F474111
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 670 | 237 | 670 | 122 |
Family's Representative Sequence
| Representative Sequence | 3300048915|Ga0496112_0515617|Ga0496112_0515617_663_1091 |
| Length | 142 |
| Sequence | VDVVEYPAKSIGGVQCVFNEMNAKIHHVNITVPKSLEDAAKHFYGVVMGLEEVPKPEDSRGRGGAWYQLGPLQLHLSIENPVGENCISKRHVCYTVSDLAQAEERFRNAGVEIIPDDLPTPGWSRFYVRDPGGNRLEIAQAV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000532 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 3 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 4 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 7 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 39 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 46 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 53 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 55 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 56 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 57 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 59 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 60 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 61 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 62 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 63 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 64 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 65 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 66 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 67 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 68 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 69 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 71 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 72 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 73 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 74 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 75 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 76 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 77 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 78 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 80 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 107 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 159 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 162 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 163 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 164 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 165 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 166 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 167 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 168 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 169 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 170 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 171 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 172 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 173 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 174 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 175 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 176 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 177 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 178 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 179 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 180 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 181 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 182 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 183 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 184 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 185 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 186 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 187 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 188 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 189 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 191 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 192 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 193 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 194 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 195 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 196 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 197 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 198 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 199 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 200 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 201 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 202 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 203 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 204 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 205 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 206 | 3300049655 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought | Metagenome | Rhizosphere |
| 207 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 208 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 209 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 210 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 211 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 212 | 3300049666 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control | Metagenome | Rhizosphere |
| 213 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 214 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 215 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 216 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 217 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 218 | 3300049689 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought | Metagenome | Rhizosphere |
| 219 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 220 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 221 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 222 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 223 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 224 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 225 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 226 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 227 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 228 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 229 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 230 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 231 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 232 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 233 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 234 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 235 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 236 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 2.84 |
| Rhizosphere | 96.87 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.3 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | CNAas_1000820 | 3300000532 | Unclassified | 2956 |
| 2 | JGI24751J29686_10000101 | 3300002459 | Bacteria | 47517 |
| 3 | rootL2_10112742 | 3300003322 | Bacteria | 1499 |
| 4 | Ga0065714_10064522 | 3300005288 | Bacteria | 42339 |
| 5 | Ga0065704_10658195 | 3300005289 | Bacteria | 579 |
| 6 | Ga0065712_10000141 | 3300005290 | Bacteria | 57657 |
| 7 | Ga0065712_10111906 | 3300005290 | Bacteria | 1809 |
| 8 | Ga0065715_10002355 | 3300005293 | Bacteria | 6897 |
| 9 | Ga0065715_10016019 | 3300005293 | Bacteria | 2832 |
| 10 | Ga0065715_10034425 | 3300005293 | Unclassified | 1151 |
| 11 | Ga0065715_10091022 | 3300005293 | Bacteria | 6202 |
| 12 | Ga0065715_10127638 | 3300005293 | Bacteria | 2082 |
| 13 | Ga0065715_10306252 | 3300005293 | Bacteria | 1030 |
| 14 | Ga0065715_10332792 | 3300005293 | Unclassified | 961 |
| 15 | Ga0065715_10451710 | 3300005293 | Bacteria | 803 |
| 16 | Ga0065715_10651856 | 3300005293 | Unclassified | 678 |
| 17 | Ga0065715_10819574 | 3300005293 | Unclassified | 594 |
| 18 | Ga0065715_10960023 | 3300005293 | Unclassified | 556 |
| 19 | Ga0065707_10021463 | 3300005295 | Bacteria | 1266 |
| 20 | Ga0065707_10097033 | 3300005295 | Bacteria | 3207 |
| 21 | Ga0065707_10154189 | 3300005295 | Bacteria | 1626 |
| 22 | Ga0065707_10319752 | 3300005295 | Bacteria | 913 |
| 23 | Ga0065707_10346491 | 3300005295 | Bacteria | 925 |
| 24 | Ga0065707_11071872 | 3300005295 | Bacteria | 522 |
| 25 | Ga0070676_10711942 | 3300005328 | Unclassified | 734 |
| 26 | Ga0070676_11044825 | 3300005328 | Unclassified | 615 |
| 27 | Ga0070683_100217404 | 3300005329 | Bacteria | 1816 |
| 28 | Ga0070690_100776708 | 3300005330 | Bacteria | 741 |
| 29 | Ga0070670_100000475 | 3300005331 | Bacteria | 32303 |
| 30 | Ga0070670_100043591 | 3300005331 | Bacteria | 3856 |
| 31 | Ga0070670_100106899 | 3300005331 | Bacteria | 2411 |
| 32 | Ga0070670_100156139 | 3300005331 | Bacteria | 1976 |
| 33 | Ga0070670_100519588 | 3300005331 | Unclassified | 1060 |
| 34 | Ga0070670_100703186 | 3300005331 | Unclassified | 909 |
| 35 | Ga0070670_100758658 | 3300005331 | Bacteria | 875 |
| 36 | Ga0068869_100050373 | 3300005334 | Bacteria | 3018 |
| 37 | Ga0068869_100085910 | 3300005334 | Bacteria | 2357 |
| 38 | Ga0068869_100125983 | 3300005334 | Bacteria | 1964 |
| 39 | Ga0068869_100192992 | 3300005334 | Bacteria | 1602 |
| 40 | Ga0068869_100215780 | 3300005334 | Bacteria | 1519 |
| 41 | Ga0068869_100302857 | 3300005334 | Bacteria | 1291 |
| 42 | Ga0068869_101108666 | 3300005334 | Unclassified | 693 |
| 43 | Ga0068869_101470142 | 3300005334 | Bacteria | 604 |
| 44 | Ga0070680_100058911 | 3300005336 | Bacteria | 3141 |
| 45 | Ga0070682_100006343 | 3300005337 | Bacteria | 6639 |
| 46 | Ga0070682_100107073 | 3300005337 | Bacteria | 1856 |
| 47 | Ga0068868_100218084 | 3300005338 | Bacteria | 1596 |
| 48 | Ga0070660_100169414 | 3300005339 | Bacteria | 1763 |
| 49 | Ga0070689_100022847 | 3300005340 | Bacteria | 4675 |
| 50 | Ga0070689_100595295 | 3300005340 | Bacteria | 957 |
| 51 | Ga0070689_101031655 | 3300005340 | Unclassified | 733 |
| 52 | Ga0070689_101113840 | 3300005340 | Unclassified | 706 |
| 53 | Ga0070689_101562495 | 3300005340 | Unclassified | 598 |
| 54 | Ga0070687_100094232 | 3300005343 | Bacteria | 1663 |
| 55 | Ga0070687_100173675 | 3300005343 | Bacteria | 1285 |
| 56 | Ga0070687_100707606 | 3300005343 | Unclassified | 704 |
| 57 | Ga0070661_100108210 | 3300005344 | Bacteria | 2074 |
| 58 | Ga0070661_100419841 | 3300005344 | Bacteria | 1060 |
| 59 | Ga0070692_10002398 | 3300005345 | Bacteria | 7259 |
| 60 | Ga0070692_10052746 | 3300005345 | Bacteria | 2119 |
| 61 | Ga0070692_10101340 | 3300005345 | Bacteria | 1579 |
| 62 | Ga0070692_10326338 | 3300005345 | Bacteria | 946 |
| 63 | Ga0070669_100282450 | 3300005353 | Bacteria | 1330 |
| 64 | Ga0070669_100338258 | 3300005353 | Unclassified | 1219 |
| 65 | Ga0070675_100494554 | 3300005354 | Bacteria | 1101 |
| 66 | Ga0070675_101301953 | 3300005354 | Unclassified | 670 |
| 67 | Ga0070675_101828585 | 3300005354 | Unclassified | 560 |
| 68 | Ga0070671_100752360 | 3300005355 | Bacteria | 847 |
| 69 | Ga0070674_100161611 | 3300005356 | Bacteria | 1700 |
| 70 | Ga0070673_100034472 | 3300005364 | Bacteria | 3831 |
| 71 | Ga0070673_100099071 | 3300005364 | Bacteria | 2397 |
| 72 | Ga0070673_100810904 | 3300005364 | Unclassified | 865 |
| 73 | Ga0070688_100597056 | 3300005365 | Unclassified | 844 |
| 74 | Ga0070688_100927297 | 3300005365 | Unclassified | 688 |
| 75 | Ga0070659_100000911 | 3300005366 | Bacteria | 21621 |
| 76 | Ga0070659_100087826 | 3300005366 | Unclassified | 2490 |
| 77 | Ga0070659_100915422 | 3300005366 | Unclassified | 767 |
| 78 | Ga0070703_10001572 | 3300005406 | Bacteria | 6800 |
| 79 | Ga0070703_10270434 | 3300005406 | Unclassified | 697 |
| 80 | Ga0070701_10233041 | 3300005438 | Bacteria | 1104 |
| 81 | Ga0070701_10614911 | 3300005438 | Unclassified | 721 |
| 82 | Ga0070701_10860115 | 3300005438 | Unclassified | 623 |
| 83 | Ga0070705_100052214 | 3300005440 | Bacteria | 2387 |
| 84 | Ga0070705_101338611 | 3300005440 | Unclassified | 595 |
| 85 | Ga0070700_100000123 | 3300005441 | Bacteria | 47619 |
| 86 | Ga0070700_100011786 | 3300005441 | Bacteria | 4852 |
| 87 | Ga0070700_100347720 | 3300005441 | Unclassified | 1098 |
| 88 | Ga0070694_100007732 | 3300005444 | Bacteria | 6559 |
| 89 | Ga0070694_100009290 | 3300005444 | Bacteria | 6034 |
| 90 | Ga0070694_100038672 | 3300005444 | Bacteria | 3171 |
| 91 | Ga0070694_100116574 | 3300005444 | Bacteria | 1910 |
| 92 | Ga0070694_100447880 | 3300005444 | Bacteria | 1019 |
| 93 | Ga0070694_100564578 | 3300005444 | Bacteria | 913 |
| 94 | Ga0070694_100582609 | 3300005444 | Bacteria | 899 |
| 95 | Ga0070694_100843083 | 3300005444 | Unclassified | 754 |
| 96 | Ga0070708_100143759 | 3300005445 | Bacteria | 2214 |
| 97 | Ga0070663_100328255 | 3300005455 | Bacteria | 1232 |
| 98 | Ga0070662_100185724 | 3300005457 | Bacteria | 1641 |
| 99 | Ga0070662_101717868 | 3300005457 | Bacteria | 542 |
| 100 | Ga0070681_10000285 | 3300005458 | Bacteria | 40740 |
| 101 | Ga0070681_10001668 | 3300005458 | Bacteria | 19805 |
| 102 | Ga0070681_10004771 | 3300005458 | Bacteria | 12991 |
| 103 | Ga0070681_10850046 | 3300005458 | Bacteria | 830 |
| 104 | Ga0068867_100541932 | 3300005459 | Unclassified | 1006 |
| 105 | Ga0070706_100000998 | 3300005467 | Bacteria | 30735 |
| 106 | Ga0070706_100010344 | 3300005467 | Bacteria | 8667 |
| 107 | Ga0070707_100000452 | 3300005468 | Bacteria | 40667 |
| 108 | Ga0070707_100012015 | 3300005468 | Bacteria | 8082 |
| 109 | Ga0070707_100251053 | 3300005468 | Bacteria | 1722 |
| 110 | Ga0070698_100011196 | 3300005471 | Bacteria | 9531 |
| 111 | Ga0070698_100067210 | 3300005471 | Bacteria | 3605 |
| 112 | Ga0070698_100323623 | 3300005471 | Bacteria | 1473 |
| 113 | Ga0070698_101775942 | 3300005471 | Unclassified | 569 |
| 114 | Ga0070699_100000440 | 3300005518 | Bacteria | 39933 |
| 115 | Ga0070699_100002112 | 3300005518 | Bacteria | 18025 |
| 116 | Ga0070699_100148029 | 3300005518 | Bacteria | 2075 |
| 117 | Ga0070699_100247135 | 3300005518 | Bacteria | 1593 |
| 118 | Ga0070699_100292372 | 3300005518 | Bacteria | 1461 |
| 119 | Ga0070699_100382353 | 3300005518 | Bacteria | 1271 |
| 120 | Ga0070699_100664757 | 3300005518 | Unclassified | 951 |
| 121 | Ga0070699_101497300 | 3300005518 | Unclassified | 619 |
| 122 | Ga0070679_100000348 | 3300005530 | Bacteria | 39245 |
| 123 | Ga0070679_100025802 | 3300005530 | Bacteria | 5767 |
| 124 | Ga0070679_100457384 | 3300005530 | Bacteria | 1221 |
| 125 | Ga0070697_100001682 | 3300005536 | Bacteria | 16890 |
| 126 | Ga0070697_100089148 | 3300005536 | Bacteria | 2548 |
| 127 | Ga0070697_100143354 | 3300005536 | Bacteria | 2010 |
| 128 | Ga0070697_100688230 | 3300005536 | Bacteria | 902 |
| 129 | Ga0070697_101557561 | 3300005536 | Unclassified | 591 |
| 130 | Ga0070697_101796058 | 3300005536 | Unclassified | 548 |
| 131 | Ga0068853_100004711 | 3300005539 | Bacteria | 10587 |
| 132 | Ga0068853_100016076 | 3300005539 | Bacteria | 6155 |
| 133 | Ga0068853_100715209 | 3300005539 | Unclassified | 956 |
| 134 | Ga0068853_101412181 | 3300005539 | Bacteria | 673 |
| 135 | Ga0070672_100567005 | 3300005543 | Unclassified | 987 |
| 136 | Ga0070686_100022421 | 3300005544 | Bacteria | 3761 |
| 137 | Ga0070695_100052711 | 3300005545 | Bacteria | 2615 |
| 138 | Ga0070695_100338782 | 3300005545 | Unclassified | 1123 |
| 139 | Ga0070695_101039125 | 3300005545 | Bacteria | 668 |
| 140 | Ga0070696_100011189 | 3300005546 | Bacteria | 6005 |
| 141 | Ga0070696_100275971 | 3300005546 | Bacteria | 1280 |
| 142 | Ga0070696_100797318 | 3300005546 | Unclassified | 777 |
| 143 | Ga0070696_101009132 | 3300005546 | Bacteria | 696 |
| 144 | Ga0070693_100001087 | 3300005547 | Bacteria | 12187 |
| 145 | Ga0070693_100095678 | 3300005547 | Bacteria | 1799 |
| 146 | Ga0070693_100721699 | 3300005547 | Unclassified | 732 |
| 147 | Ga0070693_101621598 | 3300005547 | Unclassified | 509 |
| 148 | Ga0070704_100007720 | 3300005549 | Bacteria | 6413 |
| 149 | Ga0070704_100504089 | 3300005549 | Bacteria | 1051 |
| 150 | Ga0070704_100664130 | 3300005549 | Unclassified | 921 |
| 151 | Ga0068855_100707764 | 3300005563 | Bacteria | 1077 |
| 152 | Ga0070664_100001827 | 3300005564 | Bacteria | 17039 |
| 153 | Ga0070664_100050933 | 3300005564 | Bacteria | 3505 |
| 154 | Ga0070664_100244170 | 3300005564 | Bacteria | 1612 |
| 155 | Ga0070664_100448947 | 3300005564 | Bacteria | 1184 |
| 156 | Ga0070664_102356107 | 3300005564 | Unclassified | 505 |
| 157 | Ga0068857_100001397 | 3300005577 | Bacteria | 19057 |
| 158 | Ga0068857_100222149 | 3300005577 | Bacteria | 1726 |
| 159 | Ga0068857_100273836 | 3300005577 | Bacteria | 1552 |
| 160 | Ga0068857_100404449 | 3300005577 | Bacteria | 1271 |
| 161 | Ga0068857_100467626 | 3300005577 | Bacteria | 1181 |
| 162 | Ga0068857_100790504 | 3300005577 | Unclassified | 906 |
| 163 | Ga0068857_101268337 | 3300005577 | Bacteria | 715 |
| 164 | Ga0068857_101706882 | 3300005577 | Unclassified | 616 |
| 165 | Ga0068854_100045048 | 3300005578 | Bacteria | 3135 |
| 166 | Ga0068854_100166422 | 3300005578 | Bacteria | 1712 |
| 167 | Ga0068854_100213665 | 3300005578 | Bacteria | 1523 |
| 168 | Ga0068854_100403891 | 3300005578 | Unclassified | 1131 |
| 169 | Ga0068854_100687219 | 3300005578 | Unclassified | 882 |
| 170 | Ga0068856_100084062 | 3300005614 | Unclassified | 3161 |
| 171 | Ga0070702_100010067 | 3300005615 | Bacteria | 4646 |
| 172 | Ga0070702_100047116 | 3300005615 | Bacteria | 2447 |
| 173 | Ga0070702_100129709 | 3300005615 | Bacteria | 1590 |
| 174 | Ga0070702_100162800 | 3300005615 | Unclassified | 1444 |
| 175 | Ga0070702_100249309 | 3300005615 | Unclassified | 1203 |
| 176 | Ga0070702_100886563 | 3300005615 | Bacteria | 697 |
| 177 | Ga0068852_102410758 | 3300005616 | Unclassified | 547 |
| 178 | Ga0068859_100009209 | 3300005617 | Bacteria | 9973 |
| 179 | Ga0068859_100037923 | 3300005617 | Bacteria | 4836 |
| 180 | Ga0068859_100098139 | 3300005617 | Bacteria | 2984 |
| 181 | Ga0068859_100136315 | 3300005617 | Unclassified | 2527 |
| 182 | Ga0068859_100192228 | 3300005617 | Bacteria | 2125 |
| 183 | Ga0068859_100222227 | 3300005617 | Bacteria | 1976 |
| 184 | Ga0068859_100342820 | 3300005617 | Bacteria | 1588 |
| 185 | Ga0068859_100446307 | 3300005617 | Bacteria | 1390 |
| 186 | Ga0068859_100522093 | 3300005617 | Bacteria | 1282 |
| 187 | Ga0068859_100606423 | 3300005617 | Unclassified | 1188 |
| 188 | Ga0068859_100647243 | 3300005617 | Bacteria | 1149 |
| 189 | Ga0068859_100765395 | 3300005617 | Bacteria | 1054 |
| 190 | Ga0068859_101449483 | 3300005617 | Unclassified | 757 |
| 191 | Ga0068859_101450387 | 3300005617 | Bacteria | 757 |
| 192 | Ga0068859_101537346 | 3300005617 | Unclassified | 735 |
| 193 | Ga0068864_100034755 | 3300005618 | Bacteria | 4289 |
| 194 | Ga0068864_100087390 | 3300005618 | Bacteria | 2744 |
| 195 | Ga0068864_100142795 | 3300005618 | Bacteria | 2161 |
| 196 | Ga0068864_100161378 | 3300005618 | Bacteria | 2038 |
| 197 | Ga0068864_100334778 | 3300005618 | Bacteria | 1425 |
| 198 | Ga0068864_100514009 | 3300005618 | Bacteria | 1154 |
| 199 | Ga0068864_100771211 | 3300005618 | Unclassified | 943 |
| 200 | Ga0068864_100810254 | 3300005618 | Unclassified | 921 |
| 201 | Ga0068864_100994297 | 3300005618 | Bacteria | 832 |
| 202 | Ga0068864_102086743 | 3300005618 | Bacteria | 573 |
| 203 | Ga0068861_100779045 | 3300005719 | Unclassified | 896 |
| 204 | Ga0068861_101992317 | 3300005719 | Unclassified | 579 |
| 205 | Ga0068851_10000589 | 3300005834 | Bacteria | 15769 |
| 206 | Ga0068870_10077638 | 3300005840 | Bacteria | 1827 |
| 207 | Ga0068870_10100569 | 3300005840 | Bacteria | 1633 |
| 208 | Ga0068870_10173215 | 3300005840 | Bacteria | 1289 |
| 209 | Ga0068870_10503433 | 3300005840 | Bacteria | 808 |
| 210 | Ga0068870_10536240 | 3300005840 | Unclassified | 786 |
| 211 | Ga0068870_11299631 | 3300005840 | Unclassified | 530 |
| 212 | Ga0068863_100003484 | 3300005841 | Bacteria | 15523 |
| 213 | Ga0068863_100130663 | 3300005841 | Bacteria | 2398 |
| 214 | Ga0068863_100214776 | 3300005841 | Bacteria | 1852 |
| 215 | Ga0068863_100452943 | 3300005841 | Bacteria | 1260 |
| 216 | Ga0068863_100455727 | 3300005841 | Bacteria | 1255 |
| 217 | Ga0068858_100027685 | 3300005842 | Bacteria | 5266 |
| 218 | Ga0068858_100199259 | 3300005842 | Unclassified | 1893 |
| 219 | Ga0068858_100391856 | 3300005842 | Unclassified | 1334 |
| 220 | Ga0068858_100566653 | 3300005842 | Bacteria | 1100 |
| 221 | Ga0068858_100738750 | 3300005842 | Unclassified | 958 |
| 222 | Ga0068858_100940877 | 3300005842 | Bacteria | 846 |
| 223 | Ga0068858_101295690 | 3300005842 | Unclassified | 717 |
| 224 | Ga0068860_100130990 | 3300005843 | Bacteria | 2406 |
| 225 | Ga0068860_100259981 | 3300005843 | Unclassified | 1692 |
| 226 | Ga0068860_100423216 | 3300005843 | Unclassified | 1320 |
| 227 | Ga0068860_100508157 | 3300005843 | Bacteria | 1204 |
| 228 | Ga0068862_100169536 | 3300005844 | Bacteria | 1954 |
| 229 | Ga0068862_100230906 | 3300005844 | Unclassified | 1678 |
| 230 | Ga0068862_100289594 | 3300005844 | Bacteria | 1503 |
| 231 | Ga0068862_100409096 | 3300005844 | Bacteria | 1271 |
| 232 | Ga0068862_100699868 | 3300005844 | Bacteria | 981 |
| 233 | Ga0068862_100889241 | 3300005844 | Unclassified | 875 |
| 234 | Ga0068862_101563737 | 3300005844 | Bacteria | 666 |
| 235 | Ga0068862_102514807 | 3300005844 | Unclassified | 527 |
| 236 | Ga0081539_10001736 | 3300005985 | Bacteria | 34824 |
| 237 | Ga0097621_100303917 | 3300006237 | Bacteria | 1410 |
| 238 | Ga0068871_100423003 | 3300006358 | Unclassified | 1190 |
| 239 | Ga0068871_100745640 | 3300006358 | Unclassified | 900 |
| 240 | Ga0075428_100040175 | 3300006844 | Bacteria | 5149 |
| 241 | Ga0075428_100929704 | 3300006844 | Unclassified | 922 |
| 242 | Ga0075430_100026096 | 3300006846 | Bacteria | 4971 |
| 243 | Ga0075430_100100527 | 3300006846 | Bacteria | 2415 |
| 244 | Ga0075431_100086819 | 3300006847 | Viruses | 3228 |
| 245 | Ga0075431_100094215 | 3300006847 | Bacteria | 3090 |
| 246 | Ga0075431_100489721 | 3300006847 | Unclassified | 1222 |
| 247 | Ga0075433_10017740 | 3300006852 | Bacteria | 5905 |
| 248 | Ga0075433_10049877 | 3300006852 | Bacteria | 3642 |
| 249 | Ga0075433_10125283 | 3300006852 | Bacteria | 2282 |
| 250 | Ga0075433_10215142 | 3300006852 | Bacteria | 1708 |
| 251 | Ga0075433_10408113 | 3300006852 | Bacteria | 1198 |
| 252 | Ga0075433_10744717 | 3300006852 | Bacteria | 857 |
| 253 | Ga0075433_11842829 | 3300006852 | Bacteria | 520 |
| 254 | Ga0075434_100090367 | 3300006871 | Bacteria | 3064 |
| 255 | Ga0075434_100204958 | 3300006871 | Bacteria | 1992 |
| 256 | Ga0075434_100827817 | 3300006871 | Bacteria | 941 |
| 257 | Ga0075434_100863757 | 3300006871 | Unclassified | 920 |
| 258 | Ga0075429_100027099 | 3300006880 | Bacteria | 4974 |
| 259 | Ga0075429_100324438 | 3300006880 | Unclassified | 1347 |
| 260 | Ga0075436_100207715 | 3300006914 | Unclassified | 1388 |
| 261 | Ga0075436_100333045 | 3300006914 | Bacteria | 1092 |
| 262 | Ga0097620_100009209 | 3300006931 | Bacteria | 9973 |
| 263 | Ga0097620_100037921 | 3300006931 | Bacteria | 4836 |
| 264 | Ga0097620_100098139 | 3300006931 | Bacteria | 2984 |
| 265 | Ga0097620_100136319 | 3300006931 | Unclassified | 2527 |
| 266 | Ga0097620_100192223 | 3300006931 | Bacteria | 2125 |
| 267 | Ga0097620_100222224 | 3300006931 | Bacteria | 1976 |
| 268 | Ga0097620_100342830 | 3300006931 | Bacteria | 1588 |
| 269 | Ga0097620_100446295 | 3300006931 | Bacteria | 1390 |
| 270 | Ga0097620_100522082 | 3300006931 | Bacteria | 1282 |
| 271 | Ga0097620_100606419 | 3300006931 | Unclassified | 1188 |
| 272 | Ga0097620_100647226 | 3300006931 | Bacteria | 1149 |
| 273 | Ga0097620_100765231 | 3300006931 | Bacteria | 1054 |
| 274 | Ga0097620_101449519 | 3300006931 | Unclassified | 757 |
| 275 | Ga0097620_101450818 | 3300006931 | Bacteria | 757 |
| 276 | Ga0097620_101537547 | 3300006931 | Unclassified | 735 |
| 277 | Ga0075435_100204664 | 3300007076 | Bacteria | 1673 |
| 278 | Ga0105251_10143568 | 3300009011 | Bacteria | 1080 |
| 279 | Ga0105244_10267622 | 3300009036 | Unclassified | 794 |
| 280 | Ga0105240_10060053 | 3300009093 | Bacteria | 4741 |
| 281 | Ga0111539_10137924 | 3300009094 | Bacteria | 2856 |
| 282 | Ga0111539_11060744 | 3300009094 | Bacteria | 942 |
| 283 | Ga0105245_11388868 | 3300009098 | Unclassified | 752 |
| 284 | Ga0105245_12101708 | 3300009098 | Bacteria | 618 |
| 285 | Ga0105245_12531042 | 3300009098 | Unclassified | 566 |
| 286 | Ga0105247_10005790 | 3300009101 | Bacteria | 7740 |
| 287 | Ga0105247_10091435 | 3300009101 | Bacteria | 1933 |
| 288 | Ga0105247_10205168 | 3300009101 | Bacteria | 1327 |
| 289 | Ga0105247_10339198 | 3300009101 | Bacteria | 1054 |
| 290 | Ga0105247_10631914 | 3300009101 | Unclassified | 798 |
| 291 | Ga0114129_10044807 | 3300009147 | Bacteria | 6222 |
| 292 | Ga0114129_10071240 | 3300009147 | Bacteria | 4847 |
| 293 | Ga0114129_10121949 | 3300009147 | Bacteria | 3587 |
| 294 | Ga0114129_10178702 | 3300009147 | Bacteria | 2889 |
| 295 | Ga0114129_10212484 | 3300009147 | Bacteria | 2615 |
| 296 | Ga0114129_10413383 | 3300009147 | Bacteria | 1776 |
| 297 | Ga0114129_10481177 | 3300009147 | Bacteria | 1624 |
| 298 | Ga0114129_10658942 | 3300009147 | Bacteria | 1350 |
| 299 | Ga0114129_10883816 | 3300009147 | Unclassified | 1134 |
| 300 | Ga0114129_11052381 | 3300009147 | Bacteria | 1022 |
| 301 | Ga0114129_11301993 | 3300009147 | Bacteria | 901 |
| 302 | Ga0114129_11373546 | 3300009147 | Unclassified | 873 |
| 303 | Ga0114129_12335066 | 3300009147 | Unclassified | 641 |
| 304 | Ga0105243_10051584 | 3300009148 | Bacteria | 3254 |
| 305 | Ga0105243_10114645 | 3300009148 | Bacteria | 2261 |
| 306 | Ga0105243_10777061 | 3300009148 | Bacteria | 942 |
| 307 | Ga0105243_12165098 | 3300009148 | Unclassified | 592 |
| 308 | Ga0105241_10056018 | 3300009174 | Bacteria | 3022 |
| 309 | Ga0105241_10125645 | 3300009174 | Bacteria | 2071 |
| 310 | Ga0105241_10152074 | 3300009174 | Bacteria | 1894 |
| 311 | Ga0105241_10162803 | 3300009174 | Bacteria | 1835 |
| 312 | Ga0105241_10172507 | 3300009174 | Bacteria | 1787 |
| 313 | Ga0105241_10743539 | 3300009174 | Bacteria | 899 |
| 314 | Ga0105241_11082978 | 3300009174 | Bacteria | 754 |
| 315 | Ga0105241_11143457 | 3300009174 | Bacteria | 735 |
| 316 | Ga0105241_11335947 | 3300009174 | Unclassified | 684 |
| 317 | Ga0105241_11480404 | 3300009174 | Unclassified | 653 |
| 318 | Ga0105241_12103645 | 3300009174 | Unclassified | 558 |
| 319 | Ga0105242_10011193 | 3300009176 | Bacteria | 6892 |
| 320 | Ga0105242_10124083 | 3300009176 | Bacteria | 2220 |
| 321 | Ga0105242_10888184 | 3300009176 | Unclassified | 890 |
| 322 | Ga0105242_11317883 | 3300009176 | Unclassified | 746 |
| 323 | Ga0105242_11607732 | 3300009176 | Unclassified | 684 |
| 324 | Ga0105242_12867771 | 3300009176 | Bacteria | 532 |
| 325 | Ga0105248_10069136 | 3300009177 | Bacteria | 3965 |
| 326 | Ga0105248_10134451 | 3300009177 | Bacteria | 2790 |
| 327 | Ga0105248_10201494 | 3300009177 | Bacteria | 2242 |
| 328 | Ga0105248_10235158 | 3300009177 | Bacteria | 2063 |
| 329 | Ga0105248_11503498 | 3300009177 | Bacteria | 762 |
| 330 | Ga0105248_11842206 | 3300009177 | Unclassified | 686 |
| 331 | Ga0105248_12348213 | 3300009177 | Unclassified | 607 |
| 332 | Ga0105237_10014573 | 3300009545 | Bacteria | 8215 |
| 333 | Ga0105237_10359600 | 3300009545 | Bacteria | 1460 |
| 334 | Ga0105237_12639299 | 3300009545 | Unclassified | 513 |
| 335 | Ga0105238_10017924 | 3300009551 | Bacteria | 7199 |
| 336 | Ga0105238_10789842 | 3300009551 | Bacteria | 965 |
| 337 | Ga0105249_10044076 | 3300009553 | Bacteria | 4057 |
| 338 | Ga0105249_10066893 | 3300009553 | Bacteria | 3309 |
| 339 | Ga0105249_10132631 | 3300009553 | Bacteria | 2380 |
| 340 | Ga0105249_10185268 | 3300009553 | Bacteria | 2028 |
| 341 | Ga0105249_10320253 | 3300009553 | Unclassified | 1562 |
| 342 | Ga0105249_10383775 | 3300009553 | Bacteria | 1431 |
| 343 | Ga0105249_10723168 | 3300009553 | Bacteria | 1057 |
| 344 | Ga0105249_12005203 | 3300009553 | Bacteria | 651 |
| 345 | Ga0105239_10423198 | 3300010375 | Bacteria | 1509 |
| 346 | Ga0105239_12244095 | 3300010375 | Unclassified | 635 |
| 347 | Ga0105239_13596447 | 3300010375 | Unclassified | 504 |
| 348 | Ga0105246_10170606 | 3300011119 | Bacteria | 1666 |
| 349 | Ga0105246_10207728 | 3300011119 | Bacteria | 1526 |
| 350 | Ga0105246_10360069 | 3300011119 | Unclassified | 1195 |
| 351 | Ga0105246_10418723 | 3300011119 | Bacteria | 1117 |
| 352 | Ga0157373_10001816 | 3300013100 | Bacteria | 16250 |
| 353 | Ga0157373_10033103 | 3300013100 | Bacteria | 3721 |
| 354 | Ga0157373_10354989 | 3300013100 | Unclassified | 1046 |
| 355 | Ga0157373_10491603 | 3300013100 | Bacteria | 886 |
| 356 | Ga0157374_10041844 | 3300013296 | Bacteria | 4224 |
| 357 | Ga0157374_11995922 | 3300013296 | Bacteria | 606 |
| 358 | Ga0157378_10248542 | 3300013297 | Unclassified | 1702 |
| 359 | Ga0157378_10411773 | 3300013297 | Bacteria | 1334 |
| 360 | Ga0157378_10582518 | 3300013297 | Unclassified | 1128 |
| 361 | Ga0157378_10974548 | 3300013297 | Bacteria | 881 |
| 362 | Ga0157378_12159566 | 3300013297 | Bacteria | 608 |
| 363 | Ga0163162_10085649 | 3300013306 | Bacteria | 3228 |
| 364 | Ga0163162_10192363 | 3300013306 | Bacteria | 2168 |
| 365 | Ga0163162_10616183 | 3300013306 | Bacteria | 1211 |
| 366 | Ga0157372_10042101 | 3300013307 | Bacteria | 5050 |
| 367 | Ga0157372_11037357 | 3300013307 | Unclassified | 949 |
| 368 | Ga0157372_11374777 | 3300013307 | Unclassified | 814 |
| 369 | Ga0157372_11420328 | 3300013307 | Unclassified | 800 |
| 370 | Ga0157375_10052699 | 3300013308 | Bacteria | 4001 |
| 371 | Ga0157375_10154114 | 3300013308 | Bacteria | 2435 |
| 372 | Ga0157375_10893985 | 3300013308 | Unclassified | 1032 |
| 373 | Ga0157375_11352986 | 3300013308 | Bacteria | 838 |
| 374 | Ga0157375_12818519 | 3300013308 | Unclassified | 581 |
| 375 | Ga0157375_13134379 | 3300013308 | Unclassified | 552 |
| 376 | Ga0163163_10000579 | 3300014325 | Bacteria | 32232 |
| 377 | Ga0163163_10003419 | 3300014325 | Bacteria | 13488 |
| 378 | Ga0163163_10076791 | 3300014325 | Bacteria | 3336 |
| 379 | Ga0163163_10308566 | 3300014325 | Bacteria | 1635 |
| 380 | Ga0163163_10436954 | 3300014325 | Bacteria | 1368 |
| 381 | Ga0163163_10514872 | 3300014325 | Bacteria | 1259 |
| 382 | Ga0163163_11631156 | 3300014325 | Unclassified | 706 |
| 383 | Ga0163163_11786558 | 3300014325 | Bacteria | 675 |
| 384 | Ga0157380_10000349 | 3300014326 | Bacteria | 27635 |
| 385 | Ga0157380_10064921 | 3300014326 | Bacteria | 2932 |
| 386 | Ga0157380_10285760 | 3300014326 | Bacteria | 1512 |
| 387 | Ga0157380_10706303 | 3300014326 | Unclassified | 1014 |
| 388 | Ga0157380_12751604 | 3300014326 | Unclassified | 558 |
| 389 | Ga0157377_10038794 | 3300014745 | Bacteria | 2632 |
| 390 | Ga0157377_10165601 | 3300014745 | Bacteria | 1378 |
| 391 | Ga0157377_10265805 | 3300014745 | Bacteria | 1118 |
| 392 | Ga0157377_10461049 | 3300014745 | Bacteria | 880 |
| 393 | Ga0157379_10408161 | 3300014968 | Bacteria | 1249 |
| 394 | Ga0157379_11078224 | 3300014968 | Unclassified | 769 |
| 395 | Ga0157379_11225945 | 3300014968 | Unclassified | 722 |
| 396 | Ga0182007_10195680 | 3300015262 | Unclassified | 705 |
| 397 | Ga0182007_10365838 | 3300015262 | Bacteria | 545 |
| 398 | Ga0207656_10002824 | 3300025321 | Bacteria | 5912 |
| 399 | Ga0207653_10002183 | 3300025885 | Bacteria | 6233 |
| 400 | Ga0207682_10240422 | 3300025893 | Bacteria | 841 |
| 401 | Ga0207642_10134335 | 3300025899 | Bacteria | 1296 |
| 402 | Ga0207710_10000462 | 3300025900 | Bacteria | 26063 |
| 403 | Ga0207710_10100183 | 3300025900 | Unclassified | 1365 |
| 404 | Ga0207710_10124133 | 3300025900 | Unclassified | 1235 |
| 405 | Ga0207647_10287545 | 3300025904 | Bacteria | 938 |
| 406 | Ga0207645_10658921 | 3300025907 | Unclassified | 711 |
| 407 | Ga0207643_10001491 | 3300025908 | Bacteria | 13402 |
| 408 | Ga0207643_10296049 | 3300025908 | Bacteria | 1006 |
| 409 | Ga0207643_10398853 | 3300025908 | Bacteria | 869 |
| 410 | Ga0207643_10421868 | 3300025908 | Bacteria | 846 |
| 411 | Ga0207684_10000286 | 3300025910 | Bacteria | 72634 |
| 412 | Ga0207684_10071191 | 3300025910 | Bacteria | 2955 |
| 413 | Ga0207654_10198487 | 3300025911 | Unclassified | 1319 |
| 414 | Ga0207654_10297306 | 3300025911 | Bacteria | 1097 |
| 415 | Ga0207707_10005408 | 3300025912 | Bacteria | 11167 |
| 416 | Ga0207671_10004861 | 3300025914 | Bacteria | 12643 |
| 417 | Ga0207671_10063785 | 3300025914 | Bacteria | 2738 |
| 418 | Ga0207660_10303911 | 3300025917 | Bacteria | 1271 |
| 419 | Ga0207660_10937540 | 3300025917 | Unclassified | 706 |
| 420 | Ga0207662_10075960 | 3300025918 | Bacteria | 2041 |
| 421 | Ga0207662_10110381 | 3300025918 | Bacteria | 1714 |
| 422 | Ga0207662_10214098 | 3300025918 | Bacteria | 1252 |
| 423 | Ga0207662_10767592 | 3300025918 | Unclassified | 678 |
| 424 | Ga0207657_10194759 | 3300025919 | Unclassified | 1633 |
| 425 | Ga0207649_10078720 | 3300025920 | Bacteria | 2128 |
| 426 | Ga0207649_10360327 | 3300025920 | Bacteria | 1079 |
| 427 | Ga0207652_10240545 | 3300025921 | Bacteria | 1632 |
| 428 | Ga0207652_10350223 | 3300025921 | Bacteria | 1333 |
| 429 | Ga0207652_11496882 | 3300025921 | Unclassified | 579 |
| 430 | Ga0207646_10000798 | 3300025922 | Bacteria | 41005 |
| 431 | Ga0207646_10020692 | 3300025922 | Bacteria | 6093 |
| 432 | Ga0207681_10151330 | 3300025923 | Bacteria | 1739 |
| 433 | Ga0207681_10173737 | 3300025923 | Bacteria | 1635 |
| 434 | Ga0207694_10017522 | 3300025924 | Bacteria | 5415 |
| 435 | Ga0207650_10000001 | 3300025925 | Bacteria | 1545726 |
| 436 | Ga0207650_10056830 | 3300025925 | Bacteria | 2909 |
| 437 | Ga0207650_10063854 | 3300025925 | Bacteria | 2755 |
| 438 | Ga0207650_10123853 | 3300025925 | Bacteria | 2015 |
| 439 | Ga0207650_10139770 | 3300025925 | Bacteria | 1903 |
| 440 | Ga0207650_10240940 | 3300025925 | Unclassified | 1461 |
| 441 | Ga0207650_10764126 | 3300025925 | Unclassified | 818 |
| 442 | Ga0207659_10397869 | 3300025926 | Unclassified | 1151 |
| 443 | Ga0207659_10887943 | 3300025926 | Bacteria | 766 |
| 444 | Ga0207659_11384882 | 3300025926 | Unclassified | 603 |
| 445 | Ga0207687_10449122 | 3300025927 | Bacteria | 1069 |
| 446 | Ga0207687_10517873 | 3300025927 | Unclassified | 997 |
| 447 | Ga0207690_10012439 | 3300025932 | Bacteria | 5090 |
| 448 | Ga0207706_10418625 | 3300025933 | Bacteria | 1161 |
| 449 | Ga0207686_10033760 | 3300025934 | Bacteria | 3056 |
| 450 | Ga0207709_10016138 | 3300025935 | Bacteria | 4149 |
| 451 | Ga0207670_10081832 | 3300025936 | Bacteria | 2261 |
| 452 | Ga0207670_10344350 | 3300025936 | Bacteria | 1179 |
| 453 | Ga0207704_11456031 | 3300025938 | Unclassified | 587 |
| 454 | Ga0207691_10949511 | 3300025940 | Bacteria | 719 |
| 455 | Ga0207711_10020954 | 3300025941 | Bacteria | 5458 |
| 456 | Ga0207711_10135607 | 3300025941 | Bacteria | 2210 |
| 457 | Ga0207711_10463332 | 3300025941 | Bacteria | 1180 |
| 458 | Ga0207711_11958265 | 3300025941 | Unclassified | 529 |
| 459 | Ga0207689_10041430 | 3300025942 | Bacteria | 3811 |
| 460 | Ga0207689_10065895 | 3300025942 | Bacteria | 2979 |
| 461 | Ga0207689_10270363 | 3300025942 | Bacteria | 1407 |
| 462 | Ga0207689_10431196 | 3300025942 | Bacteria | 1101 |
| 463 | Ga0207689_10736311 | 3300025942 | Bacteria | 832 |
| 464 | Ga0207689_11107869 | 3300025942 | Bacteria | 667 |
| 465 | Ga0207661_10387287 | 3300025944 | Bacteria | 1266 |
| 466 | Ga0207679_10018390 | 3300025945 | Bacteria | 4681 |
| 467 | Ga0207679_10072805 | 3300025945 | Bacteria | 2597 |
| 468 | Ga0207679_10224085 | 3300025945 | Bacteria | 1583 |
| 469 | Ga0207679_11019338 | 3300025945 | Bacteria | 759 |
| 470 | Ga0207667_10507030 | 3300025949 | Bacteria | 1223 |
| 471 | Ga0207667_11397057 | 3300025949 | Unclassified | 674 |
| 472 | Ga0207651_10449190 | 3300025960 | Unclassified | 1106 |
| 473 | Ga0207651_10575297 | 3300025960 | Unclassified | 982 |
| 474 | Ga0207651_10949091 | 3300025960 | Bacteria | 767 |
| 475 | Ga0207651_11037235 | 3300025960 | Bacteria | 734 |
| 476 | Ga0207712_10003917 | 3300025961 | Bacteria | 9407 |
| 477 | Ga0207712_10046583 | 3300025961 | Bacteria | 3007 |
| 478 | Ga0207712_10068230 | 3300025961 | Bacteria | 2547 |
| 479 | Ga0207712_10069153 | 3300025961 | Bacteria | 2533 |
| 480 | Ga0207640_10056281 | 3300025981 | Bacteria | 2580 |
| 481 | Ga0207640_10504681 | 3300025981 | Unclassified | 1008 |
| 482 | Ga0207640_10634929 | 3300025981 | Bacteria | 908 |
| 483 | Ga0207640_11026700 | 3300025981 | Unclassified | 726 |
| 484 | Ga0207677_10062117 | 3300026023 | Bacteria | 2590 |
| 485 | Ga0207703_10026878 | 3300026035 | Bacteria | 4531 |
| 486 | Ga0207703_10075752 | 3300026035 | Bacteria | 2789 |
| 487 | Ga0207703_10238465 | 3300026035 | Unclassified | 1634 |
| 488 | Ga0207703_10398337 | 3300026035 | Bacteria | 1277 |
| 489 | Ga0207703_10710903 | 3300026035 | Bacteria | 956 |
| 490 | Ga0207639_10163036 | 3300026041 | Bacteria | 1880 |
| 491 | Ga0207639_10291698 | 3300026041 | Bacteria | 1439 |
| 492 | Ga0207639_11294731 | 3300026041 | Unclassified | 684 |
| 493 | Ga0207678_10998761 | 3300026067 | Bacteria | 741 |
| 494 | Ga0207708_10000085 | 3300026075 | Bacteria | 73335 |
| 495 | Ga0207708_10015575 | 3300026075 | Bacteria | 5701 |
| 496 | Ga0207708_10026157 | 3300026075 | Bacteria | 4414 |
| 497 | Ga0207708_10807361 | 3300026075 | Unclassified | 808 |
| 498 | Ga0207702_10029124 | 3300026078 | Bacteria | 4593 |
| 499 | Ga0207702_10298692 | 3300026078 | Bacteria | 1528 |
| 500 | Ga0207641_10028297 | 3300026088 | Bacteria | 4630 |
| 501 | Ga0207641_10099923 | 3300026088 | Bacteria | 2554 |
| 502 | Ga0207641_10133004 | 3300026088 | Bacteria | 2236 |
| 503 | Ga0207641_10305211 | 3300026088 | Bacteria | 1505 |
| 504 | Ga0207648_10059789 | 3300026089 | Bacteria | 3324 |
| 505 | Ga0207648_10125448 | 3300026089 | Bacteria | 2258 |
| 506 | Ga0207648_11843238 | 3300026089 | Bacteria | 566 |
| 507 | Ga0207648_11981037 | 3300026089 | Unclassified | 544 |
| 508 | Ga0207676_10051866 | 3300026095 | Bacteria | 3204 |
| 509 | Ga0207676_10069499 | 3300026095 | Bacteria | 2820 |
| 510 | Ga0207676_10290889 | 3300026095 | Unclassified | 1487 |
| 511 | Ga0207676_10309829 | 3300026095 | Bacteria | 1445 |
| 512 | Ga0207676_10699421 | 3300026095 | Bacteria | 982 |
| 513 | Ga0207676_12254757 | 3300026095 | Unclassified | 542 |
| 514 | Ga0207674_10000054 | 3300026116 | Bacteria | 114198 |
| 515 | Ga0207674_10083214 | 3300026116 | Bacteria | 3200 |
| 516 | Ga0207674_10175578 | 3300026116 | Bacteria | 2095 |
| 517 | Ga0207674_10395009 | 3300026116 | Bacteria | 1336 |
| 518 | Ga0207674_10406495 | 3300026116 | Bacteria | 1316 |
| 519 | Ga0207674_10498416 | 3300026116 | Unclassified | 1177 |
| 520 | Ga0207674_10868933 | 3300026116 | Unclassified | 869 |
| 521 | Ga0207674_11626803 | 3300026116 | Unclassified | 614 |
| 522 | Ga0207675_100102606 | 3300026118 | Bacteria | 2695 |
| 523 | Ga0207675_100567366 | 3300026118 | Bacteria | 1135 |
| 524 | Ga0207675_100969391 | 3300026118 | Bacteria | 868 |
| 525 | Ga0207675_101476549 | 3300026118 | Bacteria | 701 |
| 526 | Ga0207675_102657393 | 3300026118 | Bacteria | 510 |
| 527 | Ga0207683_10866928 | 3300026121 | Unclassified | 838 |
| 528 | Ga0207698_10024047 | 3300026142 | Bacteria | 4268 |
| 529 | Ga0207698_11305551 | 3300026142 | Unclassified | 740 |
| 530 | Ga0207428_10280585 | 3300027907 | Bacteria | 1237 |
| 531 | Ga0268265_10065246 | 3300028380 | Bacteria | 2809 |
| 532 | Ga0268265_10158216 | 3300028380 | Bacteria | 1920 |
| 533 | Ga0268265_10312844 | 3300028380 | Bacteria | 1419 |
| 534 | Ga0268265_10842954 | 3300028380 | Bacteria | 896 |
| 535 | Ga0268265_10978025 | 3300028380 | Bacteria | 835 |
| 536 | Ga0268265_10988145 | 3300028380 | Bacteria | 831 |
| 537 | Ga0268265_11118972 | 3300028380 | Unclassified | 782 |
| 538 | Ga0268265_11545157 | 3300028380 | Bacteria | 668 |
| 539 | Ga0268264_10132949 | 3300028381 | Bacteria | 2208 |
| 540 | Ga0268264_10264010 | 3300028381 | Unclassified | 1605 |
| 541 | Ga0268264_10440643 | 3300028381 | Unclassified | 1260 |
| 542 | Ga0268264_11506620 | 3300028381 | Bacteria | 683 |
| 543 | Ga0268264_11512843 | 3300028381 | Unclassified | 682 |
| 544 | Ga0268264_12115774 | 3300028381 | Unclassified | 571 |
| 545 | Ga0314311_1022701 | 3300030733 | Bacteria | 1107 |
| 546 | Ga0307513_10270470 | 3300031456 | Bacteria | 1483 |
| 547 | Ga0307408_101146393 | 3300031548 | Bacteria | 723 |
| 548 | Ga0307405_10072035 | 3300031731 | Bacteria | 2226 |
| 549 | Ga0307405_10088899 | 3300031731 | Bacteria | 2040 |
| 550 | Ga0307410_10040052 | 3300031852 | Bacteria | 3081 |
| 551 | Ga0307410_11204056 | 3300031852 | Unclassified | 660 |
| 552 | Ga0307406_10480832 | 3300031901 | Bacteria | 1003 |
| 553 | Ga0307406_11196842 | 3300031901 | Unclassified | 660 |
| 554 | Ga0307406_12133419 | 3300031901 | Unclassified | 502 |
| 555 | Ga0307412_10006314 | 3300031911 | Bacteria | 6695 |
| 556 | Ga0307412_10420901 | 3300031911 | Unclassified | 1093 |
| 557 | Ga0307409_101734670 | 3300031995 | Unclassified | 653 |
| 558 | Ga0307416_100012408 | 3300032002 | Bacteria | 5741 |
| 559 | Ga0307414_10004189 | 3300032004 | Bacteria | 7799 |
| 560 | Ga0307414_10127232 | 3300032004 | Bacteria | 1971 |
| 561 | Ga0307414_10228081 | 3300032004 | Bacteria | 1534 |
| 562 | Ga0307411_10003878 | 3300032005 | Bacteria | 7048 |
| 563 | Ga0307411_11050740 | 3300032005 | Unclassified | 732 |
| 564 | Ga0307411_11809504 | 3300032005 | Unclassified | 567 |
| 565 | Ga0307415_100006092 | 3300032126 | Bacteria | 6467 |
| 566 | Ga0373940_0159250 | 3300035088 | Unclassified | 724 |
| 567 | Ga0373951_0003402 | 3300035091 | Bacteria | 3861 |
| 568 | Ga0373951_0126864 | 3300035091 | Bacteria | 699 |
| 569 | Ga0373941_0269257 | 3300035115 | Unclassified | 671 |
| 570 | Ga0373942_0132429 | 3300035207 | Bacteria | 787 |
| 571 | Ga0373962_0124907 | 3300035242 | Bacteria | 824 |
| 572 | Ga0373931_0618527 | 3300035691 | Bacteria | 709 |
| 573 | Ga0395899_0102363 | 3300037312 | Bacteria | 2067 |
| 574 | Ga0395899_0643007 | 3300037312 | Unclassified | 671 |
| 575 | Ga0395900_0270305 | 3300037418 | Bacteria | 1695 |
| 576 | Ga0395900_0338677 | 3300037418 | Bacteria | 1480 |
| 577 | Ga0395898_0100682 | 3300037466 | Bacteria | 2775 |
| 578 | Ga0395898_0643991 | 3300037466 | Bacteria | 1002 |
| 579 | Ga0395905_0616491 | 3300037471 | Bacteria | 987 |
| 580 | Ga0395905_0717807 | 3300037471 | Bacteria | 902 |
| 581 | Ga0395901_0255449 | 3300038443 | Bacteria | 1825 |
| 582 | Ga0395901_0820740 | 3300038443 | Unclassified | 917 |
| 583 | Ga0395901_0887700 | 3300038443 | Unclassified | 874 |
| 584 | Ga0242420_001118 | 3300038996 | Bacteria | 3446 |
| 585 | Ga0242420_129135 | 3300038996 | Unclassified | 556 |
| 586 | Ga0439448_0060455 | 3300042005 | Bacteria | 1252 |
| 587 | Ga0439455_0094036 | 3300042012 | Unclassified | 824 |
| 588 | Ga0439458_0043564 | 3300042157 | Bacteria | 1095 |
| 589 | Ga0451576_0442541 | 3300045051 | Bacteria | 1364 |
| 590 | Ga0451576_0624807 | 3300045051 | Unclassified | 1132 |
| 591 | Ga0495668_0315007 | 3300046616 | Bacteria | 858 |
| 592 | Ga0496102_0007725 | 3300048905 | Bacteria | 9188 |
| 593 | Ga0496104_0073281 | 3300048907 | Unclassified | 3258 |
| 594 | Ga0496106_0013833 | 3300048909 | Bacteria | 5963 |
| 595 | Ga0496106_0126579 | 3300048909 | Bacteria | 2001 |
| 596 | Ga0496106_0163516 | 3300048909 | Bacteria | 1761 |
| 597 | Ga0496107_0180798 | 3300048910 | Bacteria | 1566 |
| 598 | Ga0496107_0299286 | 3300048910 | Bacteria | 1197 |
| 599 | Ga0496108_0369471 | 3300048911 | Bacteria | 1252 |
| 600 | Ga0496109_0250839 | 3300048912 | Bacteria | 1667 |
| 601 | Ga0496109_0408675 | 3300048912 | Bacteria | 1283 |
| 602 | Ga0496109_0655306 | 3300048912 | Bacteria | 987 |
| 603 | Ga0496110_1107160 | 3300048913 | Unclassified | 700 |
| 604 | Ga0496111_1273367 | 3300048914 | Bacteria | 519 |
| 605 | Ga0496112_0297470 | 3300048915 | Bacteria | 1560 |
| 606 | Ga0496112_0353215 | 3300048915 | Bacteria | 1412 |
| 607 | Ga0496112_0515617 | 3300048915 | Unclassified | 1130 |
| 608 | Ga0496112_0544488 | 3300048915 | Bacteria | 1095 |
| 609 | Ga0496113_0131690 | 3300048916 | Bacteria | 1963 |
| 610 | Ga0496113_0434520 | 3300048916 | Bacteria | 1055 |
| 611 | Ga0501292_034870 | 3300049515 | Bacteria | 855 |
| 612 | Ga0501297_006391 | 3300049520 | Bacteria | 1256 |
| 613 | Ga0501298_023712 | 3300049521 | Bacteria | 1164 |
| 614 | Ga0501040_0165430 | 3300049576 | Bacteria | 1565 |
| 615 | Ga0501072_0840081 | 3300049588 | Unclassified | 718 |
| 616 | Ga0501202_087007 | 3300049652 | Unclassified | 742 |
| 617 | Ga0501208_007211 | 3300049655 | Bacteria | 1449 |
| 618 | Ga0501216_012693 | 3300049660 | Bacteria | 1386 |
| 619 | Ga0501217_000320 | 3300049661 | Bacteria | 7642 |
| 620 | Ga0501223_023218 | 3300049663 | Bacteria | 1210 |
| 621 | Ga0501224_002538 | 3300049664 | Bacteria | 2500 |
| 622 | Ga0501227_002226 | 3300049665 | Bacteria | 4291 |
| 623 | Ga0501228_030644 | 3300049666 | Unclassified | 658 |
| 624 | Ga0501230_058471 | 3300049667 | Unclassified | 777 |
| 625 | Ga0501233_020921 | 3300049668 | Bacteria | 1400 |
| 626 | Ga0501233_096500 | 3300049668 | Unclassified | 777 |
| 627 | Ga0501233_111765 | 3300049668 | Unclassified | 731 |
| 628 | Ga0501235_009548 | 3300049669 | Bacteria | 2120 |
| 629 | Ga0501243_004261 | 3300049675 | Unclassified | 2143 |
| 630 | Ga0501249_036643 | 3300049679 | Bacteria | 1105 |
| 631 | Ga0501260_002731 | 3300049689 | Bacteria | 1547 |
| 632 | Ga0501225_0027916 | 3300049705 | Bacteria | 1551 |
| 633 | Ga0501225_0031001 | 3300049705 | Bacteria | 1471 |
| 634 | Ga0501234_007938 | 3300049707 | Bacteria | 1658 |
| 635 | Ga0501079_1181518 | 3300049741 | Unclassified | 603 |
| 636 | Ga0501081_0396861 | 3300049743 | Bacteria | 1021 |
| 637 | Ga0501241_084319 | 3300049758 | Unclassified | 665 |
| 638 | Ga0501270_061719 | 3300049767 | Unclassified | 705 |
| 639 | Ga0501272_023279 | 3300049769 | Unclassified | 754 |
| 640 | Ga0501280_009885 | 3300049776 | Bacteria | 1329 |
| 641 | Ga0501212_039444 | 3300049851 | Unclassified | 778 |
| 642 | nmdc:mga05p37_115257_c1 | 3300050507 | Bacteria | 3303 |
| 643 | nmdc:mga05p37_1477241_c1 | 3300050507 | Unclassified | 678 |
| 644 | nmdc:mga05p37_303167_c1 | 3300050507 | Unclassified | 1897 |
| 645 | nmdc:mga05p37_351180_c1 | 3300050507 | Bacteria | 1736 |
| 646 | nmdc:mga05p37_926513_c1 | 3300050507 | Bacteria | 936 |
| 647 | nmdc:mga09592_1525705_c1 | 3300050508 | Unclassified | 543 |
| 648 | nmdc:mga09592_207672_c1 | 3300050508 | Bacteria | 1696 |
| 649 | nmdc:mga09592_443827_c1 | 3300050508 | Bacteria | 1120 |
| 650 | nmdc:mga09592_878230_c1 | 3300050508 | Unclassified | 755 |
| 651 | nmdc:mga0qj67_201808_c1 | 3300050509 | Bacteria | 1616 |
| 652 | nmdc:mga06r32_1022417_c1 | 3300050510 | Unclassified | 778 |
| 653 | nmdc:mga06r32_1230180_c1 | 3300050510 | Unclassified | 694 |
| 654 | nmdc:mga06r32_927427_c1 | 3300050510 | Unclassified | 826 |
| 655 | nmdc:mga08y16_13053_c1 | 3300050511 | Bacteria | 8740 |
| 656 | nmdc:mga0n895_1195222_c1 | 3300050512 | Bacteria | 734 |
| 657 | nmdc:mga0n895_139674_c1 | 3300050512 | Bacteria | 2450 |
| 658 | nmdc:mga0n895_1397284_c1 | 3300050512 | Unclassified | 669 |
| 659 | nmdc:mga0n895_196172_c1 | 3300050512 | Unclassified | 2050 |
| 660 | nmdc:mga0n895_216901_c1 | 3300050512 | Bacteria | 1943 |
| 661 | nmdc:mga0rr50_263850_c1 | 3300050513 | Unclassified | 1433 |
| 662 | nmdc:mga0rr50_36554_c1 | 3300050513 | Bacteria | 3538 |
| 663 | nmdc:mga0a205_116123_c1 | 3300050515 | Bacteria | 2575 |
| 664 | nmdc:mga0a205_123556_c1 | 3300050515 | Bacteria | 2488 |
| 665 | nmdc:mga0a205_30170_c1 | 3300050515 | Bacteria | 5191 |
| 666 | nmdc:mga0a205_65263_c1 | 3300050515 | Bacteria | 3517 |
| 667 | nmdc:mga0a205_78761_c1 | 3300050515 | Bacteria | 3184 |
| 668 | nmdc:mga0a205_843117_c1 | 3300050515 | Bacteria | 764 |
| 669 | Ga0501082_1216552 | 3300060353 | Unclassified | 658 |
| 670 | Ga0530510_0064661 | 3300061734 | Bacteria | 2649 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300037312 | Ga0395899_0643007 | Ga0395899_0643007_22_345 | 107 |
| 2 | 3300026118 | Ga0207675_102657393 | Ga0207675_1026573932 | 117 |
| 3 | 3300005406 | Ga0070703_10270434 | Ga0070703_102704341 | 119 |
| 4 | 3300005618 | Ga0068864_100087390 | Ga0068864_1000873902 | 119 |
| 5 | 3300005840 | Ga0068870_10503433 | Ga0068870_105034332 | 119 |
| 6 | 3300005841 | Ga0068863_100214776 | Ga0068863_1002147762 | 119 |
| 7 | 3300006852 | Ga0075433_10017740 | Ga0075433_100177405 | 119 |
| 8 | 3300006871 | Ga0075434_100204958 | Ga0075434_1002049583 | 119 |
| 9 | 3300009174 | Ga0105241_10056018 | Ga0105241_100560182 | 119 |
| 10 | 3300014325 | Ga0163163_10003419 | Ga0163163_100034196 | 119 |
| 11 | 3300025911 | Ga0207654_10198487 | Ga0207654_101984872 | 119 |
| 12 | 3300026088 | Ga0207641_10305211 | Ga0207641_103052112 | 119 |
| 13 | 3300026095 | Ga0207676_10051866 | Ga0207676_100518664 | 119 |
| 14 | 3300050515 | nmdc:mga0a205_78761_c1 | nmdc:mga0a205_78761_c1_1118_1477 | 119 |
| 15 | 3300005288 | Ga0065714_10064522 | Ga0065714_100645224 | 120 |
| 16 | 3300005289 | Ga0065704_10658195 | Ga0065704_106581951 | 120 |
| 17 | 3300005290 | Ga0065712_10000141 | Ga0065712_1000014116 | 120 |
| 18 | 3300005293 | Ga0065715_10091022 | Ga0065715_100910224 | 120 |
| 19 | 3300005295 | Ga0065707_10097033 | Ga0065707_100970333 | 120 |
| 20 | 3300005295 | Ga0065707_10346491 | Ga0065707_103464912 | 120 |
| 21 | 3300005328 | Ga0070676_10711942 | Ga0070676_107119421 | 120 |
| 22 | 3300005345 | Ga0070692_10326338 | Ga0070692_103263382 | 120 |
| 23 | 3300005366 | Ga0070659_100915422 | Ga0070659_1009154221 | 120 |
| 24 | 3300005441 | Ga0070700_100000123 | Ga0070700_10000012330 | 120 |
| 25 | 3300005444 | Ga0070694_100116574 | Ga0070694_1001165742 | 120 |
| 26 | 3300005467 | Ga0070706_100000998 | Ga0070706_10000099820 | 120 |
| 27 | 3300005468 | Ga0070707_100000452 | Ga0070707_10000045211 | 120 |
| 28 | 3300005471 | Ga0070698_100323623 | Ga0070698_1003236232 | 120 |
| 29 | 3300005518 | Ga0070699_100292372 | Ga0070699_1002923722 | 120 |
| 30 | 3300005518 | Ga0070699_101497300 | Ga0070699_1014973002 | 120 |
| 31 | 3300005536 | Ga0070697_100143354 | Ga0070697_1001433541 | 120 |
| 32 | 3300005545 | Ga0070695_100052711 | Ga0070695_1000527112 | 120 |
| 33 | 3300005545 | Ga0070695_100338782 | Ga0070695_1003387822 | 120 |
| 34 | 3300005546 | Ga0070696_100011189 | Ga0070696_1000111893 | 120 |
| 35 | 3300005546 | Ga0070696_100797318 | Ga0070696_1007973182 | 120 |
| 36 | 3300005549 | Ga0070704_100007720 | Ga0070704_1000077204 | 120 |
| 37 | 3300005564 | Ga0070664_100448947 | Ga0070664_1004489472 | 120 |
| 38 | 3300005577 | Ga0068857_101268337 | Ga0068857_1012683372 | 120 |
| 39 | 3300005617 | Ga0068859_100009209 | Ga0068859_1000092097 | 120 |
| 40 | 3300005618 | Ga0068864_100334778 | Ga0068864_1003347783 | 120 |
| 41 | 3300006847 | Ga0075431_100489721 | Ga0075431_1004897212 | 120 |
| 42 | 3300006852 | Ga0075433_10408113 | Ga0075433_104081132 | 120 |
| 43 | 3300006871 | Ga0075434_100827817 | Ga0075434_1008278171 | 120 |
| 44 | 3300006914 | Ga0075436_100207715 | Ga0075436_1002077152 | 120 |
| 45 | 3300006931 | Ga0097620_100009209 | Ga0097620_1000092097 | 120 |
| 46 | 3300009101 | Ga0105247_10091435 | Ga0105247_100914352 | 120 |
| 47 | 3300009147 | Ga0114129_10481177 | Ga0114129_104811773 | 120 |
| 48 | 3300009147 | Ga0114129_12335066 | Ga0114129_123350662 | 120 |
| 49 | 3300009148 | Ga0105243_12165098 | Ga0105243_121650981 | 120 |
| 50 | 3300009174 | Ga0105241_11143457 | Ga0105241_111434572 | 120 |
| 51 | 3300009176 | Ga0105242_10888184 | Ga0105242_108881842 | 120 |
| 52 | 3300009177 | Ga0105248_10134451 | Ga0105248_101344513 | 120 |
| 53 | 3300013296 | Ga0157374_11995922 | Ga0157374_119959222 | 120 |
| 54 | 3300013297 | Ga0157378_10411773 | Ga0157378_104117732 | 120 |
| 55 | 3300013307 | Ga0157372_11374777 | Ga0157372_113747772 | 120 |
| 56 | 3300013308 | Ga0157375_10052699 | Ga0157375_100526994 | 120 |
| 57 | 3300013308 | Ga0157375_10893985 | Ga0157375_108939852 | 120 |
| 58 | 3300014745 | Ga0157377_10461049 | Ga0157377_104610492 | 120 |
| 59 | 3300025910 | Ga0207684_10000286 | Ga0207684_1000028653 | 120 |
| 60 | 3300025922 | Ga0207646_10000798 | Ga0207646_1000079828 | 120 |
| 61 | 3300025927 | Ga0207687_10449122 | Ga0207687_104491222 | 120 |
| 62 | 3300025941 | Ga0207711_10020954 | Ga0207711_100209542 | 120 |
| 63 | 3300025942 | Ga0207689_10431196 | Ga0207689_104311962 | 120 |
| 64 | 3300025945 | Ga0207679_11019338 | Ga0207679_110193382 | 120 |
| 65 | 3300026075 | Ga0207708_10000085 | Ga0207708_1000008570 | 120 |
| 66 | 3300026095 | Ga0207676_10699421 | Ga0207676_106994211 | 120 |
| 67 | 3300026116 | Ga0207674_11626803 | Ga0207674_116268032 | 120 |
| 68 | 3300035242 | Ga0373962_0124907 | Ga0373962_0124907_182_544 | 120 |
| 69 | 3300037418 | Ga0395900_0270305 | Ga0395900_0270305_403_765 | 120 |
| 70 | 3300042005 | Ga0439448_0060455 | Ga0439448_0060455_276_638 | 120 |
| 71 | 3300042012 | Ga0439455_0094036 | Ga0439455_0094036_208_570 | 120 |
| 72 | 3300042157 | Ga0439458_0043564 | Ga0439458_0043564_191_553 | 120 |
| 73 | 3300050507 | nmdc:mga05p37_1477241_c1 | nmdc:mga05p37_1477241_c1_44_406 | 120 |
| 74 | 3300050507 | nmdc:mga05p37_351180_c1 | nmdc:mga05p37_351180_c1_643_1005 | 120 |
| 75 | 3300050510 | nmdc:mga06r32_1022417_c1 | nmdc:mga06r32_1022417_c1_153_515 | 120 |
| 76 | 3300050512 | nmdc:mga0n895_1397284_c1 | nmdc:mga0n895_1397284_c1_39_401 | 120 |
| 77 | 3300005290 | Ga0065712_10111906 | Ga0065712_101119063 | 121 |
| 78 | 3300005293 | Ga0065715_10034425 | Ga0065715_100344251 | 121 |
| 79 | 3300005293 | Ga0065715_10127638 | Ga0065715_101276383 | 121 |
| 80 | 3300005293 | Ga0065715_10306252 | Ga0065715_103062522 | 121 |
| 81 | 3300005293 | Ga0065715_10332792 | Ga0065715_103327921 | 121 |
| 82 | 3300005293 | Ga0065715_10451710 | Ga0065715_104517102 | 121 |
| 83 | 3300005293 | Ga0065715_10960023 | Ga0065715_109600231 | 121 |
| 84 | 3300005295 | Ga0065707_11071872 | Ga0065707_110718721 | 121 |
| 85 | 3300005329 | Ga0070683_100217404 | Ga0070683_1002174042 | 121 |
| 86 | 3300005330 | Ga0070690_100776708 | Ga0070690_1007767082 | 121 |
| 87 | 3300005331 | Ga0070670_100043591 | Ga0070670_1000435913 | 121 |
| 88 | 3300005331 | Ga0070670_100156139 | Ga0070670_1001561392 | 121 |
| 89 | 3300005334 | Ga0068869_100050373 | Ga0068869_1000503736 | 121 |
| 90 | 3300005334 | Ga0068869_100125983 | Ga0068869_1001259832 | 121 |
| 91 | 3300005334 | Ga0068869_100192992 | Ga0068869_1001929922 | 121 |
| 92 | 3300005334 | Ga0068869_100215780 | Ga0068869_1002157801 | 121 |
| 93 | 3300005334 | Ga0068869_101470142 | Ga0068869_1014701421 | 121 |
| 94 | 3300005336 | Ga0070680_100058911 | Ga0070680_1000589114 | 121 |
| 95 | 3300005337 | Ga0070682_100107073 | Ga0070682_1001070733 | 121 |
| 96 | 3300005339 | Ga0070660_100169414 | Ga0070660_1001694142 | 121 |
| 97 | 3300005340 | Ga0070689_100022847 | Ga0070689_1000228472 | 121 |
| 98 | 3300005340 | Ga0070689_101562495 | Ga0070689_1015624951 | 121 |
| 99 | 3300005343 | Ga0070687_100094232 | Ga0070687_1000942322 | 121 |
| 100 | 3300005344 | Ga0070661_100108210 | Ga0070661_1001082103 | 121 |
| 101 | 3300005353 | Ga0070669_100282450 | Ga0070669_1002824502 | 121 |
| 102 | 3300005353 | Ga0070669_100338258 | Ga0070669_1003382582 | 121 |
| 103 | 3300005354 | Ga0070675_101301953 | Ga0070675_1013019532 | 121 |
| 104 | 3300005354 | Ga0070675_101828585 | Ga0070675_1018285851 | 121 |
| 105 | 3300005356 | Ga0070674_100161611 | Ga0070674_1001616112 | 121 |
| 106 | 3300005364 | Ga0070673_100099071 | Ga0070673_1000990713 | 121 |
| 107 | 3300005364 | Ga0070673_100810904 | Ga0070673_1008109042 | 121 |
| 108 | 3300005365 | Ga0070688_100927297 | Ga0070688_1009272972 | 121 |
| 109 | 3300005366 | Ga0070659_100000911 | Ga0070659_10000091110 | 121 |
| 110 | 3300005438 | Ga0070701_10614911 | Ga0070701_106149111 | 121 |
| 111 | 3300005444 | Ga0070694_100038672 | Ga0070694_1000386722 | 121 |
| 112 | 3300005444 | Ga0070694_100564578 | Ga0070694_1005645782 | 121 |
| 113 | 3300005444 | Ga0070694_100582609 | Ga0070694_1005826091 | 121 |
| 114 | 3300005455 | Ga0070663_100328255 | Ga0070663_1003282552 | 121 |
| 115 | 3300005457 | Ga0070662_100185724 | Ga0070662_1001857242 | 121 |
| 116 | 3300005457 | Ga0070662_101717868 | Ga0070662_1017178681 | 121 |
| 117 | 3300005458 | Ga0070681_10000285 | Ga0070681_1000028532 | 121 |
| 118 | 3300005458 | Ga0070681_10004771 | Ga0070681_100047715 | 121 |
| 119 | 3300005471 | Ga0070698_101775942 | Ga0070698_1017759421 | 121 |
| 120 | 3300005518 | Ga0070699_100382353 | Ga0070699_1003823532 | 121 |
| 121 | 3300005530 | Ga0070679_100000348 | Ga0070679_1000003486 | 121 |
| 122 | 3300005530 | Ga0070679_100025802 | Ga0070679_1000258024 | 121 |
| 123 | 3300005536 | Ga0070697_101796058 | Ga0070697_1017960581 | 121 |
| 124 | 3300005539 | Ga0068853_100004711 | Ga0068853_10000471110 | 121 |
| 125 | 3300005539 | Ga0068853_100016076 | Ga0068853_1000160763 | 121 |
| 126 | 3300005539 | Ga0068853_101412181 | Ga0068853_1014121812 | 121 |
| 127 | 3300005543 | Ga0070672_100567005 | Ga0070672_1005670052 | 121 |
| 128 | 3300005544 | Ga0070686_100022421 | Ga0070686_1000224212 | 121 |
| 129 | 3300005546 | Ga0070696_101009132 | Ga0070696_1010091321 | 121 |
| 130 | 3300005547 | Ga0070693_101621598 | Ga0070693_1016215981 | 121 |
| 131 | 3300005549 | Ga0070704_100504089 | Ga0070704_1005040892 | 121 |
| 132 | 3300005563 | Ga0068855_100707764 | Ga0068855_1007077642 | 121 |
| 133 | 3300005564 | Ga0070664_100001827 | Ga0070664_10000182712 | 121 |
| 134 | 3300005564 | Ga0070664_102356107 | Ga0070664_1023561071 | 121 |
| 135 | 3300005577 | Ga0068857_100001397 | Ga0068857_10000139713 | 121 |
| 136 | 3300005578 | Ga0068854_100045048 | Ga0068854_1000450482 | 121 |
| 137 | 3300005578 | Ga0068854_100166422 | Ga0068854_1001664222 | 121 |
| 138 | 3300005614 | Ga0068856_100084062 | Ga0068856_1000840622 | 121 |
| 139 | 3300005615 | Ga0070702_100249309 | Ga0070702_1002493092 | 121 |
| 140 | 3300005615 | Ga0070702_100886563 | Ga0070702_1008865631 | 121 |
| 141 | 3300005617 | Ga0068859_100136315 | Ga0068859_1001363151 | 121 |
| 142 | 3300005617 | Ga0068859_100222227 | Ga0068859_1002222272 | 121 |
| 143 | 3300005617 | Ga0068859_100446307 | Ga0068859_1004463072 | 121 |
| 144 | 3300005617 | Ga0068859_100606423 | Ga0068859_1006064232 | 121 |
| 145 | 3300005617 | Ga0068859_100647243 | Ga0068859_1006472431 | 121 |
| 146 | 3300005617 | Ga0068859_100765395 | Ga0068859_1007653952 | 121 |
| 147 | 3300005617 | Ga0068859_101450387 | Ga0068859_1014503872 | 121 |
| 148 | 3300005618 | Ga0068864_100034755 | Ga0068864_1000347555 | 121 |
| 149 | 3300005618 | Ga0068864_100142795 | Ga0068864_1001427953 | 121 |
| 150 | 3300005618 | Ga0068864_100161378 | Ga0068864_1001613782 | 121 |
| 151 | 3300005618 | Ga0068864_100994297 | Ga0068864_1009942971 | 121 |
| 152 | 3300005618 | Ga0068864_102086743 | Ga0068864_1020867432 | 121 |
| 153 | 3300005719 | Ga0068861_100779045 | Ga0068861_1007790452 | 121 |
| 154 | 3300005719 | Ga0068861_101992317 | Ga0068861_1019923172 | 121 |
| 155 | 3300005840 | Ga0068870_10077638 | Ga0068870_100776382 | 121 |
| 156 | 3300005840 | Ga0068870_10100569 | Ga0068870_101005693 | 121 |
| 157 | 3300005840 | Ga0068870_10173215 | Ga0068870_101732152 | 121 |
| 158 | 3300005840 | Ga0068870_11299631 | Ga0068870_112996311 | 121 |
| 159 | 3300005841 | Ga0068863_100003484 | Ga0068863_10000348413 | 121 |
| 160 | 3300005841 | Ga0068863_100130663 | Ga0068863_1001306633 | 121 |
| 161 | 3300005842 | Ga0068858_100566653 | Ga0068858_1005666531 | 121 |
| 162 | 3300005843 | Ga0068860_100423216 | Ga0068860_1004232162 | 121 |
| 163 | 3300005843 | Ga0068860_100508157 | Ga0068860_1005081573 | 121 |
| 164 | 3300005844 | Ga0068862_100169536 | Ga0068862_1001695363 | 121 |
| 165 | 3300005844 | Ga0068862_100230906 | Ga0068862_1002309062 | 121 |
| 166 | 3300005844 | Ga0068862_100289594 | Ga0068862_1002895942 | 121 |
| 167 | 3300005844 | Ga0068862_100889241 | Ga0068862_1008892412 | 121 |
| 168 | 3300005844 | Ga0068862_101563737 | Ga0068862_1015637372 | 121 |
| 169 | 3300006846 | Ga0075430_100026096 | Ga0075430_1000260963 | 121 |
| 170 | 3300006847 | Ga0075431_100094215 | Ga0075431_1000942154 | 121 |
| 171 | 3300006852 | Ga0075433_10125283 | Ga0075433_101252832 | 121 |
| 172 | 3300006852 | Ga0075433_10215142 | Ga0075433_102151422 | 121 |
| 173 | 3300006852 | Ga0075433_11842829 | Ga0075433_118428291 | 121 |
| 174 | 3300006880 | Ga0075429_100027099 | Ga0075429_1000270995 | 121 |
| 175 | 3300006914 | Ga0075436_100333045 | Ga0075436_1003330452 | 121 |
| 176 | 3300006931 | Ga0097620_100136319 | Ga0097620_1001363194 | 121 |
| 177 | 3300006931 | Ga0097620_100222224 | Ga0097620_1002222242 | 121 |
| 178 | 3300006931 | Ga0097620_100446295 | Ga0097620_1004462952 | 121 |
| 179 | 3300006931 | Ga0097620_100606419 | Ga0097620_1006064192 | 121 |
| 180 | 3300006931 | Ga0097620_100647226 | Ga0097620_1006472261 | 121 |
| 181 | 3300006931 | Ga0097620_100765231 | Ga0097620_1007652312 | 121 |
| 182 | 3300006931 | Ga0097620_101450818 | Ga0097620_1014508182 | 121 |
| 183 | 3300007076 | Ga0075435_100204664 | Ga0075435_1002046641 | 121 |
| 184 | 3300009094 | Ga0111539_10137924 | Ga0111539_101379242 | 121 |
| 185 | 3300009094 | Ga0111539_11060744 | Ga0111539_110607441 | 121 |
| 186 | 3300009098 | Ga0105245_12101708 | Ga0105245_121017081 | 121 |
| 187 | 3300009101 | Ga0105247_10631914 | Ga0105247_106319141 | 121 |
| 188 | 3300009147 | Ga0114129_10044807 | Ga0114129_100448073 | 121 |
| 189 | 3300009147 | Ga0114129_10121949 | Ga0114129_101219492 | 121 |
| 190 | 3300009147 | Ga0114129_10212484 | Ga0114129_102124843 | 121 |
| 191 | 3300009147 | Ga0114129_10883816 | Ga0114129_108838162 | 121 |
| 192 | 3300009147 | Ga0114129_11301993 | Ga0114129_113019933 | 121 |
| 193 | 3300009147 | Ga0114129_11373546 | Ga0114129_113735462 | 121 |
| 194 | 3300009174 | Ga0105241_10162803 | Ga0105241_101628032 | 121 |
| 195 | 3300009174 | Ga0105241_11480404 | Ga0105241_114804041 | 121 |
| 196 | 3300009176 | Ga0105242_11607732 | Ga0105242_116077322 | 121 |
| 197 | 3300009177 | Ga0105248_10069136 | Ga0105248_100691362 | 121 |
| 198 | 3300009553 | Ga0105249_10132631 | Ga0105249_101326312 | 121 |
| 199 | 3300009553 | Ga0105249_10320253 | Ga0105249_103202533 | 121 |
| 200 | 3300009553 | Ga0105249_10383775 | Ga0105249_103837753 | 121 |
| 201 | 3300009553 | Ga0105249_12005203 | Ga0105249_120052031 | 121 |
| 202 | 3300010375 | Ga0105239_10423198 | Ga0105239_104231982 | 121 |
| 203 | 3300013100 | Ga0157373_10033103 | Ga0157373_100331032 | 121 |
| 204 | 3300013296 | Ga0157374_10041844 | Ga0157374_100418445 | 121 |
| 205 | 3300013297 | Ga0157378_10974548 | Ga0157378_109745481 | 121 |
| 206 | 3300013297 | Ga0157378_12159566 | Ga0157378_121595661 | 121 |
| 207 | 3300013307 | Ga0157372_11037357 | Ga0157372_110373572 | 121 |
| 208 | 3300013308 | Ga0157375_10154114 | Ga0157375_101541144 | 121 |
| 209 | 3300013308 | Ga0157375_11352986 | Ga0157375_113529861 | 121 |
| 210 | 3300013308 | Ga0157375_12818519 | Ga0157375_128185191 | 121 |
| 211 | 3300014325 | Ga0163163_10076791 | Ga0163163_100767913 | 121 |
| 212 | 3300014325 | Ga0163163_10308566 | Ga0163163_103085662 | 121 |
| 213 | 3300014326 | Ga0157380_10000349 | Ga0157380_1000034930 | 121 |
| 214 | 3300014326 | Ga0157380_10064921 | Ga0157380_100649212 | 121 |
| 215 | 3300014326 | Ga0157380_10285760 | Ga0157380_102857602 | 121 |
| 216 | 3300014745 | Ga0157377_10165601 | Ga0157377_101656012 | 121 |
| 217 | 3300014745 | Ga0157377_10265805 | Ga0157377_102658052 | 121 |
| 218 | 3300015262 | Ga0182007_10195680 | Ga0182007_101956801 | 121 |
| 219 | 3300015262 | Ga0182007_10365838 | Ga0182007_103658381 | 121 |
| 220 | 3300025893 | Ga0207682_10240422 | Ga0207682_102404221 | 121 |
| 221 | 3300025900 | Ga0207710_10124133 | Ga0207710_101241332 | 121 |
| 222 | 3300025908 | Ga0207643_10001491 | Ga0207643_100014919 | 121 |
| 223 | 3300025908 | Ga0207643_10296049 | Ga0207643_102960492 | 121 |
| 224 | 3300025908 | Ga0207643_10421868 | Ga0207643_104218682 | 121 |
| 225 | 3300025917 | Ga0207660_10303911 | Ga0207660_103039112 | 121 |
| 226 | 3300025920 | Ga0207649_10078720 | Ga0207649_100787202 | 121 |
| 227 | 3300025921 | Ga0207652_10240545 | Ga0207652_102405453 | 121 |
| 228 | 3300025923 | Ga0207681_10151330 | Ga0207681_101513302 | 121 |
| 229 | 3300025925 | Ga0207650_10056830 | Ga0207650_100568302 | 121 |
| 230 | 3300025925 | Ga0207650_10063854 | Ga0207650_100638543 | 121 |
| 231 | 3300025925 | Ga0207650_10139770 | Ga0207650_101397703 | 121 |
| 232 | 3300025925 | Ga0207650_10240940 | Ga0207650_102409402 | 121 |
| 233 | 3300025926 | Ga0207659_11384882 | Ga0207659_113848822 | 121 |
| 234 | 3300025932 | Ga0207690_10012439 | Ga0207690_100124395 | 121 |
| 235 | 3300025933 | Ga0207706_10418625 | Ga0207706_104186252 | 121 |
| 236 | 3300025936 | Ga0207670_10081832 | Ga0207670_100818322 | 121 |
| 237 | 3300025940 | Ga0207691_10949511 | Ga0207691_109495111 | 121 |
| 238 | 3300025941 | Ga0207711_10135607 | Ga0207711_101356073 | 121 |
| 239 | 3300025942 | Ga0207689_10041430 | Ga0207689_100414307 | 121 |
| 240 | 3300025942 | Ga0207689_10065895 | Ga0207689_100658952 | 121 |
| 241 | 3300025942 | Ga0207689_10736311 | Ga0207689_107363112 | 121 |
| 242 | 3300025942 | Ga0207689_11107869 | Ga0207689_111078691 | 121 |
| 243 | 3300025944 | Ga0207661_10387287 | Ga0207661_103872871 | 121 |
| 244 | 3300025945 | Ga0207679_10018390 | Ga0207679_100183902 | 121 |
| 245 | 3300025949 | Ga0207667_10507030 | Ga0207667_105070302 | 121 |
| 246 | 3300025960 | Ga0207651_10575297 | Ga0207651_105752972 | 121 |
| 247 | 3300025960 | Ga0207651_11037235 | Ga0207651_110372351 | 121 |
| 248 | 3300025961 | Ga0207712_10068230 | Ga0207712_100682302 | 121 |
| 249 | 3300025981 | Ga0207640_10056281 | Ga0207640_100562812 | 121 |
| 250 | 3300026035 | Ga0207703_10710903 | Ga0207703_107109032 | 121 |
| 251 | 3300026041 | Ga0207639_10163036 | Ga0207639_101630363 | 121 |
| 252 | 3300026041 | Ga0207639_10291698 | Ga0207639_102916982 | 121 |
| 253 | 3300026067 | Ga0207678_10998761 | Ga0207678_109987612 | 121 |
| 254 | 3300026075 | Ga0207708_10026157 | Ga0207708_100261573 | 121 |
| 255 | 3300026078 | Ga0207702_10029124 | Ga0207702_100291242 | 121 |
| 256 | 3300026088 | Ga0207641_10028297 | Ga0207641_100282974 | 121 |
| 257 | 3300026089 | Ga0207648_10059789 | Ga0207648_100597894 | 121 |
| 258 | 3300026089 | Ga0207648_10125448 | Ga0207648_101254482 | 121 |
| 259 | 3300026089 | Ga0207648_11843238 | Ga0207648_118432381 | 121 |
| 260 | 3300026095 | Ga0207676_10069499 | Ga0207676_100694993 | 121 |
| 261 | 3300026095 | Ga0207676_10290889 | Ga0207676_102908892 | 121 |
| 262 | 3300026095 | Ga0207676_10309829 | Ga0207676_103098293 | 121 |
| 263 | 3300026116 | Ga0207674_10000054 | Ga0207674_1000005462 | 121 |
| 264 | 3300026116 | Ga0207674_10175578 | Ga0207674_101755783 | 121 |
| 265 | 3300026118 | Ga0207675_100102606 | Ga0207675_1001026062 | 121 |
| 266 | 3300026118 | Ga0207675_101476549 | Ga0207675_1014765491 | 121 |
| 267 | 3300027907 | Ga0207428_10280585 | Ga0207428_102805852 | 121 |
| 268 | 3300028380 | Ga0268265_10065246 | Ga0268265_100652462 | 121 |
| 269 | 3300028380 | Ga0268265_10158216 | Ga0268265_101582162 | 121 |
| 270 | 3300028380 | Ga0268265_10312844 | Ga0268265_103128442 | 121 |
| 271 | 3300028380 | Ga0268265_10978025 | Ga0268265_109780252 | 121 |
| 272 | 3300028380 | Ga0268265_11545157 | Ga0268265_115451572 | 121 |
| 273 | 3300028381 | Ga0268264_10440643 | Ga0268264_104406432 | 121 |
| 274 | 3300028381 | Ga0268264_11506620 | Ga0268264_115066201 | 121 |
| 275 | 3300031731 | Ga0307405_10072035 | Ga0307405_100720351 | 121 |
| 276 | 3300031852 | Ga0307410_10040052 | Ga0307410_100400523 | 121 |
| 277 | 3300031852 | Ga0307410_11204056 | Ga0307410_112040562 | 121 |
| 278 | 3300031901 | Ga0307406_12133419 | Ga0307406_121334191 | 121 |
| 279 | 3300031911 | Ga0307412_10006314 | Ga0307412_100063148 | 121 |
| 280 | 3300031995 | Ga0307409_101734670 | Ga0307409_1017346701 | 121 |
| 281 | 3300032002 | Ga0307416_100012408 | Ga0307416_1000124081 | 121 |
| 282 | 3300032004 | Ga0307414_10004189 | Ga0307414_100041898 | 121 |
| 283 | 3300032004 | Ga0307414_10127232 | Ga0307414_101272323 | 121 |
| 284 | 3300032005 | Ga0307411_10003878 | Ga0307411_100038781 | 121 |
| 285 | 3300032126 | Ga0307415_100006092 | Ga0307415_1000060921 | 121 |
| 286 | 3300035091 | Ga0373951_0126864 | Ga0373951_0126864_300_665 | 121 |
| 287 | 3300035207 | Ga0373942_0132429 | Ga0373942_0132429_370_735 | 121 |
| 288 | 3300037312 | Ga0395899_0102363 | Ga0395899_0102363_710_1084 | 121 |
| 289 | 3300037471 | Ga0395905_0717807 | Ga0395905_0717807_124_489 | 121 |
| 290 | 3300038443 | Ga0395901_0887700 | Ga0395901_0887700_363_737 | 121 |
| 291 | 3300038996 | Ga0242420_129135 | Ga0242420_129135_117_482 | 121 |
| 292 | 3300045051 | Ga0451576_0624807 | Ga0451576_0624807_403_768 | 121 |
| 293 | 3300048905 | Ga0496102_0007725 | Ga0496102_0007725_7301_7666 | 121 |
| 294 | 3300048907 | Ga0496104_0073281 | Ga0496104_0073281_290_655 | 121 |
| 295 | 3300048909 | Ga0496106_0013833 | Ga0496106_0013833_325_690 | 121 |
| 296 | 3300048909 | Ga0496106_0126579 | Ga0496106_0126579_622_987 | 121 |
| 297 | 3300048910 | Ga0496107_0180798 | Ga0496107_0180798_53_418 | 121 |
| 298 | 3300048912 | Ga0496109_0250839 | Ga0496109_0250839_149_514 | 121 |
| 299 | 3300048912 | Ga0496109_0655306 | Ga0496109_0655306_68_433 | 121 |
| 300 | 3300048914 | Ga0496111_1273367 | Ga0496111_1273367_51_416 | 121 |
| 301 | 3300048916 | Ga0496113_0434520 | Ga0496113_0434520_287_652 | 121 |
| 302 | 3300049515 | Ga0501292_034870 | Ga0501292_034870_281_646 | 121 |
| 303 | 3300049520 | Ga0501297_006391 | Ga0501297_006391_418_783 | 121 |
| 304 | 3300049521 | Ga0501298_023712 | Ga0501298_023712_100_465 | 121 |
| 305 | 3300049576 | Ga0501040_0165430 | Ga0501040_0165430_767_1132 | 121 |
| 306 | 3300049588 | Ga0501072_0840081 | Ga0501072_0840081_104_469 | 121 |
| 307 | 3300049652 | Ga0501202_087007 | Ga0501202_087007_14_379 | 121 |
| 308 | 3300049655 | Ga0501208_007211 | Ga0501208_007211_160_525 | 121 |
| 309 | 3300049660 | Ga0501216_012693 | Ga0501216_012693_1007_1372 | 121 |
| 310 | 3300049661 | Ga0501217_000320 | Ga0501217_000320_76_441 | 121 |
| 311 | 3300049663 | Ga0501223_023218 | Ga0501223_023218_155_520 | 121 |
| 312 | 3300049664 | Ga0501224_002538 | Ga0501224_002538_760_1125 | 121 |
| 313 | 3300049666 | Ga0501228_030644 | Ga0501228_030644_32_397 | 121 |
| 314 | 3300049667 | Ga0501230_058471 | Ga0501230_058471_298_663 | 121 |
| 315 | 3300049668 | Ga0501233_020921 | Ga0501233_020921_427_792 | 121 |
| 316 | 3300049668 | Ga0501233_111765 | Ga0501233_111765_291_656 | 121 |
| 317 | 3300049669 | Ga0501235_009548 | Ga0501235_009548_862_1227 | 121 |
| 318 | 3300049675 | Ga0501243_004261 | Ga0501243_004261_1361_1726 | 121 |
| 319 | 3300049679 | Ga0501249_036643 | Ga0501249_036643_707_1072 | 121 |
| 320 | 3300049689 | Ga0501260_002731 | Ga0501260_002731_428_793 | 121 |
| 321 | 3300049705 | Ga0501225_0027916 | Ga0501225_0027916_1130_1495 | 121 |
| 322 | 3300049707 | Ga0501234_007938 | Ga0501234_007938_549_914 | 121 |
| 323 | 3300049741 | Ga0501079_1181518 | Ga0501079_1181518_211_591 | 121 |
| 324 | 3300049743 | Ga0501081_0396861 | Ga0501081_0396861_592_957 | 121 |
| 325 | 3300049767 | Ga0501270_061719 | Ga0501270_061719_311_676 | 121 |
| 326 | 3300049769 | Ga0501272_023279 | Ga0501272_023279_313_678 | 121 |
| 327 | 3300049776 | Ga0501280_009885 | Ga0501280_009885_750_1115 | 121 |
| 328 | 3300049851 | Ga0501212_039444 | Ga0501212_039444_358_723 | 121 |
| 329 | 3300050507 | nmdc:mga05p37_303167_c1 | nmdc:mga05p37_303167_c1_1345_1710 | 121 |
| 330 | 3300050507 | nmdc:mga05p37_926513_c1 | nmdc:mga05p37_926513_c1_505_870 | 121 |
| 331 | 3300050508 | nmdc:mga09592_1525705_c1 | nmdc:mga09592_1525705_c1_145_510 | 121 |
| 332 | 3300050508 | nmdc:mga09592_443827_c1 | nmdc:mga09592_443827_c1_705_1070 | 121 |
| 333 | 3300050511 | nmdc:mga08y16_13053_c1 | nmdc:mga08y16_13053_c1_1540_1905 | 121 |
| 334 | 3300050512 | nmdc:mga0n895_139674_c1 | nmdc:mga0n895_139674_c1_148_513 | 121 |
| 335 | 3300050512 | nmdc:mga0n895_196172_c1 | nmdc:mga0n895_196172_c1_50_415 | 121 |
| 336 | 3300050513 | nmdc:mga0rr50_263850_c1 | nmdc:mga0rr50_263850_c1_136_501 | 121 |
| 337 | 3300050515 | nmdc:mga0a205_116123_c1 | nmdc:mga0a205_116123_c1_70_435 | 121 |
| 338 | 3300050515 | nmdc:mga0a205_123556_c1 | nmdc:mga0a205_123556_c1_888_1253 | 121 |
| 339 | 3300050515 | nmdc:mga0a205_30170_c1 | nmdc:mga0a205_30170_c1_987_1352 | 121 |
| 340 | 3300050515 | nmdc:mga0a205_843117_c1 | nmdc:mga0a205_843117_c1_380_745 | 121 |
| 341 | 3300060353 | Ga0501082_1216552 | Ga0501082_1216552_268_633 | 121 |
| 342 | 3300061734 | Ga0530510_0064661 | Ga0530510_0064661_1581_1946 | 121 |
| 343 | 3300002459 | JGI24751J29686_10000101 | JGI24751J29686_100001018 | 122 |
| 344 | 3300005293 | Ga0065715_10002355 | Ga0065715_100023552 | 122 |
| 345 | 3300005293 | Ga0065715_10819574 | Ga0065715_108195741 | 122 |
| 346 | 3300005328 | Ga0070676_11044825 | Ga0070676_110448252 | 122 |
| 347 | 3300005331 | Ga0070670_100000475 | Ga0070670_1000004759 | 122 |
| 348 | 3300005331 | Ga0070670_100703186 | Ga0070670_1007031862 | 122 |
| 349 | 3300005334 | Ga0068869_100085910 | Ga0068869_1000859102 | 122 |
| 350 | 3300005334 | Ga0068869_100302857 | Ga0068869_1003028572 | 122 |
| 351 | 3300005334 | Ga0068869_101108666 | Ga0068869_1011086661 | 122 |
| 352 | 3300005337 | Ga0070682_100006343 | Ga0070682_1000063434 | 122 |
| 353 | 3300005338 | Ga0068868_100218084 | Ga0068868_1002180842 | 122 |
| 354 | 3300005340 | Ga0070689_101031655 | Ga0070689_1010316552 | 122 |
| 355 | 3300005340 | Ga0070689_101113840 | Ga0070689_1011138402 | 122 |
| 356 | 3300005343 | Ga0070687_100173675 | Ga0070687_1001736752 | 122 |
| 357 | 3300005343 | Ga0070687_100707606 | Ga0070687_1007076062 | 122 |
| 358 | 3300005344 | Ga0070661_100419841 | Ga0070661_1004198412 | 122 |
| 359 | 3300005345 | Ga0070692_10002398 | Ga0070692_100023986 | 122 |
| 360 | 3300005345 | Ga0070692_10052746 | Ga0070692_100527462 | 122 |
| 361 | 3300005345 | Ga0070692_10101340 | Ga0070692_101013402 | 122 |
| 362 | 3300005355 | Ga0070671_100752360 | Ga0070671_1007523602 | 122 |
| 363 | 3300005364 | Ga0070673_100034472 | Ga0070673_1000344722 | 122 |
| 364 | 3300005365 | Ga0070688_100597056 | Ga0070688_1005970561 | 122 |
| 365 | 3300005406 | Ga0070703_10001572 | Ga0070703_100015726 | 122 |
| 366 | 3300005438 | Ga0070701_10233041 | Ga0070701_102330412 | 122 |
| 367 | 3300005438 | Ga0070701_10860115 | Ga0070701_108601151 | 122 |
| 368 | 3300005441 | Ga0070700_100011786 | Ga0070700_1000117862 | 122 |
| 369 | 3300005441 | Ga0070700_100347720 | Ga0070700_1003477201 | 122 |
| 370 | 3300005444 | Ga0070694_100007732 | Ga0070694_1000077326 | 122 |
| 371 | 3300005444 | Ga0070694_100009290 | Ga0070694_1000092907 | 122 |
| 372 | 3300005444 | Ga0070694_100843083 | Ga0070694_1008430832 | 122 |
| 373 | 3300005445 | Ga0070708_100143759 | Ga0070708_1001437592 | 122 |
| 374 | 3300005459 | Ga0068867_100541932 | Ga0068867_1005419322 | 122 |
| 375 | 3300005467 | Ga0070706_100010344 | Ga0070706_1000103447 | 122 |
| 376 | 3300005468 | Ga0070707_100012015 | Ga0070707_1000120156 | 122 |
| 377 | 3300005468 | Ga0070707_100251053 | Ga0070707_1002510533 | 122 |
| 378 | 3300005471 | Ga0070698_100011196 | Ga0070698_1000111968 | 122 |
| 379 | 3300005518 | Ga0070699_100000440 | Ga0070699_10000044030 | 122 |
| 380 | 3300005518 | Ga0070699_100148029 | Ga0070699_1001480291 | 122 |
| 381 | 3300005518 | Ga0070699_100247135 | Ga0070699_1002471352 | 122 |
| 382 | 3300005530 | Ga0070679_100457384 | Ga0070679_1004573841 | 122 |
| 383 | 3300005536 | Ga0070697_100001682 | Ga0070697_1000016821 | 122 |
| 384 | 3300005536 | Ga0070697_100089148 | Ga0070697_1000891483 | 122 |
| 385 | 3300005536 | Ga0070697_101557561 | Ga0070697_1015575611 | 122 |
| 386 | 3300005539 | Ga0068853_100715209 | Ga0068853_1007152092 | 122 |
| 387 | 3300005547 | Ga0070693_100001087 | Ga0070693_1000010878 | 122 |
| 388 | 3300005547 | Ga0070693_100721699 | Ga0070693_1007216992 | 122 |
| 389 | 3300005549 | Ga0070704_100664130 | Ga0070704_1006641301 | 122 |
| 390 | 3300005564 | Ga0070664_100050933 | Ga0070664_1000509332 | 122 |
| 391 | 3300005564 | Ga0070664_100244170 | Ga0070664_1002441702 | 122 |
| 392 | 3300005577 | Ga0068857_100467626 | Ga0068857_1004676262 | 122 |
| 393 | 3300005577 | Ga0068857_100790504 | Ga0068857_1007905042 | 122 |
| 394 | 3300005577 | Ga0068857_101706882 | Ga0068857_1017068821 | 122 |
| 395 | 3300005578 | Ga0068854_100403891 | Ga0068854_1004038912 | 122 |
| 396 | 3300005615 | Ga0070702_100010067 | Ga0070702_1000100672 | 122 |
| 397 | 3300005615 | Ga0070702_100047116 | Ga0070702_1000471161 | 122 |
| 398 | 3300005615 | Ga0070702_100129709 | Ga0070702_1001297092 | 122 |
| 399 | 3300005616 | Ga0068852_102410758 | Ga0068852_1024107582 | 122 |
| 400 | 3300005617 | Ga0068859_100037923 | Ga0068859_1000379237 | 122 |
| 401 | 3300005617 | Ga0068859_100098139 | Ga0068859_1000981392 | 122 |
| 402 | 3300005617 | Ga0068859_100192228 | Ga0068859_1001922282 | 122 |
| 403 | 3300005617 | Ga0068859_100342820 | Ga0068859_1003428202 | 122 |
| 404 | 3300005617 | Ga0068859_100522093 | Ga0068859_1005220932 | 122 |
| 405 | 3300005617 | Ga0068859_101449483 | Ga0068859_1014494832 | 122 |
| 406 | 3300005618 | Ga0068864_100771211 | Ga0068864_1007712112 | 122 |
| 407 | 3300005618 | Ga0068864_100810254 | Ga0068864_1008102542 | 122 |
| 408 | 3300005834 | Ga0068851_10000589 | Ga0068851_1000058910 | 122 |
| 409 | 3300005840 | Ga0068870_10536240 | Ga0068870_105362402 | 122 |
| 410 | 3300005841 | Ga0068863_100452943 | Ga0068863_1004529432 | 122 |
| 411 | 3300005841 | Ga0068863_100455727 | Ga0068863_1004557272 | 122 |
| 412 | 3300005842 | Ga0068858_100027685 | Ga0068858_1000276854 | 122 |
| 413 | 3300005842 | Ga0068858_100199259 | Ga0068858_1001992592 | 122 |
| 414 | 3300005842 | Ga0068858_100391856 | Ga0068858_1003918562 | 122 |
| 415 | 3300005842 | Ga0068858_100738750 | Ga0068858_1007387502 | 122 |
| 416 | 3300005842 | Ga0068858_100940877 | Ga0068858_1009408772 | 122 |
| 417 | 3300005842 | Ga0068858_101295690 | Ga0068858_1012956902 | 122 |
| 418 | 3300005843 | Ga0068860_100130990 | Ga0068860_1001309902 | 122 |
| 419 | 3300005843 | Ga0068860_100259981 | Ga0068860_1002599812 | 122 |
| 420 | 3300005844 | Ga0068862_100409096 | Ga0068862_1004090962 | 122 |
| 421 | 3300005844 | Ga0068862_102514807 | Ga0068862_1025148071 | 122 |
| 422 | 3300006237 | Ga0097621_100303917 | Ga0097621_1003039172 | 122 |
| 423 | 3300006358 | Ga0068871_100423003 | Ga0068871_1004230032 | 122 |
| 424 | 3300006358 | Ga0068871_100745640 | Ga0068871_1007456402 | 122 |
| 425 | 3300006847 | Ga0075431_100086819 | Ga0075431_1000868194 | 122 |
| 426 | 3300006852 | Ga0075433_10049877 | Ga0075433_100498772 | 122 |
| 427 | 3300006852 | Ga0075433_10744717 | Ga0075433_107447172 | 122 |
| 428 | 3300006871 | Ga0075434_100090367 | Ga0075434_1000903673 | 122 |
| 429 | 3300006871 | Ga0075434_100863757 | Ga0075434_1008637572 | 122 |
| 430 | 3300006880 | Ga0075429_100324438 | Ga0075429_1003244383 | 122 |
| 431 | 3300006931 | Ga0097620_100037921 | Ga0097620_1000379217 | 122 |
| 432 | 3300006931 | Ga0097620_100098139 | Ga0097620_1000981392 | 122 |
| 433 | 3300006931 | Ga0097620_100192223 | Ga0097620_1001922232 | 122 |
| 434 | 3300006931 | Ga0097620_100342830 | Ga0097620_1003428302 | 122 |
| 435 | 3300006931 | Ga0097620_100522082 | Ga0097620_1005220822 | 122 |
| 436 | 3300006931 | Ga0097620_101449519 | Ga0097620_1014495192 | 122 |
| 437 | 3300009011 | Ga0105251_10143568 | Ga0105251_101435681 | 122 |
| 438 | 3300009036 | Ga0105244_10267622 | Ga0105244_102676222 | 122 |
| 439 | 3300009093 | Ga0105240_10060053 | Ga0105240_100600533 | 122 |
| 440 | 3300009098 | Ga0105245_12531042 | Ga0105245_125310422 | 122 |
| 441 | 3300009101 | Ga0105247_10005790 | Ga0105247_100057908 | 122 |
| 442 | 3300009101 | Ga0105247_10205168 | Ga0105247_102051682 | 122 |
| 443 | 3300009101 | Ga0105247_10339198 | Ga0105247_103391982 | 122 |
| 444 | 3300009147 | Ga0114129_10071240 | Ga0114129_100712402 | 122 |
| 445 | 3300009147 | Ga0114129_10658942 | Ga0114129_106589422 | 122 |
| 446 | 3300009148 | Ga0105243_10051584 | Ga0105243_100515842 | 122 |
| 447 | 3300009148 | Ga0105243_10114645 | Ga0105243_101146452 | 122 |
| 448 | 3300009174 | Ga0105241_10125645 | Ga0105241_101256453 | 122 |
| 449 | 3300009174 | Ga0105241_10152074 | Ga0105241_101520742 | 122 |
| 450 | 3300009174 | Ga0105241_10743539 | Ga0105241_107435393 | 122 |
| 451 | 3300009174 | Ga0105241_11335947 | Ga0105241_113359471 | 122 |
| 452 | 3300009174 | Ga0105241_12103645 | Ga0105241_121036452 | 122 |
| 453 | 3300009176 | Ga0105242_10011193 | Ga0105242_100111935 | 122 |
| 454 | 3300009176 | Ga0105242_10124083 | Ga0105242_101240832 | 122 |
| 455 | 3300009176 | Ga0105242_11317883 | Ga0105242_113178832 | 122 |
| 456 | 3300009176 | Ga0105242_12867771 | Ga0105242_128677712 | 122 |
| 457 | 3300009177 | Ga0105248_10201494 | Ga0105248_102014942 | 122 |
| 458 | 3300009177 | Ga0105248_10235158 | Ga0105248_102351583 | 122 |
| 459 | 3300009177 | Ga0105248_11503498 | Ga0105248_115034982 | 122 |
| 460 | 3300009177 | Ga0105248_11842206 | Ga0105248_118422062 | 122 |
| 461 | 3300009177 | Ga0105248_12348213 | Ga0105248_123482132 | 122 |
| 462 | 3300009545 | Ga0105237_10014573 | Ga0105237_100145738 | 122 |
| 463 | 3300009545 | Ga0105237_12639299 | Ga0105237_126392991 | 122 |
| 464 | 3300009551 | Ga0105238_10017924 | Ga0105238_100179245 | 122 |
| 465 | 3300009551 | Ga0105238_10789842 | Ga0105238_107898421 | 122 |
| 466 | 3300009553 | Ga0105249_10044076 | Ga0105249_100440763 | 122 |
| 467 | 3300009553 | Ga0105249_10185268 | Ga0105249_101852682 | 122 |
| 468 | 3300009553 | Ga0105249_10723168 | Ga0105249_107231682 | 122 |
| 469 | 3300010375 | Ga0105239_12244095 | Ga0105239_122440952 | 122 |
| 470 | 3300010375 | Ga0105239_13596447 | Ga0105239_135964471 | 122 |
| 471 | 3300011119 | Ga0105246_10170606 | Ga0105246_101706062 | 122 |
| 472 | 3300011119 | Ga0105246_10207728 | Ga0105246_102077282 | 122 |
| 473 | 3300011119 | Ga0105246_10418723 | Ga0105246_104187231 | 122 |
| 474 | 3300013100 | Ga0157373_10001816 | Ga0157373_100018167 | 122 |
| 475 | 3300013100 | Ga0157373_10354989 | Ga0157373_103549892 | 122 |
| 476 | 3300013297 | Ga0157378_10248542 | Ga0157378_102485422 | 122 |
| 477 | 3300013297 | Ga0157378_10582518 | Ga0157378_105825182 | 122 |
| 478 | 3300013306 | Ga0163162_10192363 | Ga0163162_101923632 | 122 |
| 479 | 3300013306 | Ga0163162_10616183 | Ga0163162_106161832 | 122 |
| 480 | 3300013307 | Ga0157372_10042101 | Ga0157372_100421012 | 122 |
| 481 | 3300014325 | Ga0163163_10000579 | Ga0163163_1000057923 | 122 |
| 482 | 3300014325 | Ga0163163_10514872 | Ga0163163_105148722 | 122 |
| 483 | 3300014325 | Ga0163163_11631156 | Ga0163163_116311561 | 122 |
| 484 | 3300014326 | Ga0157380_10706303 | Ga0157380_107063032 | 122 |
| 485 | 3300014326 | Ga0157380_12751604 | Ga0157380_127516042 | 122 |
| 486 | 3300014745 | Ga0157377_10038794 | Ga0157377_100387943 | 122 |
| 487 | 3300014968 | Ga0157379_10408161 | Ga0157379_104081611 | 122 |
| 488 | 3300014968 | Ga0157379_11078224 | Ga0157379_110782242 | 122 |
| 489 | 3300014968 | Ga0157379_11225945 | Ga0157379_112259451 | 122 |
| 490 | 3300025321 | Ga0207656_10002824 | Ga0207656_100028243 | 122 |
| 491 | 3300025885 | Ga0207653_10002183 | Ga0207653_100021834 | 122 |
| 492 | 3300025899 | Ga0207642_10134335 | Ga0207642_101343352 | 122 |
| 493 | 3300025900 | Ga0207710_10000462 | Ga0207710_1000046218 | 122 |
| 494 | 3300025900 | Ga0207710_10100183 | Ga0207710_101001832 | 122 |
| 495 | 3300025904 | Ga0207647_10287545 | Ga0207647_102875452 | 122 |
| 496 | 3300025907 | Ga0207645_10658921 | Ga0207645_106589211 | 122 |
| 497 | 3300025910 | Ga0207684_10071191 | Ga0207684_100711914 | 122 |
| 498 | 3300025911 | Ga0207654_10297306 | Ga0207654_102973062 | 122 |
| 499 | 3300025914 | Ga0207671_10004861 | Ga0207671_100048615 | 122 |
| 500 | 3300025917 | Ga0207660_10937540 | Ga0207660_109375402 | 122 |
| 501 | 3300025918 | Ga0207662_10110381 | Ga0207662_101103812 | 122 |
| 502 | 3300025918 | Ga0207662_10214098 | Ga0207662_102140981 | 122 |
| 503 | 3300025918 | Ga0207662_10767592 | Ga0207662_107675921 | 122 |
| 504 | 3300025920 | Ga0207649_10360327 | Ga0207649_103603272 | 122 |
| 505 | 3300025921 | Ga0207652_10350223 | Ga0207652_103502233 | 122 |
| 506 | 3300025922 | Ga0207646_10020692 | Ga0207646_100206923 | 122 |
| 507 | 3300025923 | Ga0207681_10173737 | Ga0207681_101737373 | 122 |
| 508 | 3300025924 | Ga0207694_10017522 | Ga0207694_100175227 | 122 |
| 509 | 3300025925 | Ga0207650_10000001 | Ga0207650_10000001947 | 122 |
| 510 | 3300025926 | Ga0207659_10397869 | Ga0207659_103978692 | 122 |
| 511 | 3300025927 | Ga0207687_10517873 | Ga0207687_105178732 | 122 |
| 512 | 3300025934 | Ga0207686_10033760 | Ga0207686_100337602 | 122 |
| 513 | 3300025935 | Ga0207709_10016138 | Ga0207709_100161382 | 122 |
| 514 | 3300025936 | Ga0207670_10344350 | Ga0207670_103443502 | 122 |
| 515 | 3300025938 | Ga0207704_11456031 | Ga0207704_114560312 | 122 |
| 516 | 3300025941 | Ga0207711_10463332 | Ga0207711_104633322 | 122 |
| 517 | 3300025941 | Ga0207711_11958265 | Ga0207711_119582651 | 122 |
| 518 | 3300025942 | Ga0207689_10270363 | Ga0207689_102703631 | 122 |
| 519 | 3300025945 | Ga0207679_10072805 | Ga0207679_100728053 | 122 |
| 520 | 3300025945 | Ga0207679_10224085 | Ga0207679_102240853 | 122 |
| 521 | 3300025960 | Ga0207651_10449190 | Ga0207651_104491902 | 122 |
| 522 | 3300025960 | Ga0207651_10949091 | Ga0207651_109490912 | 122 |
| 523 | 3300025961 | Ga0207712_10003917 | Ga0207712_100039175 | 122 |
| 524 | 3300025961 | Ga0207712_10069153 | Ga0207712_100691532 | 122 |
| 525 | 3300025981 | Ga0207640_10634929 | Ga0207640_106349292 | 122 |
| 526 | 3300026023 | Ga0207677_10062117 | Ga0207677_100621172 | 122 |
| 527 | 3300026035 | Ga0207703_10026878 | Ga0207703_100268783 | 122 |
| 528 | 3300026035 | Ga0207703_10075752 | Ga0207703_100757523 | 122 |
| 529 | 3300026035 | Ga0207703_10238465 | Ga0207703_102384653 | 122 |
| 530 | 3300026035 | Ga0207703_10398337 | Ga0207703_103983372 | 122 |
| 531 | 3300026041 | Ga0207639_11294731 | Ga0207639_112947312 | 122 |
| 532 | 3300026075 | Ga0207708_10015575 | Ga0207708_100155755 | 122 |
| 533 | 3300026075 | Ga0207708_10807361 | Ga0207708_108073612 | 122 |
| 534 | 3300026088 | Ga0207641_10099923 | Ga0207641_100999233 | 122 |
| 535 | 3300026088 | Ga0207641_10133004 | Ga0207641_101330042 | 122 |
| 536 | 3300026089 | Ga0207648_11981037 | Ga0207648_119810372 | 122 |
| 537 | 3300026116 | Ga0207674_10395009 | Ga0207674_103950092 | 122 |
| 538 | 3300026116 | Ga0207674_10868933 | Ga0207674_108689332 | 122 |
| 539 | 3300026118 | Ga0207675_100567366 | Ga0207675_1005673662 | 122 |
| 540 | 3300026118 | Ga0207675_100969391 | Ga0207675_1009693912 | 122 |
| 541 | 3300026121 | Ga0207683_10866928 | Ga0207683_108669282 | 122 |
| 542 | 3300026142 | Ga0207698_10024047 | Ga0207698_100240472 | 122 |
| 543 | 3300026142 | Ga0207698_11305551 | Ga0207698_113055512 | 122 |
| 544 | 3300028380 | Ga0268265_10842954 | Ga0268265_108429542 | 122 |
| 545 | 3300028380 | Ga0268265_11118972 | Ga0268265_111189721 | 122 |
| 546 | 3300028381 | Ga0268264_10132949 | Ga0268264_101329492 | 122 |
| 547 | 3300028381 | Ga0268264_10264010 | Ga0268264_102640103 | 122 |
| 548 | 3300028381 | Ga0268264_11512843 | Ga0268264_115128432 | 122 |
| 549 | 3300028381 | Ga0268264_12115774 | Ga0268264_121157742 | 122 |
| 550 | 3300031731 | Ga0307405_10088899 | Ga0307405_100888992 | 122 |
| 551 | 3300031901 | Ga0307406_10480832 | Ga0307406_104808322 | 122 |
| 552 | 3300031911 | Ga0307412_10420901 | Ga0307412_104209012 | 122 |
| 553 | 3300032004 | Ga0307414_10228081 | Ga0307414_102280812 | 122 |
| 554 | 3300035088 | Ga0373940_0159250 | Ga0373940_0159250_249_617 | 122 |
| 555 | 3300035115 | Ga0373941_0269257 | Ga0373941_0269257_281_649 | 122 |
| 556 | 3300046616 | Ga0495668_0315007 | Ga0495668_0315007_133_501 | 122 |
| 557 | 3300048910 | Ga0496107_0299286 | Ga0496107_0299286_67_435 | 122 |
| 558 | 3300048911 | Ga0496108_0369471 | Ga0496108_0369471_807_1175 | 122 |
| 559 | 3300048912 | Ga0496109_0408675 | Ga0496109_0408675_211_579 | 122 |
| 560 | 3300048913 | Ga0496110_1107160 | Ga0496110_1107160_268_636 | 122 |
| 561 | 3300048915 | Ga0496112_0353215 | Ga0496112_0353215_713_1081 | 122 |
| 562 | 3300048915 | Ga0496112_0515617 | Ga0496112_0515617_663_1091 | 122 |
| 563 | 3300048915 | Ga0496112_0544488 | Ga0496112_0544488_516_884 | 122 |
| 564 | 3300048916 | Ga0496113_0131690 | Ga0496113_0131690_1119_1487 | 122 |
| 565 | 3300049665 | Ga0501227_002226 | Ga0501227_002226_3219_3587 | 122 |
| 566 | 3300049668 | Ga0501233_096500 | Ga0501233_096500_61_429 | 122 |
| 567 | 3300049705 | Ga0501225_0031001 | Ga0501225_0031001_556_924 | 122 |
| 568 | 3300049758 | Ga0501241_084319 | Ga0501241_084319_28_396 | 122 |
| 569 | 3300050508 | nmdc:mga09592_207672_c1 | nmdc:mga09592_207672_c1_629_997 | 122 |
| 570 | 3300050510 | nmdc:mga06r32_927427_c1 | nmdc:mga06r32_927427_c1_196_564 | 122 |
| 571 | 3300050512 | nmdc:mga0n895_1195222_c1 | nmdc:mga0n895_1195222_c1_144_512 | 122 |
| 572 | 3300050512 | nmdc:mga0n895_216901_c1 | nmdc:mga0n895_216901_c1_1143_1511 | 122 |
| 573 | 3300050513 | nmdc:mga0rr50_36554_c1 | nmdc:mga0rr50_36554_c1_1535_1903 | 122 |
| 574 | 3300050515 | nmdc:mga0a205_65263_c1 | nmdc:mga0a205_65263_c1_1803_2171 | 122 |
| 575 | 3300003322 | rootL2_10112742 | rootL2_101127422 | 123 |
| 576 | 3300005295 | Ga0065707_10021463 | Ga0065707_100214633 | 123 |
| 577 | 3300005295 | Ga0065707_10154189 | Ga0065707_101541892 | 123 |
| 578 | 3300005295 | Ga0065707_10319752 | Ga0065707_103197522 | 123 |
| 579 | 3300005331 | Ga0070670_100106899 | Ga0070670_1001068992 | 123 |
| 580 | 3300005331 | Ga0070670_100519588 | Ga0070670_1005195882 | 123 |
| 581 | 3300005366 | Ga0070659_100087826 | Ga0070659_1000878263 | 123 |
| 582 | 3300005458 | Ga0070681_10850046 | Ga0070681_108500462 | 123 |
| 583 | 3300005536 | Ga0070697_100688230 | Ga0070697_1006882301 | 123 |
| 584 | 3300005577 | Ga0068857_100222149 | Ga0068857_1002221493 | 123 |
| 585 | 3300005577 | Ga0068857_100404449 | Ga0068857_1004044492 | 123 |
| 586 | 3300005578 | Ga0068854_100213665 | Ga0068854_1002136653 | 123 |
| 587 | 3300005578 | Ga0068854_100687219 | Ga0068854_1006872192 | 123 |
| 588 | 3300005615 | Ga0070702_100162800 | Ga0070702_1001628002 | 123 |
| 589 | 3300005985 | Ga0081539_10001736 | Ga0081539_1000173613 | 123 |
| 590 | 3300009147 | Ga0114129_10178702 | Ga0114129_101787023 | 123 |
| 591 | 3300009147 | Ga0114129_10413383 | Ga0114129_104133832 | 123 |
| 592 | 3300009174 | Ga0105241_11082978 | Ga0105241_110829782 | 123 |
| 593 | 3300011119 | Ga0105246_10360069 | Ga0105246_103600692 | 123 |
| 594 | 3300013307 | Ga0157372_11420328 | Ga0157372_114203282 | 123 |
| 595 | 3300013308 | Ga0157375_13134379 | Ga0157375_131343791 | 123 |
| 596 | 3300014325 | Ga0163163_10436954 | Ga0163163_104369542 | 123 |
| 597 | 3300025919 | Ga0207657_10194759 | Ga0207657_101947592 | 123 |
| 598 | 3300025925 | Ga0207650_10123853 | Ga0207650_101238532 | 123 |
| 599 | 3300025925 | Ga0207650_10764126 | Ga0207650_107641261 | 123 |
| 600 | 3300025949 | Ga0207667_11397057 | Ga0207667_113970572 | 123 |
| 601 | 3300025981 | Ga0207640_10504681 | Ga0207640_105046812 | 123 |
| 602 | 3300025981 | Ga0207640_11026700 | Ga0207640_110267002 | 123 |
| 603 | 3300026095 | Ga0207676_12254757 | Ga0207676_122547571 | 123 |
| 604 | 3300026116 | Ga0207674_10083214 | Ga0207674_100832144 | 123 |
| 605 | 3300026116 | Ga0207674_10498416 | Ga0207674_104984162 | 123 |
| 606 | 3300028380 | Ga0268265_10988145 | Ga0268265_109881452 | 123 |
| 607 | 3300031456 | Ga0307513_10270470 | Ga0307513_102704702 | 123 |
| 608 | 3300032005 | Ga0307411_11809504 | Ga0307411_118095042 | 123 |
| 609 | 3300035091 | Ga0373951_0003402 | Ga0373951_0003402_742_1113 | 123 |
| 610 | 3300035691 | Ga0373931_0618527 | Ga0373931_0618527_54_425 | 123 |
| 611 | 3300038996 | Ga0242420_001118 | Ga0242420_001118_1752_2123 | 123 |
| 612 | 3300045051 | Ga0451576_0442541 | Ga0451576_0442541_545_916 | 123 |
| 613 | 3300048909 | Ga0496106_0163516 | Ga0496106_0163516_615_986 | 123 |
| 614 | 3300050507 | nmdc:mga05p37_115257_c1 | nmdc:mga05p37_115257_c1_587_967 | 123 |
| 615 | 3300050510 | nmdc:mga06r32_1230180_c1 | nmdc:mga06r32_1230180_c1_211_582 | 123 |
| 616 | 3300005471 | Ga0070698_100067210 | Ga0070698_1000672101 | 124 |
| 617 | 3300005518 | Ga0070699_100664757 | Ga0070699_1006647572 | 124 |
| 618 | 3300005617 | Ga0068859_101537346 | Ga0068859_1015373462 | 124 |
| 619 | 3300006844 | Ga0075428_100040175 | Ga0075428_1000401757 | 124 |
| 620 | 3300006931 | Ga0097620_101537547 | Ga0097620_1015375472 | 124 |
| 621 | 3300009147 | Ga0114129_11052381 | Ga0114129_110523812 | 124 |
| 622 | 3300009148 | Ga0105243_10777061 | Ga0105243_107770612 | 124 |
| 623 | 3300037466 | Ga0395898_0643991 | Ga0395898_0643991_315_689 | 124 |
| 624 | 3300038443 | Ga0395901_0820740 | Ga0395901_0820740_388_762 | 124 |
| 625 | 3300005293 | Ga0065715_10016019 | Ga0065715_100160192 | 126 |
| 626 | 3300005340 | Ga0070689_100595295 | Ga0070689_1005952952 | 126 |
| 627 | 3300005440 | Ga0070705_100052214 | Ga0070705_1000522142 | 126 |
| 628 | 3300005444 | Ga0070694_100447880 | Ga0070694_1004478802 | 126 |
| 629 | 3300005458 | Ga0070681_10001668 | Ga0070681_100016684 | 126 |
| 630 | 3300005518 | Ga0070699_100002112 | Ga0070699_10000211214 | 126 |
| 631 | 3300005545 | Ga0070695_101039125 | Ga0070695_1010391252 | 126 |
| 632 | 3300005546 | Ga0070696_100275971 | Ga0070696_1002759713 | 126 |
| 633 | 3300005547 | Ga0070693_100095678 | Ga0070693_1000956782 | 126 |
| 634 | 3300009545 | Ga0105237_10359600 | Ga0105237_103596002 | 126 |
| 635 | 3300013100 | Ga0157373_10491603 | Ga0157373_104916032 | 126 |
| 636 | 3300014325 | Ga0163163_11786558 | Ga0163163_117865582 | 126 |
| 637 | 3300025912 | Ga0207707_10005408 | Ga0207707_100054087 | 126 |
| 638 | 3300025914 | Ga0207671_10063785 | Ga0207671_100637852 | 126 |
| 639 | 3300025921 | Ga0207652_11496882 | Ga0207652_114968822 | 126 |
| 640 | 3300026078 | Ga0207702_10298692 | Ga0207702_102986922 | 126 |
| 641 | 3300037418 | Ga0395900_0338677 | Ga0395900_0338677_999_1451 | 126 |
| 642 | 3300037466 | Ga0395898_0100682 | Ga0395898_0100682_1163_1546 | 126 |
| 643 | 3300037471 | Ga0395905_0616491 | Ga0395905_0616491_137_520 | 126 |
| 644 | 3300038443 | Ga0395901_0255449 | Ga0395901_0255449_393_776 | 126 |
| 645 | 3300048915 | Ga0496112_0297470 | Ga0496112_0297470_377_760 | 126 |
| 646 | 3300005293 | Ga0065715_10651856 | Ga0065715_106518561 | 127 |
| 647 | 3300005331 | Ga0070670_100758658 | Ga0070670_1007586582 | 127 |
| 648 | 3300005440 | Ga0070705_101338611 | Ga0070705_1013386112 | 127 |
| 649 | 3300005577 | Ga0068857_100273836 | Ga0068857_1002738362 | 127 |
| 650 | 3300005618 | Ga0068864_100514009 | Ga0068864_1005140092 | 127 |
| 651 | 3300006844 | Ga0075428_100929704 | Ga0075428_1009297042 | 127 |
| 652 | 3300006846 | Ga0075430_100100527 | Ga0075430_1001005272 | 127 |
| 653 | 3300009098 | Ga0105245_11388868 | Ga0105245_113888682 | 127 |
| 654 | 3300009174 | Ga0105241_10172507 | Ga0105241_101725073 | 127 |
| 655 | 3300025908 | Ga0207643_10398853 | Ga0207643_103988532 | 127 |
| 656 | 3300026116 | Ga0207674_10406495 | Ga0207674_104064953 | 127 |
| 657 | 3300030733 | Ga0314311_1022701 | Ga0314311_10227012 | 127 |
| 658 | 3300031548 | Ga0307408_101146393 | Ga0307408_1011463931 | 127 |
| 659 | 3300031901 | Ga0307406_11196842 | Ga0307406_111968422 | 127 |
| 660 | 3300032005 | Ga0307411_11050740 | Ga0307411_110507402 | 127 |
| 661 | 3300050508 | nmdc:mga09592_878230_c1 | nmdc:mga09592_878230_c1_24_407 | 127 |
| 662 | 3300050509 | nmdc:mga0qj67_201808_c1 | nmdc:mga0qj67_201808_c1_801_1184 | 127 |
| 663 | 3300000532 | CNAas_1000820 | CNAas_10008204 | 128 |
| 664 | 3300005354 | Ga0070675_100494554 | Ga0070675_1004945542 | 128 |
| 665 | 3300005844 | Ga0068862_100699868 | Ga0068862_1006998681 | 128 |
| 666 | 3300009553 | Ga0105249_10066893 | Ga0105249_100668934 | 128 |
| 667 | 3300013306 | Ga0163162_10085649 | Ga0163162_100856492 | 128 |
| 668 | 3300025918 | Ga0207662_10075960 | Ga0207662_100759601 | 128 |
| 669 | 3300025926 | Ga0207659_10887943 | Ga0207659_108879431 | 128 |
| 670 | 3300025961 | Ga0207712_10046583 | Ga0207712_100465833 | 128 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2qqz-assembly1.cif.gz_B | crystal structure of putative glyoxalase family protein from bacillus anthracis | 0.8723 | 1 | 122 |
| 2qqz-assembly1.cif.gz_B | crystal structure of putative glyoxalase family protein from bacillus anthracis | 0.8461 | 1 | 122 |
| 4nb0-assembly1.cif.gz_A | crystal structure of fosb from staphylococcus aureus with bs-cys9 disulfide at 1.62 angstrom resolution | 0.8167 | 1 | 122 |
| 7n7g-assembly1.cif.gz_A | crystal structure of fosb from enterococcus faecium with fosfomycin | 0.8129 | 1 | 123 |
| 4naz-assembly1.cif.gz_A | crystal structure of fosb from staphylococcus aureus with zn and sulfate at 1.15 angstrom resolution | 0.8007 | 1 | 123 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2qqzB01 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.8938 | 7 | 118 | 3.10.180.10 |
| 3itwA02 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.8753 | 70 | 120 | 3.30.720.110 |
| 2qqzB01 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.857 | 7 | 118 | 3.10.180.10 |
| 3m2oB02 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.8448 | 71 | 118 | 3.30.720.110 |
| 4nazA01 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.8007 | 1 | 123 | 3.10.180.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V8PPM9-F1-model_v4 | Bleomycin resistance protein | 0.9377 | 3 | 121 |
|
| AF-A0A3B9ML07-F1-model_v4 | Bleomycin resistance protein | 0.9342 | 3 | 122 |
|
| AF-A0A352FVU7-F1-model_v4 | Bleomycin resistance protein | 0.933 | 1 | 122 |
|
| AF-A0A252DJ89-F1-model_v4 | deleted | 0.9312 | 3 | 123 |
|
| AF-A0A2V8QT68-F1-model_v4 | Bleomycin resistance protein | 0.9287 | 3 | 122 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar