga0501082_1216552 3300060353 Unclassified 658
670 Ga0530510_0064661 3300061734 Bacteria 2649

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037312 Ga0395899_0643007 Ga0395899_0643007_22_345 107
2 3300026118 Ga0207675_102657393 Ga0207675_1026573932 117
3 3300005406 Ga0070703_10270434 Ga0070703_102704341 119
4 3300005618 Ga0068864_100087390 Ga0068864_1000873902 119
5 3300005840 Ga0068870_10503433 Ga0068870_105034332 119
6 3300005841 Ga0068863_100214776 Ga0068863_1002147762 119
7 3300006852 Ga0075433_10017740 Ga0075433_100177405 119
8 3300006871 Ga0075434_100204958 Ga0075434_1002049583 119
9 3300009174 Ga0105241_10056018 Ga0105241_100560182 119
10 3300014325 Ga0163163_10003419 Ga0163163_100034196 119
11 3300025911 Ga0207654_10198487 Ga0207654_101984872 119
12 3300026088 Ga0207641_10305211 Ga0207641_103052112 119
13 3300026095 Ga0207676_10051866 Ga0207676_100518664 119
14 3300050515 nmdc:mga0a205_78761_c1 nmdc:mga0a205_78761_c1_1118_1477 119
15 3300005288 Ga0065714_10064522 Ga0065714_100645224 120
16 3300005289 Ga0065704_10658195 Ga0065704_106581951 120
17 3300005290 Ga0065712_10000141 Ga0065712_1000014116 120
18 3300005293 Ga0065715_10091022 Ga0065715_100910224 120
19 3300005295 Ga0065707_10097033 Ga0065707_100970333 120
20 3300005295 Ga0065707_10346491 Ga0065707_103464912 120
21 3300005328 Ga0070676_10711942 Ga0070676_107119421 120
22 3300005345 Ga0070692_10326338 Ga0070692_103263382 120
23 3300005366 Ga0070659_100915422 Ga0070659_1009154221 120
24 3300005441 Ga0070700_100000123 Ga0070700_10000012330 120
25 3300005444 Ga0070694_100116574 Ga0070694_1001165742 120
26 3300005467 Ga0070706_100000998 Ga0070706_10000099820 120
27 3300005468 Ga0070707_100000452 Ga0070707_10000045211 120
28 3300005471 Ga0070698_100323623 Ga0070698_1003236232 120
29 3300005518 Ga0070699_100292372 Ga0070699_1002923722 120
30 3300005518 Ga0070699_101497300 Ga0070699_1014973002 120
31 3300005536 Ga0070697_100143354 Ga0070697_1001433541 120
32 3300005545 Ga0070695_100052711 Ga0070695_1000527112 120
33 3300005545 Ga0070695_100338782 Ga0070695_1003387822 120
34 3300005546 Ga0070696_100011189 Ga0070696_1000111893 120
35 3300005546 Ga0070696_100797318 Ga0070696_1007973182 120
36 3300005549 Ga0070704_100007720 Ga0070704_1000077204 120
37 3300005564 Ga0070664_100448947 Ga0070664_1004489472 120
38 3300005577 Ga0068857_101268337 Ga0068857_1012683372 120
39 3300005617 Ga0068859_100009209 Ga0068859_1000092097 120
40 3300005618 Ga0068864_100334778 Ga0068864_1003347783 120
41 3300006847 Ga0075431_100489721 Ga0075431_1004897212 120
42 3300006852 Ga0075433_10408113 Ga0075433_104081132 120
43 3300006871 Ga0075434_100827817 Ga0075434_1008278171 120
44 3300006914 Ga0075436_100207715 Ga0075436_1002077152 120
45 3300006931 Ga0097620_100009209 Ga0097620_1000092097 120
46 3300009101 Ga0105247_10091435 Ga0105247_100914352 120
47 3300009147 Ga0114129_10481177 Ga0114129_104811773 120
48 3300009147 Ga0114129_12335066 Ga0114129_123350662 120
49 3300009148 Ga0105243_12165098 Ga0105243_121650981 120
50 3300009174 Ga0105241_11143457 Ga0105241_111434572 120
51 3300009176 Ga0105242_10888184 Ga0105242_108881842 120
52 3300009177 Ga0105248_10134451 Ga0105248_101344513 120
53 3300013296 Ga0157374_11995922 Ga0157374_119959222 120
54 3300013297 Ga0157378_10411773 Ga0157378_104117732 120
55 3300013307 Ga0157372_11374777 Ga0157372_113747772 120
56 3300013308 Ga0157375_10052699 Ga0157375_100526994 120
57 3300013308 Ga0157375_10893985 Ga0157375_108939852 120
58 3300014745 Ga0157377_10461049 Ga0157377_104610492 120
59 3300025910 Ga0207684_10000286 Ga0207684_1000028653 120
60 3300025922 Ga0207646_10000798 Ga0207646_1000079828 120
61 3300025927 Ga0207687_10449122 Ga0207687_104491222 120
62 3300025941 Ga0207711_10020954 Ga0207711_100209542 120
63 3300025942 Ga0207689_10431196 Ga0207689_104311962 120
64 3300025945 Ga0207679_11019338 Ga0207679_110193382 120
65 3300026075 Ga0207708_10000085 Ga0207708_1000008570 120
66 3300026095 Ga0207676_10699421 Ga0207676_106994211 120
67 3300026116 Ga0207674_11626803 Ga0207674_116268032 120
68 3300035242 Ga0373962_0124907 Ga0373962_0124907_182_544 120
69 3300037418 Ga0395900_0270305 Ga0395900_0270305_403_765 120
70 3300042005 Ga0439448_0060455 Ga0439448_0060455_276_638 120
71 3300042012 Ga0439455_0094036 Ga0439455_0094036_208_570 120
72 3300042157 Ga0439458_0043564 Ga0439458_0043564_191_553 120
73 3300050507 nmdc:mga05p37_1477241_c1 nmdc:mga05p37_1477241_c1_44_406 120
74 3300050507 nmdc:mga05p37_351180_c1 nmdc:mga05p37_351180_c1_643_1005 120
75 3300050510 nmdc:mga06r32_1022417_c1 nmdc:mga06r32_1022417_c1_153_515 120
76 3300050512 nmdc:mga0n895_1397284_c1 nmdc:mga0n895_1397284_c1_39_401 120
77 3300005290 Ga0065712_10111906 Ga0065712_101119063 121
78 3300005293 Ga0065715_10034425 Ga0065715_100344251 121
79 3300005293 Ga0065715_10127638 Ga0065715_101276383 121
80 3300005293 Ga0065715_10306252 Ga0065715_103062522 121
81 3300005293 Ga0065715_10332792 Ga0065715_103327921 121
82 3300005293 Ga0065715_10451710 Ga0065715_104517102 121
83 3300005293 Ga0065715_10960023 Ga0065715_109600231 121
84 3300005295 Ga0065707_11071872 Ga0065707_110718721 121
85 3300005329 Ga0070683_100217404 Ga0070683_1002174042 121
86 3300005330 Ga0070690_100776708 Ga0070690_1007767082 121
87 3300005331 Ga0070670_100043591 Ga0070670_1000435913 121
88 3300005331 Ga0070670_100156139 Ga0070670_1001561392 121
89 3300005334 Ga0068869_100050373 Ga0068869_1000503736 121
90 3300005334 Ga0068869_100125983 Ga0068869_1001259832 121
91 3300005334 Ga0068869_100192992 Ga0068869_1001929922 121
92 3300005334 Ga0068869_100215780 Ga0068869_1002157801 121
93 3300005334 Ga0068869_101470142 Ga0068869_1014701421 121
94 3300005336 Ga0070680_100058911 Ga0070680_1000589114 121
95 3300005337 Ga0070682_100107073 Ga0070682_1001070733 121
96 3300005339 Ga0070660_100169414 Ga0070660_1001694142 121
97 3300005340 Ga0070689_100022847 Ga0070689_1000228472 121
98 3300005340 Ga0070689_101562495 Ga0070689_1015624951 121
99 3300005343 Ga0070687_100094232 Ga0070687_1000942322 121
100 3300005344 Ga0070661_100108210 Ga0070661_1001082103 121
101 3300005353 Ga0070669_100282450 Ga0070669_1002824502 121
102 3300005353 Ga0070669_100338258 Ga0070669_1003382582 121
103 3300005354 Ga0070675_101301953 Ga0070675_1013019532 121
104 3300005354 Ga0070675_101828585 Ga0070675_1018285851 121
105 3300005356 Ga0070674_100161611 Ga0070674_1001616112 121
106 3300005364 Ga0070673_100099071 Ga0070673_1000990713 121
107 3300005364 Ga0070673_100810904 Ga0070673_1008109042 121
108 3300005365 Ga0070688_100927297 Ga0070688_1009272972 121
109 3300005366 Ga0070659_100000911 Ga0070659_10000091110 121
110 3300005438 Ga0070701_10614911 Ga0070701_106149111 121
111 3300005444 Ga0070694_100038672 Ga0070694_1000386722 121
112 3300005444 Ga0070694_100564578 Ga0070694_1005645782 121
113 3300005444 Ga0070694_100582609 Ga0070694_1005826091 121
114 3300005455 Ga0070663_100328255 Ga0070663_1003282552 121
115 3300005457 Ga0070662_100185724 Ga0070662_1001857242 121
116 3300005457 Ga0070662_101717868 Ga0070662_1017178681 121
117 3300005458 Ga0070681_10000285 Ga0070681_1000028532 121
118 3300005458 Ga0070681_10004771 Ga0070681_100047715 121
119 3300005471 Ga0070698_101775942 Ga0070698_1017759421 121
120 3300005518 Ga0070699_100382353 Ga0070699_1003823532 121
121 3300005530 Ga0070679_100000348 Ga0070679_1000003486 121
122 3300005530 Ga0070679_100025802 Ga0070679_1000258024 121
123 3300005536 Ga0070697_101796058 Ga0070697_1017960581 121
124 3300005539 Ga0068853_100004711 Ga0068853_10000471110 121
125 3300005539 Ga0068853_100016076 Ga0068853_1000160763 121
126 3300005539 Ga0068853_101412181 Ga0068853_1014121812 121
127 3300005543 Ga0070672_100567005 Ga0070672_1005670052 121
128 3300005544 Ga0070686_100022421 Ga0070686_1000224212 121
129 3300005546 Ga0070696_101009132 Ga0070696_1010091321 121
130 3300005547 Ga0070693_101621598 Ga0070693_1016215981 121
131 3300005549 Ga0070704_100504089 Ga0070704_1005040892 121
132 3300005563 Ga0068855_100707764 Ga0068855_1007077642 121
133 3300005564 Ga0070664_100001827 Ga0070664_10000182712 121
134 3300005564 Ga0070664_102356107 Ga0070664_1023561071 121
135 3300005577 Ga0068857_100001397 Ga0068857_10000139713 121
136 3300005578 Ga0068854_100045048 Ga0068854_1000450482 121
137 3300005578 Ga0068854_100166422 Ga0068854_1001664222 121
138 3300005614 Ga0068856_100084062 Ga0068856_1000840622 121
139 3300005615 Ga0070702_100249309 Ga0070702_1002493092 121
140 3300005615 Ga0070702_100886563 Ga0070702_1008865631 121
141 3300005617 Ga0068859_100136315 Ga0068859_1001363151 121
142 3300005617 Ga0068859_100222227 Ga0068859_1002222272 121
143 3300005617 Ga0068859_100446307 Ga0068859_1004463072 121
144 3300005617 Ga0068859_100606423 Ga0068859_1006064232 121
145 3300005617 Ga0068859_100647243 Ga0068859_1006472431 121
146 3300005617 Ga0068859_100765395 Ga0068859_1007653952 121
147 3300005617 Ga0068859_101450387 Ga0068859_1014503872 121
148 3300005618 Ga0068864_100034755 Ga0068864_1000347555 121
149 3300005618 Ga0068864_100142795 Ga0068864_1001427953 121
150 3300005618 Ga0068864_100161378 Ga0068864_1001613782 121
151 3300005618 Ga0068864_100994297 Ga0068864_1009942971 121
152 3300005618 Ga0068864_102086743 Ga0068864_1020867432 121
153 3300005719 Ga0068861_100779045 Ga0068861_1007790452 121
154 3300005719 Ga0068861_101992317 Ga0068861_1019923172 121
155 3300005840 Ga0068870_10077638 Ga0068870_100776382 121
156 3300005840 Ga0068870_10100569 Ga0068870_101005693 121
157 3300005840 Ga0068870_10173215 Ga0068870_101732152 121
158 3300005840 Ga0068870_11299631 Ga0068870_112996311 121
159 3300005841 Ga0068863_100003484 Ga0068863_10000348413 121
160 3300005841 Ga0068863_100130663 Ga0068863_1001306633 121
161 3300005842 Ga0068858_100566653 Ga0068858_1005666531 121
162 3300005843 Ga0068860_100423216 Ga0068860_1004232162 121
163 3300005843 Ga0068860_100508157 Ga0068860_1005081573 121
164 3300005844 Ga0068862_100169536 Ga0068862_1001695363 121
165 3300005844 Ga0068862_100230906 Ga0068862_1002309062 121
166 3300005844 Ga0068862_100289594 Ga0068862_1002895942 121
167 3300005844 Ga0068862_100889241 Ga0068862_1008892412 121
168 3300005844 Ga0068862_101563737 Ga0068862_1015637372 121
169 3300006846 Ga0075430_100026096 Ga0075430_1000260963 121
170 3300006847 Ga0075431_100094215 Ga0075431_1000942154 121
171 3300006852 Ga0075433_10125283 Ga0075433_101252832 121
172 3300006852 Ga0075433_10215142 Ga0075433_102151422 121
173 3300006852 Ga0075433_11842829 Ga0075433_118428291 121
174 3300006880 Ga0075429_100027099 Ga0075429_1000270995 121
175 3300006914 Ga0075436_100333045 Ga0075436_1003330452 121
176 3300006931 Ga0097620_100136319 Ga0097620_1001363194 121
177 3300006931 Ga0097620_100222224 Ga0097620_1002222242 121
178 3300006931 Ga0097620_100446295 Ga0097620_1004462952 121
179 3300006931 Ga0097620_100606419 Ga0097620_1006064192 121
180 3300006931 Ga0097620_100647226 Ga0097620_1006472261 121
181 3300006931 Ga0097620_100765231 Ga0097620_1007652312 121
182 3300006931 Ga0097620_101450818 Ga0097620_1014508182 121
183 3300007076 Ga0075435_100204664 Ga0075435_1002046641 121
184 3300009094 Ga0111539_10137924 Ga0111539_101379242 121
185 3300009094 Ga0111539_11060744 Ga0111539_110607441 121
186 3300009098 Ga0105245_12101708 Ga0105245_121017081 121
187 3300009101 Ga0105247_10631914 Ga0105247_106319141 121
188 3300009147 Ga0114129_10044807 Ga0114129_100448073 121
189 3300009147 Ga0114129_10121949 Ga0114129_101219492 121
190 3300009147 Ga0114129_10212484 Ga0114129_102124843 121
191 3300009147 Ga0114129_10883816 Ga0114129_108838162 121
192 3300009147 Ga0114129_11301993 Ga0114129_113019933 121
193 3300009147 Ga0114129_11373546 Ga0114129_113735462 121
194 3300009174 Ga0105241_10162803 Ga0105241_101628032 121
195 3300009174 Ga0105241_11480404 Ga0105241_114804041 121
196 3300009176 Ga0105242_11607732 Ga0105242_116077322 121
197 3300009177 Ga0105248_10069136 Ga0105248_100691362 121
198 3300009553 Ga0105249_10132631 Ga0105249_101326312 121
199 3300009553 Ga0105249_10320253 Ga0105249_103202533 121
200 3300009553 Ga0105249_10383775 Ga0105249_103837753 121
201 3300009553 Ga0105249_12005203 Ga0105249_120052031 121
202 3300010375 Ga0105239_10423198 Ga0105239_104231982 121
203 3300013100 Ga0157373_10033103 Ga0157373_100331032 121
204 3300013296 Ga0157374_10041844 Ga0157374_100418445 121
205 3300013297 Ga0157378_10974548 Ga0157378_109745481 121
206 3300013297 Ga0157378_12159566 Ga0157378_121595661 121
207 3300013307 Ga0157372_11037357 Ga0157372_110373572 121
208 3300013308 Ga0157375_10154114 Ga0157375_101541144 121
209 3300013308 Ga0157375_11352986 Ga0157375_113529861 121
210 3300013308 Ga0157375_12818519 Ga0157375_128185191 121
211 3300014325 Ga0163163_10076791 Ga0163163_100767913 121
212 3300014325 Ga0163163_10308566 Ga0163163_103085662 121
213 3300014326 Ga0157380_10000349 Ga0157380_1000034930 121
214 3300014326 Ga0157380_10064921 Ga0157380_100649212 121
215 3300014326 Ga0157380_10285760 Ga0157380_102857602 121
216 3300014745 Ga0157377_10165601 Ga0157377_101656012 121
217 3300014745 Ga0157377_10265805 Ga0157377_102658052 121
218 3300015262 Ga0182007_10195680 Ga0182007_101956801 121
219 3300015262 Ga0182007_10365838 Ga0182007_103658381 121
220 3300025893 Ga0207682_10240422 Ga0207682_102404221 121
221 3300025900 Ga0207710_10124133 Ga0207710_101241332 121
222 3300025908 Ga0207643_10001491 Ga0207643_100014919 121
223 3300025908 Ga0207643_10296049 Ga0207643_102960492 121
224 3300025908 Ga0207643_10421868 Ga0207643_104218682 121
225 3300025917 Ga0207660_10303911 Ga0207660_103039112 121
226 3300025920 Ga0207649_10078720 Ga0207649_100787202 121
227 3300025921 Ga0207652_10240545 Ga0207652_102405453 121
228 3300025923 Ga0207681_10151330 Ga0207681_101513302 121
229 3300025925 Ga0207650_10056830 Ga0207650_100568302 121
230 3300025925 Ga0207650_10063854 Ga0207650_100638543 121
231 3300025925 Ga0207650_10139770 Ga0207650_101397703 121
232 3300025925 Ga0207650_10240940 Ga0207650_102409402 121
233 3300025926 Ga0207659_11384882 Ga0207659_113848822 121
234 3300025932 Ga0207690_10012439 Ga0207690_100124395 121
235 3300025933 Ga0207706_10418625 Ga0207706_104186252 121
236 3300025936 Ga0207670_10081832 Ga0207670_100818322 121
237 3300025940 Ga0207691_10949511 Ga0207691_109495111 121
238 3300025941 Ga0207711_10135607 Ga0207711_101356073 121
239 3300025942 Ga0207689_10041430 Ga0207689_100414307 121
240 3300025942 Ga0207689_10065895 Ga0207689_100658952 121
241 3300025942 Ga0207689_10736311 Ga0207689_107363112 121
242 3300025942 Ga0207689_11107869 Ga0207689_111078691 121
243 3300025944 Ga0207661_10387287 Ga0207661_103872871 121
244 3300025945 Ga0207679_10018390 Ga0207679_100183902 121
245 3300025949 Ga0207667_10507030 Ga0207667_105070302 121
246 3300025960 Ga0207651_10575297 Ga0207651_105752972 121
247 3300025960 Ga0207651_11037235 Ga0207651_110372351 121
248 3300025961 Ga0207712_10068230 Ga0207712_100682302 121
249 3300025981 Ga0207640_10056281 Ga0207640_100562812 121
250 3300026035 Ga0207703_10710903 Ga0207703_107109032 121
251 3300026041 Ga0207639_10163036 Ga0207639_101630363 121
252 3300026041 Ga0207639_10291698 Ga0207639_102916982 121
253 3300026067 Ga0207678_10998761 Ga0207678_109987612 121
254 3300026075 Ga0207708_10026157 Ga0207708_100261573 121
255 3300026078 Ga0207702_10029124 Ga0207702_100291242 121
256 3300026088 Ga0207641_10028297 Ga0207641_100282974 121
257 3300026089 Ga0207648_10059789 Ga0207648_100597894 121
258 3300026089 Ga0207648_10125448 Ga0207648_101254482 121
259 3300026089 Ga0207648_11843238 Ga0207648_118432381 121
260 3300026095 Ga0207676_10069499 Ga0207676_100694993 121
261 3300026095 Ga0207676_10290889 Ga0207676_102908892 121
262 3300026095 Ga0207676_10309829 Ga0207676_103098293 121
263 3300026116 Ga0207674_10000054 Ga0207674_1000005462 121
264 3300026116 Ga0207674_10175578 Ga0207674_101755783 121
265 3300026118 Ga0207675_100102606 Ga0207675_1001026062 121
266 3300026118 Ga0207675_101476549 Ga0207675_1014765491 121
267 3300027907 Ga0207428_10280585 Ga0207428_102805852 121
268 3300028380 Ga0268265_10065246 Ga0268265_100652462 121
269 3300028380 Ga0268265_10158216 Ga0268265_101582162 121
270 3300028380 Ga0268265_10312844 Ga0268265_103128442 121
271 3300028380 Ga0268265_10978025 Ga0268265_109780252 121
272 3300028380 Ga0268265_11545157 Ga0268265_115451572 121
273 3300028381 Ga0268264_10440643 Ga0268264_104406432 121
274 3300028381 Ga0268264_11506620 Ga0268264_115066201 121
275 3300031731 Ga0307405_10072035 Ga0307405_100720351 121
276 3300031852 Ga0307410_10040052 Ga0307410_100400523 121
277 3300031852 Ga0307410_11204056 Ga0307410_112040562 121
278 3300031901 Ga0307406_12133419 Ga0307406_121334191 121
279 3300031911 Ga0307412_10006314 Ga0307412_100063148 121
280 3300031995 Ga0307409_101734670 Ga0307409_1017346701 121
281 3300032002 Ga0307416_100012408 Ga0307416_1000124081 121
282 3300032004 Ga0307414_10004189 Ga0307414_100041898 121
283 3300032004 Ga0307414_10127232 Ga0307414_101272323 121
284 3300032005 Ga0307411_10003878 Ga0307411_100038781 121
285 3300032126 Ga0307415_100006092 Ga0307415_1000060921 121
286 3300035091 Ga0373951_0126864 Ga0373951_0126864_300_665 121
287 3300035207 Ga0373942_0132429 Ga0373942_0132429_370_735 121
288 3300037312 Ga0395899_0102363 Ga0395899_0102363_710_1084 121
289 3300037471 Ga0395905_0717807 Ga0395905_0717807_124_489 121
290 3300038443 Ga0395901_0887700 Ga0395901_0887700_363_737 121
291 3300038996 Ga0242420_129135 Ga0242420_129135_117_482 121
292 3300045051 Ga0451576_0624807 Ga0451576_0624807_403_768 121
293 3300048905 Ga0496102_0007725 Ga0496102_0007725_7301_7666 121
294 3300048907 Ga0496104_0073281 Ga0496104_0073281_290_655 121
295 3300048909 Ga0496106_0013833 Ga0496106_0013833_325_690 121
296 3300048909 Ga0496106_0126579 Ga0496106_0126579_622_987 121
297 3300048910 Ga0496107_0180798 Ga0496107_0180798_53_418 121
298 3300048912 Ga0496109_0250839 Ga0496109_0250839_149_514 121
299 3300048912 Ga0496109_0655306 Ga0496109_0655306_68_433 121
300 3300048914 Ga0496111_1273367 Ga0496111_1273367_51_416 121
301 3300048916 Ga0496113_0434520 Ga0496113_0434520_287_652 121
302 3300049515 Ga0501292_034870 Ga0501292_034870_281_646 121
303 3300049520 Ga0501297_006391 Ga0501297_006391_418_783 121
304 3300049521 Ga0501298_023712 Ga0501298_023712_100_465 121
305 3300049576 Ga0501040_0165430 Ga0501040_0165430_767_1132 121
306 3300049588 Ga0501072_0840081 Ga0501072_0840081_104_469 121
307 3300049652 Ga0501202_087007 Ga0501202_087007_14_379 121
308 3300049655 Ga0501208_007211 Ga0501208_007211_160_525 121
309 3300049660 Ga0501216_012693 Ga0501216_012693_1007_1372 121
310 3300049661 Ga0501217_000320 Ga0501217_000320_76_441 121
311 3300049663 Ga0501223_023218 Ga0501223_023218_155_520 121
312 3300049664 Ga0501224_002538 Ga0501224_002538_760_1125 121
313 3300049666 Ga0501228_030644 Ga0501228_030644_32_397 121
314 3300049667 Ga0501230_058471 Ga0501230_058471_298_663 121
315 3300049668 Ga0501233_020921 Ga0501233_020921_427_792 121
316 3300049668 Ga0501233_111765 Ga0501233_111765_291_656 121
317 3300049669 Ga0501235_009548 Ga0501235_009548_862_1227 121
318 3300049675 Ga0501243_004261 Ga0501243_004261_1361_1726 121
319 3300049679 Ga0501249_036643 Ga0501249_036643_707_1072 121
320 3300049689 Ga0501260_002731 Ga0501260_002731_428_793 121
321 3300049705 Ga0501225_0027916 Ga0501225_0027916_1130_1495 121
322 3300049707 Ga0501234_007938 Ga0501234_007938_549_914 121
323 3300049741 Ga0501079_1181518 Ga0501079_1181518_211_591 121
324 3300049743 Ga0501081_0396861 Ga0501081_0396861_592_957 121
325 3300049767 Ga0501270_061719 Ga0501270_061719_311_676 121
326 3300049769 Ga0501272_023279 Ga0501272_023279_313_678 121
327 3300049776 Ga0501280_009885 Ga0501280_009885_750_1115 121
328 3300049851 Ga0501212_039444 Ga0501212_039444_358_723 121
329 3300050507 nmdc:mga05p37_303167_c1 nmdc:mga05p37_303167_c1_1345_1710 121
330 3300050507 nmdc:mga05p37_926513_c1 nmdc:mga05p37_926513_c1_505_870 121
331 3300050508 nmdc:mga09592_1525705_c1 nmdc:mga09592_1525705_c1_145_510 121
332 3300050508 nmdc:mga09592_443827_c1 nmdc:mga09592_443827_c1_705_1070 121
333 3300050511 nmdc:mga08y16_13053_c1 nmdc:mga08y16_13053_c1_1540_1905 121
334 3300050512 nmdc:mga0n895_139674_c1 nmdc:mga0n895_139674_c1_148_513 121
335 3300050512 nmdc:mga0n895_196172_c1 nmdc:mga0n895_196172_c1_50_415 121
336 3300050513 nmdc:mga0rr50_263850_c1 nmdc:mga0rr50_263850_c1_136_501 121
337 3300050515 nmdc:mga0a205_116123_c1 nmdc:mga0a205_116123_c1_70_435 121
338 3300050515 nmdc:mga0a205_123556_c1 nmdc:mga0a205_123556_c1_888_1253 121
339 3300050515 nmdc:mga0a205_30170_c1 nmdc:mga0a205_30170_c1_987_1352 121
340 3300050515 nmdc:mga0a205_843117_c1 nmdc:mga0a205_843117_c1_380_745 121
341 3300060353 Ga0501082_1216552 Ga0501082_1216552_268_633 121
342 3300061734 Ga0530510_0064661 Ga0530510_0064661_1581_1946 121
343 3300002459 JGI24751J29686_10000101 JGI24751J29686_100001018 122
344 3300005293 Ga0065715_10002355 Ga0065715_100023552 122
345 3300005293 Ga0065715_10819574 Ga0065715_108195741 122
346 3300005328 Ga0070676_11044825 Ga0070676_110448252 122
347 3300005331 Ga0070670_100000475 Ga0070670_1000004759 122
348 3300005331 Ga0070670_100703186 Ga0070670_1007031862 122
349 3300005334 Ga0068869_100085910 Ga0068869_1000859102 122
350 3300005334 Ga0068869_100302857 Ga0068869_1003028572 122
351 3300005334 Ga0068869_101108666 Ga0068869_1011086661 122
352 3300005337 Ga0070682_100006343 Ga0070682_1000063434 122
353 3300005338 Ga0068868_100218084 Ga0068868_1002180842 122
354 3300005340 Ga0070689_101031655 Ga0070689_1010316552 122
355 3300005340 Ga0070689_101113840 Ga0070689_1011138402 122
356 3300005343 Ga0070687_100173675 Ga0070687_1001736752 122
357 3300005343 Ga0070687_100707606 Ga0070687_1007076062 122
358 3300005344 Ga0070661_100419841 Ga0070661_1004198412 122
359 3300005345 Ga0070692_10002398 Ga0070692_100023986 122
360 3300005345 Ga0070692_10052746 Ga0070692_100527462 122
361 3300005345 Ga0070692_10101340 Ga0070692_101013402 122
362 3300005355 Ga0070671_100752360 Ga0070671_1007523602 122
363 3300005364 Ga0070673_100034472 Ga0070673_1000344722 122
364 3300005365 Ga0070688_100597056 Ga0070688_1005970561 122
365 3300005406 Ga0070703_10001572 Ga0070703_100015726 122
366 3300005438 Ga0070701_10233041 Ga0070701_102330412 122
367 3300005438 Ga0070701_10860115 Ga0070701_108601151 122
368 3300005441 Ga0070700_100011786 Ga0070700_1000117862 122
369 3300005441 Ga0070700_100347720 Ga0070700_1003477201 122
370 3300005444 Ga0070694_100007732 Ga0070694_1000077326 122
371 3300005444 Ga0070694_100009290 Ga0070694_1000092907 122
372 3300005444 Ga0070694_100843083 Ga0070694_1008430832 122
373 3300005445 Ga0070708_100143759 Ga0070708_1001437592 122
374 3300005459 Ga0068867_100541932 Ga0068867_1005419322 122
375 3300005467 Ga0070706_100010344 Ga0070706_1000103447 122
376 3300005468 Ga0070707_100012015 Ga0070707_1000120156 122
377 3300005468 Ga0070707_100251053 Ga0070707_1002510533 122
378 3300005471 Ga0070698_100011196 Ga0070698_1000111968 122
379 3300005518 Ga0070699_100000440 Ga0070699_10000044030 122
380 3300005518 Ga0070699_100148029 Ga0070699_1001480291 122
381 3300005518 Ga0070699_100247135 Ga0070699_1002471352 122
382 3300005530 Ga0070679_100457384 Ga0070679_1004573841 122
383 3300005536 Ga0070697_100001682 Ga0070697_1000016821 122
384 3300005536 Ga0070697_100089148 Ga0070697_1000891483 122
385 3300005536 Ga0070697_101557561 Ga0070697_1015575611 122
386 3300005539 Ga0068853_100715209 Ga0068853_1007152092 122
387 3300005547 Ga0070693_100001087 Ga0070693_1000010878 122
388 3300005547 Ga0070693_100721699 Ga0070693_1007216992 122
389 3300005549 Ga0070704_100664130 Ga0070704_1006641301 122
390 3300005564 Ga0070664_100050933 Ga0070664_1000509332 122
391 3300005564 Ga0070664_100244170 Ga0070664_1002441702 122
392 3300005577 Ga0068857_100467626 Ga0068857_1004676262 122
393 3300005577 Ga0068857_100790504 Ga0068857_1007905042 122
394 3300005577 Ga0068857_101706882 Ga0068857_1017068821 122
395 3300005578 Ga0068854_100403891 Ga0068854_1004038912 122
396 3300005615 Ga0070702_100010067 Ga0070702_1000100672 122
397 3300005615 Ga0070702_100047116 Ga0070702_1000471161 122
398 3300005615 Ga0070702_100129709 Ga0070702_1001297092 122
399 3300005616 Ga0068852_102410758 Ga0068852_1024107582 122
400 3300005617 Ga0068859_100037923 Ga0068859_1000379237 122
401 3300005617 Ga0068859_100098139 Ga0068859_1000981392 122
402 3300005617 Ga0068859_100192228 Ga0068859_1001922282 122
403 3300005617 Ga0068859_100342820 Ga0068859_1003428202 122
404 3300005617 Ga0068859_100522093 Ga0068859_1005220932 122
405 3300005617 Ga0068859_101449483 Ga0068859_1014494832 122
406 3300005618 Ga0068864_100771211 Ga0068864_1007712112 122
407 3300005618 Ga0068864_100810254 Ga0068864_1008102542 122
408 3300005834 Ga0068851_10000589 Ga0068851_1000058910 122
409 3300005840 Ga0068870_10536240 Ga0068870_105362402 122
410 3300005841 Ga0068863_100452943 Ga0068863_1004529432 122
411 3300005841 Ga0068863_100455727 Ga0068863_1004557272 122
412 3300005842 Ga0068858_100027685 Ga0068858_1000276854 122
413 3300005842 Ga0068858_100199259 Ga0068858_1001992592 122
414 3300005842 Ga0068858_100391856 Ga0068858_1003918562 122
415 3300005842 Ga0068858_100738750 Ga0068858_1007387502 122
416 3300005842 Ga0068858_100940877 Ga0068858_1009408772 122
417 3300005842 Ga0068858_101295690 Ga0068858_1012956902 122
418 3300005843 Ga0068860_100130990 Ga0068860_1001309902 122
419 3300005843 Ga0068860_100259981 Ga0068860_1002599812 122
420 3300005844 Ga0068862_100409096 Ga0068862_1004090962 122
421 3300005844 Ga0068862_102514807 Ga0068862_1025148071 122
422 3300006237 Ga0097621_100303917 Ga0097621_1003039172 122
423 3300006358 Ga0068871_100423003 Ga0068871_1004230032 122
424 3300006358 Ga0068871_100745640 Ga0068871_1007456402 122
425 3300006847 Ga0075431_100086819 Ga0075431_1000868194 122
426 3300006852 Ga0075433_10049877 Ga0075433_100498772 122
427 3300006852 Ga0075433_10744717 Ga0075433_107447172 122
428 3300006871 Ga0075434_100090367 Ga0075434_1000903673 122
429 3300006871 Ga0075434_100863757 Ga0075434_1008637572 122
430 3300006880 Ga0075429_100324438 Ga0075429_1003244383 122
431 3300006931 Ga0097620_100037921 Ga0097620_1000379217 122
432 3300006931 Ga0097620_100098139 Ga0097620_1000981392 122
433 3300006931 Ga0097620_100192223 Ga0097620_1001922232 122
434 3300006931 Ga0097620_100342830 Ga0097620_1003428302 122
435 3300006931 Ga0097620_100522082 Ga0097620_1005220822 122
436 3300006931 Ga0097620_101449519 Ga0097620_1014495192 122
437 3300009011 Ga0105251_10143568 Ga0105251_101435681 122
438 3300009036 Ga0105244_10267622 Ga0105244_102676222 122
439 3300009093 Ga0105240_10060053 Ga0105240_100600533 122
440 3300009098 Ga0105245_12531042 Ga0105245_125310422 122
441 3300009101 Ga0105247_10005790 Ga0105247_100057908 122
442 3300009101 Ga0105247_10205168 Ga0105247_102051682 122
443 3300009101 Ga0105247_10339198 Ga0105247_103391982 122
444 3300009147 Ga0114129_10071240 Ga0114129_100712402 122
445 3300009147 Ga0114129_10658942 Ga0114129_106589422 122
446 3300009148 Ga0105243_10051584 Ga0105243_100515842 122
447 3300009148 Ga0105243_10114645 Ga0105243_101146452 122
448 3300009174 Ga0105241_10125645 Ga0105241_101256453 122
449 3300009174 Ga0105241_10152074 Ga0105241_101520742 122
450 3300009174 Ga0105241_10743539 Ga0105241_107435393 122
451 3300009174 Ga0105241_11335947 Ga0105241_113359471 122
452 3300009174 Ga0105241_12103645 Ga0105241_121036452 122
453 3300009176 Ga0105242_10011193 Ga0105242_100111935 122
454 3300009176 Ga0105242_10124083 Ga0105242_101240832 122
455 3300009176 Ga0105242_11317883 Ga0105242_113178832 122
456 3300009176 Ga0105242_12867771 Ga0105242_128677712 122
457 3300009177 Ga0105248_10201494 Ga0105248_102014942 122
458 3300009177 Ga0105248_10235158 Ga0105248_102351583 122
459 3300009177 Ga0105248_11503498 Ga0105248_115034982 122
460 3300009177 Ga0105248_11842206 Ga0105248_118422062 122
461 3300009177 Ga0105248_12348213 Ga0105248_123482132 122
462 3300009545 Ga0105237_10014573 Ga0105237_100145738 122
463 3300009545 Ga0105237_12639299 Ga0105237_126392991 122
464 3300009551 Ga0105238_10017924 Ga0105238_100179245 122
465 3300009551 Ga0105238_10789842 Ga0105238_107898421 122
466 3300009553 Ga0105249_10044076 Ga0105249_100440763 122
467 3300009553 Ga0105249_10185268 Ga0105249_101852682 122
468 3300009553 Ga0105249_10723168 Ga0105249_107231682 122
469 3300010375 Ga0105239_12244095 Ga0105239_122440952 122
470 3300010375 Ga0105239_13596447 Ga0105239_135964471 122
471 3300011119 Ga0105246_10170606 Ga0105246_101706062 122
472 3300011119 Ga0105246_10207728 Ga0105246_102077282 122
473 3300011119 Ga0105246_10418723 Ga0105246_104187231 122
474 3300013100 Ga0157373_10001816 Ga0157373_100018167 122
475 3300013100 Ga0157373_10354989 Ga0157373_103549892 122
476 3300013297 Ga0157378_10248542 Ga0157378_102485422 122
477 3300013297 Ga0157378_10582518 Ga0157378_105825182 122
478 3300013306 Ga0163162_10192363 Ga0163162_101923632 122
479 3300013306 Ga0163162_10616183 Ga0163162_106161832 122
480 3300013307 Ga0157372_10042101 Ga0157372_100421012 122
481 3300014325 Ga0163163_10000579 Ga0163163_1000057923 122
482 3300014325 Ga0163163_10514872 Ga0163163_105148722 122
483 3300014325 Ga0163163_11631156 Ga0163163_116311561 122
484 3300014326 Ga0157380_10706303 Ga0157380_107063032 122
485 3300014326 Ga0157380_12751604 Ga0157380_127516042 122
486 3300014745 Ga0157377_10038794 Ga0157377_100387943 122
487 3300014968 Ga0157379_10408161 Ga0157379_104081611 122
488 3300014968 Ga0157379_11078224 Ga0157379_110782242 122
489 3300014968 Ga0157379_11225945 Ga0157379_112259451 122
490 3300025321 Ga0207656_10002824 Ga0207656_100028243 122
491 3300025885 Ga0207653_10002183 Ga0207653_100021834 122
492 3300025899 Ga0207642_10134335 Ga0207642_101343352 122
493 3300025900 Ga0207710_10000462 Ga0207710_1000046218 122
494 3300025900 Ga0207710_10100183 Ga0207710_101001832 122
495 3300025904 Ga0207647_10287545 Ga0207647_102875452 122
496 3300025907 Ga0207645_10658921 Ga0207645_106589211 122
497 3300025910 Ga0207684_10071191 Ga0207684_100711914 122
498 3300025911 Ga0207654_10297306 Ga0207654_102973062 122
499 3300025914 Ga0207671_10004861 Ga0207671_100048615 122
500 3300025917 Ga0207660_10937540 Ga0207660_109375402 122
501 3300025918 Ga0207662_10110381 Ga0207662_101103812 122
502 3300025918 Ga0207662_10214098 Ga0207662_102140981 122
503 3300025918 Ga0207662_10767592 Ga0207662_107675921 122
504 3300025920 Ga0207649_10360327 Ga0207649_103603272 122
505 3300025921 Ga0207652_10350223 Ga0207652_103502233 122
506 3300025922 Ga0207646_10020692 Ga0207646_100206923 122
507 3300025923 Ga0207681_10173737 Ga0207681_101737373 122
508 3300025924 Ga0207694_10017522 Ga0207694_100175227 122
509 3300025925 Ga0207650_10000001 Ga0207650_10000001947 122
510 3300025926 Ga0207659_10397869 Ga0207659_103978692 122
511 3300025927 Ga0207687_10517873 Ga0207687_105178732 122
512 3300025934 Ga0207686_10033760 Ga0207686_100337602 122
513 3300025935 Ga0207709_10016138 Ga0207709_100161382 122
514 3300025936 Ga0207670_10344350 Ga0207670_103443502 122
515 3300025938 Ga0207704_11456031 Ga0207704_114560312 122
516 3300025941 Ga0207711_10463332 Ga0207711_104633322 122
517 3300025941 Ga0207711_11958265 Ga0207711_119582651 122
518 3300025942 Ga0207689_10270363 Ga0207689_102703631 122
519 3300025945 Ga0207679_10072805 Ga0207679_100728053 122
520 3300025945 Ga0207679_10224085 Ga0207679_102240853 122
521 3300025960 Ga0207651_10449190 Ga0207651_104491902 122
522 3300025960 Ga0207651_10949091 Ga0207651_109490912 122
523 3300025961 Ga0207712_10003917 Ga0207712_100039175 122
524 3300025961 Ga0207712_10069153 Ga0207712_100691532 122
525 3300025981 Ga0207640_10634929 Ga0207640_106349292 122
526 3300026023 Ga0207677_10062117 Ga0207677_100621172 122
527 3300026035 Ga0207703_10026878 Ga0207703_100268783 122
528 3300026035 Ga0207703_10075752 Ga0207703_100757523 122
529 3300026035 Ga0207703_10238465 Ga0207703_102384653 122
530 3300026035 Ga0207703_10398337 Ga0207703_103983372 122
531 3300026041 Ga0207639_11294731 Ga0207639_112947312 122
532 3300026075 Ga0207708_10015575 Ga0207708_100155755 122
533 3300026075 Ga0207708_10807361 Ga0207708_108073612 122
534 3300026088 Ga0207641_10099923 Ga0207641_100999233 122
535 3300026088 Ga0207641_10133004 Ga0207641_101330042 122
536 3300026089 Ga0207648_11981037 Ga0207648_119810372 122
537 3300026116 Ga0207674_10395009 Ga0207674_103950092 122
538 3300026116 Ga0207674_10868933 Ga0207674_108689332 122
539 3300026118 Ga0207675_100567366 Ga0207675_1005673662 122
540 3300026118 Ga0207675_100969391 Ga0207675_1009693912 122
541 3300026121 Ga0207683_10866928 Ga0207683_108669282 122
542 3300026142 Ga0207698_10024047 Ga0207698_100240472 122
543 3300026142 Ga0207698_11305551 Ga0207698_113055512 122
544 3300028380 Ga0268265_10842954 Ga0268265_108429542 122
545 3300028380 Ga0268265_11118972 Ga0268265_111189721 122
546 3300028381 Ga0268264_10132949 Ga0268264_101329492 122
547 3300028381 Ga0268264_10264010 Ga0268264_102640103 122
548 3300028381 Ga0268264_11512843 Ga0268264_115128432 122
549 3300028381 Ga0268264_12115774 Ga0268264_121157742 122
550 3300031731 Ga0307405_10088899 Ga0307405_100888992 122
551 3300031901 Ga0307406_10480832 Ga0307406_104808322 122
552 3300031911 Ga0307412_10420901 Ga0307412_104209012 122
553 3300032004 Ga0307414_10228081 Ga0307414_102280812 122
554 3300035088 Ga0373940_0159250 Ga0373940_0159250_249_617 122
555 3300035115 Ga0373941_0269257 Ga0373941_0269257_281_649 122
556 3300046616 Ga0495668_0315007 Ga0495668_0315007_133_501 122
557 3300048910 Ga0496107_0299286 Ga0496107_0299286_67_435 122
558 3300048911 Ga0496108_0369471 Ga0496108_0369471_807_1175 122
559 3300048912 Ga0496109_0408675 Ga0496109_0408675_211_579 122
560 3300048913 Ga0496110_1107160 Ga0496110_1107160_268_636 122
561 3300048915 Ga0496112_0353215 Ga0496112_0353215_713_1081 122
562 3300048915 Ga0496112_0515617 Ga0496112_0515617_663_1091 122
563 3300048915 Ga0496112_0544488 Ga0496112_0544488_516_884 122
564 3300048916 Ga0496113_0131690 Ga0496113_0131690_1119_1487 122
565 3300049665 Ga0501227_002226 Ga0501227_002226_3219_3587 122
566 3300049668 Ga0501233_096500 Ga0501233_096500_61_429 122
567 3300049705 Ga0501225_0031001 Ga0501225_0031001_556_924 122
568 3300049758 Ga0501241_084319 Ga0501241_084319_28_396 122
569 3300050508 nmdc:mga09592_207672_c1 nmdc:mga09592_207672_c1_629_997 122
570 3300050510 nmdc:mga06r32_927427_c1 nmdc:mga06r32_927427_c1_196_564 122
571 3300050512 nmdc:mga0n895_1195222_c1 nmdc:mga0n895_1195222_c1_144_512 122
572 3300050512 nmdc:mga0n895_216901_c1 nmdc:mga0n895_216901_c1_1143_1511 122
573 3300050513 nmdc:mga0rr50_36554_c1 nmdc:mga0rr50_36554_c1_1535_1903 122
574 3300050515 nmdc:mga0a205_65263_c1 nmdc:mga0a205_65263_c1_1803_2171 122
575 3300003322 rootL2_10112742 rootL2_101127422 123
576 3300005295 Ga0065707_10021463 Ga0065707_100214633 123
577 3300005295 Ga0065707_10154189 Ga0065707_101541892 123
578 3300005295 Ga0065707_10319752 Ga0065707_103197522 123
579 3300005331 Ga0070670_100106899 Ga0070670_1001068992 123
580 3300005331 Ga0070670_100519588 Ga0070670_1005195882 123
581 3300005366 Ga0070659_100087826 Ga0070659_1000878263 123
582 3300005458 Ga0070681_10850046 Ga0070681_108500462 123
583 3300005536 Ga0070697_100688230 Ga0070697_1006882301 123
584 3300005577 Ga0068857_100222149 Ga0068857_1002221493 123
585 3300005577 Ga0068857_100404449 Ga0068857_1004044492 123
586 3300005578 Ga0068854_100213665 Ga0068854_1002136653 123
587 3300005578 Ga0068854_100687219 Ga0068854_1006872192 123
588 3300005615 Ga0070702_100162800 Ga0070702_1001628002 123
589 3300005985 Ga0081539_10001736 Ga0081539_1000173613 123
590 3300009147 Ga0114129_10178702 Ga0114129_101787023 123
591 3300009147 Ga0114129_10413383 Ga0114129_104133832 123
592 3300009174 Ga0105241_11082978 Ga0105241_110829782 123
593 3300011119 Ga0105246_10360069 Ga0105246_103600692 123
594 3300013307 Ga0157372_11420328 Ga0157372_114203282 123
595 3300013308 Ga0157375_13134379 Ga0157375_131343791 123
596 3300014325 Ga0163163_10436954 Ga0163163_104369542 123
597 3300025919 Ga0207657_10194759 Ga0207657_101947592 123
598 3300025925 Ga0207650_10123853 Ga0207650_101238532 123
599 3300025925 Ga0207650_10764126 Ga0207650_107641261 123
600 3300025949 Ga0207667_11397057 Ga0207667_113970572 123
601 3300025981 Ga0207640_10504681 Ga0207640_105046812 123
602 3300025981 Ga0207640_11026700 Ga0207640_110267002 123
603 3300026095 Ga0207676_12254757 Ga0207676_122547571 123
604 3300026116 Ga0207674_10083214 Ga0207674_100832144 123
605 3300026116 Ga0207674_10498416 Ga0207674_104984162 123
606 3300028380 Ga0268265_10988145 Ga0268265_109881452 123
607 3300031456 Ga0307513_10270470 Ga0307513_102704702 123
608 3300032005 Ga0307411_11809504 Ga0307411_118095042 123
609 3300035091 Ga0373951_0003402 Ga0373951_0003402_742_1113 123
610 3300035691 Ga0373931_0618527 Ga0373931_0618527_54_425 123
611 3300038996 Ga0242420_001118 Ga0242420_001118_1752_2123 123
612 3300045051 Ga0451576_0442541 Ga0451576_0442541_545_916 123
613 3300048909 Ga0496106_0163516 Ga0496106_0163516_615_986 123
614 3300050507 nmdc:mga05p37_115257_c1 nmdc:mga05p37_115257_c1_587_967 123
615 3300050510 nmdc:mga06r32_1230180_c1 nmdc:mga06r32_1230180_c1_211_582 123
616 3300005471 Ga0070698_100067210 Ga0070698_1000672101 124
617 3300005518 Ga0070699_100664757 Ga0070699_1006647572 124
618 3300005617 Ga0068859_101537346 Ga0068859_1015373462 124
619 3300006844 Ga0075428_100040175 Ga0075428_1000401757 124
620 3300006931 Ga0097620_101537547 Ga0097620_1015375472 124
621 3300009147 Ga0114129_11052381 Ga0114129_110523812 124
622 3300009148 Ga0105243_10777061 Ga0105243_107770612 124
623 3300037466 Ga0395898_0643991 Ga0395898_0643991_315_689 124
624 3300038443 Ga0395901_0820740 Ga0395901_0820740_388_762 124
625 3300005293 Ga0065715_10016019 Ga0065715_100160192 126
626 3300005340 Ga0070689_100595295 Ga0070689_1005952952 126
627 3300005440 Ga0070705_100052214 Ga0070705_1000522142 126
628 3300005444 Ga0070694_100447880 Ga0070694_1004478802 126
629 3300005458 Ga0070681_10001668 Ga0070681_100016684 126
630 3300005518 Ga0070699_100002112 Ga0070699_10000211214 126
631 3300005545 Ga0070695_101039125 Ga0070695_1010391252 126
632 3300005546 Ga0070696_100275971 Ga0070696_1002759713 126
633 3300005547 Ga0070693_100095678 Ga0070693_1000956782 126
634 3300009545 Ga0105237_10359600 Ga0105237_103596002 126
635 3300013100 Ga0157373_10491603 Ga0157373_104916032 126
636 3300014325 Ga0163163_11786558 Ga0163163_117865582 126
637 3300025912 Ga0207707_10005408 Ga0207707_100054087 126
638 3300025914 Ga0207671_10063785 Ga0207671_100637852 126
639 3300025921 Ga0207652_11496882 Ga0207652_114968822 126
640 3300026078 Ga0207702_10298692 Ga0207702_102986922 126
641 3300037418 Ga0395900_0338677 Ga0395900_0338677_999_1451 126
642 3300037466 Ga0395898_0100682 Ga0395898_0100682_1163_1546 126
643 3300037471 Ga0395905_0616491 Ga0395905_0616491_137_520 126
644 3300038443 Ga0395901_0255449 Ga0395901_0255449_393_776 126
645 3300048915 Ga0496112_0297470 Ga0496112_0297470_377_760 126
646 3300005293 Ga0065715_10651856 Ga0065715_106518561 127
647 3300005331 Ga0070670_100758658 Ga0070670_1007586582 127
648 3300005440 Ga0070705_101338611 Ga0070705_1013386112 127
649 3300005577 Ga0068857_100273836 Ga0068857_1002738362 127
650 3300005618 Ga0068864_100514009 Ga0068864_1005140092 127
651 3300006844 Ga0075428_100929704 Ga0075428_1009297042 127
652 3300006846 Ga0075430_100100527 Ga0075430_1001005272 127
653 3300009098 Ga0105245_11388868 Ga0105245_113888682 127
654 3300009174 Ga0105241_10172507 Ga0105241_101725073 127
655 3300025908 Ga0207643_10398853 Ga0207643_103988532 127
656 3300026116 Ga0207674_10406495 Ga0207674_104064953 127
657 3300030733 Ga0314311_1022701 Ga0314311_10227012 127
658 3300031548 Ga0307408_101146393 Ga0307408_1011463931 127
659 3300031901 Ga0307406_11196842 Ga0307406_111968422 127
660 3300032005 Ga0307411_11050740 Ga0307411_110507402 127
661 3300050508 nmdc:mga09592_878230_c1 nmdc:mga09592_878230_c1_24_407 127
662 3300050509 nmdc:mga0qj67_201808_c1 nmdc:mga0qj67_201808_c1_801_1184 127
663 3300000532 CNAas_1000820 CNAas_10008204 128
664 3300005354 Ga0070675_100494554 Ga0070675_1004945542 128
665 3300005844 Ga0068862_100699868 Ga0068862_1006998681 128
666 3300009553 Ga0105249_10066893 Ga0105249_100668934 128
667 3300013306 Ga0163162_10085649 Ga0163162_100856492 128
668 3300025918 Ga0207662_10075960 Ga0207662_100759601 128
669 3300025926 Ga0207659_10887943 Ga0207659_108879431 128
670 3300025961 Ga0207712_10046583 Ga0207712_100465833 128

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

24

138

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qqz-assembly1.cif.gz_B crystal structure of putative glyoxalase family protein from bacillus anthracis 0.8723 1 122
2qqz-assembly1.cif.gz_B crystal structure of putative glyoxalase family protein from bacillus anthracis 0.8461 1 122
4nb0-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus with bs-cys9 disulfide at 1.62 angstrom resolution 0.8167 1 122
7n7g-assembly1.cif.gz_A crystal structure of fosb from enterococcus faecium with fosfomycin 0.8129 1 123
4naz-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus with zn and sulfate at 1.15 angstrom resolution 0.8007 1 123
ID Description Score Start End Superfamily
2qqzB01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8938 7 118 3.10.180.10
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8753 70 120 3.30.720.110
2qqzB01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.857 7 118 3.10.180.10
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8448 71 118 3.30.720.110
4nazA01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8007 1 123 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A2V8PPM9-F1-model_v4 Bleomycin resistance protein 0.9377 3 121
AF-A0A3B9ML07-F1-model_v4 Bleomycin resistance protein 0.9342 3 122
AF-A0A352FVU7-F1-model_v4 Bleomycin resistance protein 0.933 1 122
AF-A0A252DJ89-F1-model_v4 deleted 0.9312 3 123
AF-A0A2V8QT68-F1-model_v4 Bleomycin resistance protein 0.9287 3 122

Feature Viewer

pLDDT pTM Quality
89.04 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map