F474095

General Info

Members Datasets Scaffolds Average Seq Length
670 273 1340 388

Family's Representative Sequence

Representative Sequence 3300028379|Ga0268266_10189584|Ga0268266_101895841
Length 434
Sequence MNAIVIHYKELALKGRNRSWFVQQLVRNLRTAVAGLGVVAVRAVMGRIEIELQAPAVSPAAATGRSPAETSALGEIGAPGQVRLGSPSRGHSPASPPPGWAELRDRIGHVFGIANFSHAGRAPHEFAALASTILSDLGDTEASSFRVSARRADKQLPFTSPQIEREVGGLIKEARGWQVRLDDPELTIHVEMMPDHAFYYFGKEPGAGGLPTGTSGRVACLLSGGIDSPVAAYRMMRRGCPVLFIHFHSYPLLSRASQEKVREIATLLTRYQLRSRLHLVPFGELQQQVLLAVQPELRVVIYRRLMLRIAERLARRWKAGALVTGEVVGQVASQTLENMTTIAGATNLEILRPLVGMDKDEIIEQAQRLGTFPISIIPDQDCCQLFTPRHPATRARPEQIEAAERALPIAEMVDAAIAASVVEEFRFPMPSSPD

Samples

Sample ID Description Type Environment
1 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
66 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
69 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
70 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
71 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
72 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
152 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
155 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
156 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
157 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
158 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
159 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
160 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
161 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
162 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
163 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
164 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
165 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
166 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
167 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
168 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
169 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
170 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
171 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
172 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
173 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
174 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
175 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
176 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
177 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
178 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
179 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
180 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
181 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
182 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
183 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
184 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
185 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
186 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
187 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
188 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
189 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
190 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
191 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
192 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
193 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
194 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
195 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
196 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
197 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
198 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
199 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
200 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
201 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
202 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
203 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
204 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
205 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
206 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
207 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
208 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
209 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
210 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
211 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
212 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
213 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
214 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
215 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
216 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
217 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
218 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
219 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
220 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
221 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
222 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
223 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
224 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
225 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
226 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
227 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
228 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
229 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
230 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
231 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
232 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
233 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
241 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
242 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
243 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
244 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
245 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
246 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
247 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
248 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
249 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
250 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
252 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
253 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
254 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
255 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
256 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
257 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
258 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
259 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
260 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
261 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
262 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
263 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
264 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
265 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
266 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
267 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
268 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
269 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
270 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
271 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
272 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
273 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.79
Nodule 0
Rhizoplane 3.88
Rhizosphere 94.18
Stem 0
Stem Tuber 0
Unclassified 10

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0268266_10189584 3300028379 Bacteria 1877
2 JGI24751J29686_10002791 3300002459 Bacteria 3514
3 JGI25406J46586_10000491 3300003203 Bacteria 18498
4 Ga0065712_10020821 3300005290 Unclassified 1713
5 Ga0065712_10026676 3300005290 Bacteria 1546
6 Ga0065712_10142213 3300005290 Unclassified 1440
7 Ga0065715_10094271 3300005293 Bacteria 4389
8 Ga0065715_10118756 3300005293 Unclassified 2296
9 Ga0065707_10001449 3300005295 Bacteria 11740
10 Ga0065707_10006518 3300005295 Bacteria 3337
11 Ga0065707_10009013 3300005295 Unclassified 3939
12 Ga0070676_10004192 3300005328 Bacteria 7571
13 Ga0070676_10021642 3300005328 Bacteria 3601
14 Ga0070676_10038590 3300005328 Bacteria 2759
15 Ga0070676_10038917 3300005328 Bacteria 2748
16 Ga0070683_100000702 3300005329 Bacteria 24327
17 Ga0070683_100119518 3300005329 Bacteria 2489
18 Ga0070683_100136965 3300005329 Bacteria 2319
19 Ga0070690_100131778 3300005330 Unclassified 1689
20 Ga0070670_100003306 3300005331 Bacteria 13341
21 Ga0070670_100014348 3300005331 Bacteria 6798
22 Ga0070670_100078964 3300005331 Bacteria 2828
23 Ga0070670_100098815 3300005331 Bacteria 2512
24 Ga0070670_100187951 3300005331 Unclassified 1794
25 Ga0070677_10005129 3300005333 Bacteria 4304
26 Ga0068869_100222030 3300005334 Bacteria 1498
27 Ga0070666_10004947 3300005335 Bacteria 8153
28 Ga0070666_10126739 3300005335 Bacteria 1772
29 Ga0070680_100041031 3300005336 Unclassified 3752
30 Ga0068868_100011616 3300005338 Bacteria 6414
31 Ga0068868_100095107 3300005338 Bacteria 2404
32 Ga0070660_100088263 3300005339 Bacteria 2442
33 Ga0070689_100069246 3300005340 Bacteria 2753
34 Ga0070689_100132421 3300005340 Bacteria 2000
35 Ga0070689_100199512 3300005340 Bacteria 1633
36 Ga0070691_10000473 3300005341 Bacteria 15007
37 Ga0070692_10094327 3300005345 Bacteria 1631
38 Ga0070668_100091583 3300005347 Bacteria 2397
39 Ga0070669_100060746 3300005353 Bacteria 2777
40 Ga0070669_100088294 3300005353 Bacteria 2320
41 Ga0070669_100168146 3300005353 Bacteria 1708
42 Ga0070675_100000202 3300005354 Bacteria 37748
43 Ga0070675_100038954 3300005354 Bacteria 3876
44 Ga0070675_100223235 3300005354 Bacteria 1641
45 Ga0070671_100061790 3300005355 Bacteria 3120
46 Ga0070671_100064146 3300005355 Bacteria 3060
47 Ga0070674_100024262 3300005356 Bacteria 3934
48 Ga0070674_100045893 3300005356 Bacteria 2987
49 Ga0070674_100133085 3300005356 Bacteria 1857
50 Ga0070674_100153363 3300005356 Bacteria 1740
51 Ga0070673_100000282 3300005364 Bacteria 26333
52 Ga0070673_100002528 3300005364 Bacteria 11171
53 Ga0070673_100071179 3300005364 Bacteria 2793
54 Ga0070688_100029128 3300005365 Bacteria 3303
55 Ga0070688_100115143 3300005365 Bacteria 1794
56 Ga0070659_100233553 3300005366 Bacteria 1520
57 Ga0070667_100013136 3300005367 Bacteria 6846
58 Ga0070667_100072801 3300005367 Bacteria 2929
59 Ga0070714_100020682 3300005435 Bacteria 5379
60 Ga0070714_100347481 3300005435 Unclassified 1392
61 Ga0070701_10014384 3300005438 Bacteria 3627
62 Ga0070705_100006359 3300005440 Bacteria 5787
63 Ga0070700_100006004 3300005441 Bacteria 6461
64 Ga0070700_100070143 3300005441 Bacteria 2234
65 Ga0070700_100079587 3300005441 Bacteria 2113
66 Ga0070700_100095906 3300005441 Bacteria 1945
67 Ga0070700_100125087 3300005441 Bacteria 1728
68 Ga0070694_100010880 3300005444 Bacteria 5629
69 Ga0070694_100079292 3300005444 Bacteria 2279
70 Ga0070708_100075792 3300005445 Bacteria 3036
71 Ga0070708_100275386 3300005445 Bacteria 1583
72 Ga0070678_100002631 3300005456 Bacteria 9880
73 Ga0070678_100028953 3300005456 Bacteria 3786
74 Ga0070662_100223431 3300005457 Bacteria 1504
75 Ga0070681_10019500 3300005458 Bacteria 6790
76 Ga0070681_10108226 3300005458 Bacteria 2720
77 Ga0068867_100009353 3300005459 Bacteria 6917
78 Ga0068867_100013323 3300005459 Bacteria 5825
79 Ga0068867_100025953 3300005459 Bacteria 4203
80 Ga0068867_100065776 3300005459 Bacteria 2699
81 Ga0070706_100000101 3300005467 Bacteria 104707
82 Ga0070706_100087293 3300005467 Bacteria 2891
83 Ga0070707_100014493 3300005468 Bacteria 7388
84 Ga0070707_100058637 3300005468 Bacteria 3692
85 Ga0070707_100079899 3300005468 Bacteria 3156
86 Ga0070707_100195747 3300005468 Unclassified 1970
87 Ga0070698_100029348 3300005471 Bacteria 5710
88 Ga0070698_100040293 3300005471 Bacteria 4801
89 Ga0070698_100054630 3300005471 Bacteria 4054
90 Ga0070698_100229468 3300005471 Unclassified 1790
91 Ga0070699_100003668 3300005518 Bacteria 13600
92 Ga0070699_100008689 3300005518 Bacteria 8804
93 Ga0070699_100030443 3300005518 Bacteria 4659
94 Ga0070699_100093431 3300005518 Bacteria 2632
95 Ga0070699_100172458 3300005518 Bacteria 1917
96 Ga0070679_100022602 3300005530 Bacteria 6148
97 Ga0070679_100174362 3300005530 Bacteria 2123
98 Ga0070684_100000068 3300005535 Bacteria 65538
99 Ga0070684_100009549 3300005535 Bacteria 7645
100 Ga0070697_100000189 3300005536 Bacteria 50813
101 Ga0070697_100038812 3300005536 Bacteria 3848
102 Ga0070697_100189167 3300005536 Bacteria 1747
103 Ga0070672_100029894 3300005543 Bacteria 4089
104 Ga0070695_100000785 3300005545 Bacteria 17066
105 Ga0070695_100014083 3300005545 Bacteria 4815
106 Ga0070696_100029118 3300005546 Bacteria 3771
107 Ga0070696_100058504 3300005546 Bacteria 2692
108 Ga0070696_100078877 3300005546 Bacteria 2329
109 Ga0070696_100125583 3300005546 Bacteria 1861
110 Ga0070693_100047782 3300005547 Bacteria 2436
111 Ga0070665_100006386 3300005548 Bacteria 12013
112 Ga0070665_100008967 3300005548 Bacteria 10134
113 Ga0070665_100010405 3300005548 Bacteria 9414
114 Ga0070665_100033210 3300005548 Bacteria 5192
115 Ga0070704_100001151 3300005549 Bacteria 13820
116 Ga0070704_100011495 3300005549 Bacteria 5427
117 Ga0070704_100055179 3300005549 Bacteria 2815
118 Ga0070704_100089098 3300005549 Bacteria 2294
119 Ga0070704_100103135 3300005549 Bacteria 2154
120 Ga0070704_100140567 3300005549 Unclassified 1884
121 Ga0070704_100146319 3300005549 Unclassified 1852
122 Ga0068855_100322533 3300005563 Bacteria 1707
123 Ga0070664_100008127 3300005564 Bacteria 8482
124 Ga0068857_100050996 3300005577 Bacteria 3670
125 Ga0068854_100050997 3300005578 Bacteria 2963
126 Ga0068854_100052821 3300005578 Bacteria 2916
127 Ga0070702_100001302 3300005615 Bacteria 10114
128 Ga0068859_100005666 3300005617 Bacteria 12714
129 Ga0068859_100024547 3300005617 Bacteria 6048
130 Ga0068859_100227254 3300005617 Bacteria 1954
131 Ga0068859_100266819 3300005617 Unclassified 1804
132 Ga0068859_100328683 3300005617 Bacteria 1623
133 Ga0068864_100006553 3300005618 Bacteria 9539
134 Ga0068866_10010359 3300005718 Bacteria 3994
135 Ga0068861_100003622 3300005719 Bacteria 10288
136 Ga0068863_100066986 3300005841 Bacteria 3396
137 Ga0068863_100140256 3300005841 Unclassified 2310
138 Ga0068863_100194278 3300005841 Bacteria 1951
139 Ga0068858_100005453 3300005842 Bacteria 12454
140 Ga0068858_100013146 3300005842 Bacteria 7805
141 Ga0068858_100034125 3300005842 Bacteria 4720
142 Ga0068858_100180904 3300005842 Bacteria 1991
143 Ga0068860_100061312 3300005843 Bacteria 3574
144 Ga0068860_100185959 3300005843 Bacteria 2009
145 Ga0068862_100016452 3300005844 Bacteria 6156
146 Ga0068862_100046267 3300005844 Bacteria 3712
147 Ga0068862_100234264 3300005844 Bacteria 1667
148 Ga0068862_100323912 3300005844 Bacteria 1423
149 Ga0081455_10013648 3300005937 Bacteria 8002
150 Ga0081455_10102180 3300005937 Unclassified 2299
151 Ga0081455_10116831 3300005937 Bacteria 2109
152 Ga0081538_10001528 3300005981 Bacteria 23736
153 Ga0081538_10058983 3300005981 Bacteria 2221
154 Ga0081539_10000093 3300005985 Bacteria 207314
155 Ga0075365_10007190 3300006038 Bacteria 6215
156 Ga0075364_10047399 3300006051 Bacteria 2799
157 Ga0075362_10000421 3300006177 Bacteria 12191
158 Ga0075367_10003356 3300006178 Bacteria 7615
159 Ga0075366_10013364 3300006195 Bacteria 4672
160 Ga0097621_100000477 3300006237 Bacteria 28162
161 Ga0097621_100002349 3300006237 Bacteria 12970
162 Ga0097621_100013417 3300006237 Bacteria 6107
163 Ga0097621_100022317 3300006237 Bacteria 4912
164 Ga0097621_100030260 3300006237 Bacteria 4284
165 Ga0097621_100040296 3300006237 Bacteria 3755
166 Ga0097621_100192429 3300006237 Unclassified 1767
167 Ga0075370_10006888 3300006353 Bacteria 5751
168 Ga0068871_100005279 3300006358 Bacteria 9044
169 Ga0068871_100012430 3300006358 Bacteria 6275
170 Ga0068871_100015114 3300006358 Bacteria 5771
171 Ga0068871_100032832 3300006358 Bacteria 4104
172 Ga0075428_100000080 3300006844 Bacteria 80349
173 Ga0075428_100032730 3300006844 Bacteria 5742
174 Ga0075428_100131866 3300006844 Bacteria 2717
175 Ga0075428_100414895 3300006844 Bacteria 1442
176 Ga0075430_100002473 3300006846 Bacteria 15388
177 Ga0075430_100078679 3300006846 Unclassified 2764
178 Ga0075431_100002515 3300006847 Bacteria 17677
179 Ga0075431_100011777 3300006847 Bacteria 8824
180 Ga0075431_100133808 3300006847 Unclassified 2556
181 Ga0075433_10007021 3300006852 Bacteria 8923
182 Ga0075433_10016600 3300006852 Bacteria 6075
183 Ga0075433_10129598 3300006852 Bacteria 2241
184 Ga0075434_100004294 3300006871 Bacteria 12804
185 Ga0075434_100005549 3300006871 Bacteria 11495
186 Ga0075434_100010893 3300006871 Bacteria 8550
187 Ga0075434_100035368 3300006871 Bacteria 4938
188 Ga0075434_100045559 3300006871 Bacteria 4351
189 Ga0075434_100059288 3300006871 Bacteria 3805
190 Ga0075434_100162802 3300006871 Bacteria 2251
191 Ga0075434_100302637 3300006871 Bacteria 1620
192 Ga0075429_100000156 3300006880 Bacteria 42804
193 Ga0075429_100001098 3300006880 Bacteria 21794
194 Ga0075429_100050306 3300006880 Bacteria 3626
195 Ga0075429_100093444 3300006880 Bacteria 2623
196 Ga0068865_100008148 3300006881 Bacteria 6466
197 Ga0068865_100039835 3300006881 Bacteria 3189
198 Ga0068865_100058204 3300006881 Bacteria 2698
199 Ga0068865_100089278 3300006881 Bacteria 2232
200 Ga0075436_100000295 3300006914 Bacteria 31676
201 Ga0075436_100007582 3300006914 Bacteria 7413
202 Ga0097620_100005666 3300006931 Bacteria 12714
203 Ga0097620_100024547 3300006931 Bacteria 6048
204 Ga0097620_100227264 3300006931 Bacteria 1954
205 Ga0097620_100266820 3300006931 Unclassified 1804
206 Ga0097620_100328726 3300006931 Bacteria 1623
207 Ga0075435_100000147 3300007076 Bacteria 39845
208 Ga0075435_100002656 3300007076 Bacteria 11922
209 Ga0075435_100030102 3300007076 Bacteria 4266
210 Ga0075435_100036648 3300007076 Bacteria 3900
211 Ga0075435_100037478 3300007076 Bacteria 3861
212 Ga0075435_100091312 3300007076 Bacteria 2513
213 Ga0075435_100149449 3300007076 Archaea 1963
214 Ga0105240_10011792 3300009093 Bacteria 12141
215 Ga0105240_10034088 3300009093 Bacteria 6571
216 Ga0105240_10178022 3300009093 Unclassified 2512
217 Ga0105240_10180230 3300009093 Bacteria 2494
218 Ga0105240_10197850 3300009093 Bacteria 2357
219 Ga0111539_10000059 3300009094 Bacteria 113645
220 Ga0111539_10000181 3300009094 Bacteria 73457
221 Ga0111539_10000209 3300009094 Bacteria 69503
222 Ga0111539_10002429 3300009094 Bacteria 24773
223 Ga0111539_10009783 3300009094 Bacteria 12103
224 Ga0111539_10043681 3300009094 Bacteria 5372
225 Ga0111539_10047449 3300009094 Bacteria 5132
226 Ga0111539_10100907 3300009094 Bacteria 3389
227 Ga0111539_10115071 3300009094 Bacteria 3155
228 Ga0111539_10137313 3300009094 Bacteria 2863
229 Ga0111539_10145053 3300009094 Bacteria 2779
230 Ga0111539_10164168 3300009094 Bacteria 2598
231 Ga0105245_10005530 3300009098 Bacteria 11098
232 Ga0105245_10324095 3300009098 Bacteria 1519
233 Ga0105247_10019812 3300009101 Bacteria 4041
234 Ga0105247_10031210 3300009101 Bacteria 3233
235 Ga0105247_10040093 3300009101 Unclassified 2862
236 Ga0114129_10000077 3300009147 Bacteria 90951
237 Ga0114129_10001820 3300009147 Bacteria 29050
238 Ga0114129_10009067 3300009147 Bacteria 14179
239 Ga0114129_10034155 3300009147 Bacteria 7183
240 Ga0114129_10036366 3300009147 Bacteria 6954
241 Ga0114129_10043732 3300009147 Bacteria 6302
242 Ga0114129_10106350 3300009147 Unclassified 3876
243 Ga0114129_10108011 3300009147 Bacteria 3842
244 Ga0114129_10112109 3300009147 Bacteria 3762
245 Ga0105243_10016882 3300009148 Bacteria 5520
246 Ga0105243_10054372 3300009148 Bacteria 3179
247 Ga0105242_10003632 3300009176 Bacteria 12008
248 Ga0105242_10027319 3300009176 Bacteria 4529
249 Ga0105242_10097791 3300009176 Bacteria 2482
250 Ga0105248_10004014 3300009177 Bacteria 16266
251 Ga0105248_10014318 3300009177 Bacteria 8730
252 Ga0105248_10018395 3300009177 Bacteria 7720
253 Ga0105248_10023744 3300009177 Bacteria 6814
254 Ga0105248_10033764 3300009177 Bacteria 5718
255 Ga0105248_10043896 3300009177 Bacteria 5014
256 Ga0105248_10148605 3300009177 Bacteria 2644
257 Ga0105248_10317020 3300009177 Bacteria 1756
258 Ga0105237_10176890 3300009545 Bacteria 2134
259 Ga0105249_10153421 3300009553 Bacteria 2219
260 Ga0105249_10154010 3300009553 Bacteria 2215
261 Ga0105249_10232698 3300009553 Unclassified 1818
262 Ga0157370_10278479 3300013104 Bacteria 1546
263 Ga0157374_10128612 3300013296 Bacteria 2450
264 Ga0157374_10305188 3300013296 Unclassified 1575
265 Ga0157378_10000578 3300013297 Bacteria 34492
266 Ga0157378_10023338 3300013297 Bacteria 5444
267 Ga0163162_10056599 3300013306 Bacteria 3949
268 Ga0157372_10140203 3300013307 Unclassified 2785
269 Ga0157375_10002741 3300013308 Bacteria 15224
270 Ga0157375_10028668 3300013308 Bacteria 5223
271 Ga0157375_10132350 3300013308 Unclassified 2614
272 Ga0157375_10218723 3300013308 Unclassified 2063
273 Ga0163163_10010892 3300014325 Bacteria 8216
274 Ga0163163_10013097 3300014325 Bacteria 7577
275 Ga0163163_10023177 3300014325 Bacteria 5890
276 Ga0157380_10034162 3300014326 Bacteria 3921
277 Ga0157380_10051633 3300014326 Bacteria 3253
278 Ga0157380_10065967 3300014326 Bacteria 2911
279 Ga0157380_10114672 3300014326 Bacteria 2271
280 Ga0157379_10000584 3300014968 Bacteria 29559
281 Ga0157379_10017975 3300014968 Bacteria 6231
282 Ga0157379_10018346 3300014968 Bacteria 6168
283 Ga0157379_10021777 3300014968 Bacteria 5678
284 Ga0157379_10044495 3300014968 Bacteria 3963
285 Ga0157379_10171473 3300014968 Bacteria 1959
286 Ga0157376_10019378 3300014969 Bacteria 5243
287 Ga0157376_10034338 3300014969 Bacteria 4095
288 Ga0157376_10041762 3300014969 Bacteria 3757
289 Ga0157376_10124749 3300014969 Bacteria 2288
290 Ga0207682_10011954 3300025893 Bacteria 3390
291 Ga0207682_10015468 3300025893 Unclassified 2970
292 Ga0207680_10004015 3300025903 Bacteria 6953
293 Ga0207680_10019777 3300025903 Bacteria 3609
294 Ga0207680_10030934 3300025903 Bacteria 3026
295 Ga0207680_10041021 3300025903 Bacteria 2698
296 Ga0207699_10077698 3300025906 Unclassified 2049
297 Ga0207645_10041479 3300025907 Bacteria 2945
298 Ga0207684_10000584 3300025910 Bacteria 44035
299 Ga0207684_10000607 3300025910 Bacteria 42607
300 Ga0207684_10214483 3300025910 Bacteria 1661
301 Ga0207684_10325909 3300025910 Unclassified 1323
302 Ga0207707_10036870 3300025912 Bacteria 4273
303 Ga0207707_10039875 3300025912 Unclassified 4103
304 Ga0207707_10230432 3300025912 Unclassified 1611
305 Ga0207695_10136275 3300025913 Unclassified 2408
306 Ga0207695_10165469 3300025913 Unclassified 2140
307 Ga0207671_10111125 3300025914 Bacteria 2085
308 Ga0207660_10029026 3300025917 Unclassified 3790
309 Ga0207662_10009833 3300025918 Bacteria 5277
310 Ga0207662_10064804 3300025918 Bacteria 2199
311 Ga0207657_10114870 3300025919 Bacteria 2219
312 Ga0207649_10022407 3300025920 Bacteria 3649
313 Ga0207652_10038008 3300025921 Unclassified 4078
314 Ga0207652_10210762 3300025921 Bacteria 1749
315 Ga0207646_10024832 3300025922 Bacteria 5485
316 Ga0207646_10036794 3300025922 Bacteria 4417
317 Ga0207646_10036937 3300025922 Bacteria 4407
318 Ga0207681_10012038 3300025923 Bacteria 5329
319 Ga0207681_10019225 3300025923 Bacteria 4314
320 Ga0207681_10244036 3300025923 Bacteria 1399
321 Ga0207650_10008008 3300025925 Bacteria 7201
322 Ga0207650_10030010 3300025925 Bacteria 3913
323 Ga0207650_10180756 3300025925 Bacteria 1681
324 Ga0207650_10188207 3300025925 Bacteria 1648
325 Ga0207659_10000076 3300025926 Bacteria 62373
326 Ga0207659_10017562 3300025926 Bacteria 4675
327 Ga0207659_10096939 3300025926 Bacteria 2214
328 Ga0207687_10008541 3300025927 Bacteria 6698
329 Ga0207664_10177549 3300025929 Unclassified 1827
330 Ga0207644_10022378 3300025931 Bacteria 4319
331 Ga0207706_10066896 3300025933 Bacteria 3162
332 Ga0207706_10084052 3300025933 Bacteria 2798
333 Ga0207706_10099614 3300025933 Bacteria 2557
334 Ga0207686_10017136 3300025934 Bacteria 4077
335 Ga0207686_10020853 3300025934 Bacteria 3751
336 Ga0207709_10048363 3300025935 Bacteria 2591
337 Ga0207670_10131699 3300025936 Bacteria 1833
338 Ga0207669_10015080 3300025937 Unclassified 3888
339 Ga0207669_10046761 3300025937 Bacteria 2559
340 Ga0207669_10062920 3300025937 Bacteria 2288
341 Ga0207669_10093624 3300025937 Unclassified 1964
342 Ga0207669_10221925 3300025937 Bacteria 1388
343 Ga0207704_10010703 3300025938 Bacteria 4486
344 Ga0207704_10062347 3300025938 Bacteria 2318
345 Ga0207704_10132313 3300025938 Bacteria 1730
346 Ga0207691_10000274 3300025940 Bacteria 51054
347 Ga0207691_10022903 3300025940 Bacteria 5887
348 Ga0207691_10095964 3300025940 Bacteria 2651
349 Ga0207711_10016158 3300025941 Bacteria 6196
350 Ga0207711_10030976 3300025941 Bacteria 4512
351 Ga0207711_10033697 3300025941 Bacteria 4335
352 Ga0207711_10042071 3300025941 Bacteria 3892
353 Ga0207711_10073136 3300025941 Unclassified 2979
354 Ga0207711_10091941 3300025941 Bacteria 2669
355 Ga0207711_10114557 3300025941 Bacteria 2401
356 Ga0207661_10002311 3300025944 Bacteria 13129
357 Ga0207661_10031293 3300025944 Bacteria 4108
358 Ga0207679_10002489 3300025945 Bacteria 11346
359 Ga0207679_10193752 3300025945 Bacteria 1692
360 Ga0207651_10000358 3300025960 Bacteria 19310
361 Ga0207668_10051113 3300025972 Bacteria 2853
362 Ga0207640_10026213 3300025981 Bacteria 3536
363 Ga0207640_10040545 3300025981 Bacteria 2955
364 Ga0207658_10053150 3300025986 Bacteria 2992
365 Ga0207677_10029159 3300026023 Bacteria 3503
366 Ga0207677_10038536 3300026023 Bacteria 3134
367 Ga0207677_10098597 3300026023 Bacteria 2144
368 Ga0207703_10021562 3300026035 Bacteria 5044
369 Ga0207703_10024618 3300026035 Bacteria 4735
370 Ga0207703_10136597 3300026035 Bacteria 2123
371 Ga0207703_10225785 3300026035 Bacteria 1676
372 Ga0207678_10030823 3300026067 Bacteria 4683
373 Ga0207708_10067610 3300026075 Bacteria 2734
374 Ga0207641_10001113 3300026088 Bacteria 27018
375 Ga0207641_10099587 3300026088 Bacteria 2558
376 Ga0207641_10188514 3300026088 Bacteria 1894
377 Ga0207648_10015198 3300026089 Bacteria 7085
378 Ga0207648_10017181 3300026089 Bacteria 6592
379 Ga0207648_10024699 3300026089 Bacteria 5360
380 Ga0207676_10090218 3300026095 Bacteria 2514
381 Ga0207676_10139761 3300026095 Bacteria 2072
382 Ga0207674_10102743 3300026116 Bacteria 2838
383 Ga0207675_100009497 3300026118 Bacteria 9103
384 Ga0207675_100015621 3300026118 Bacteria 7082
385 Ga0207675_100030251 3300026118 Bacteria 5043
386 Ga0207675_100044375 3300026118 Bacteria 4154
387 Ga0207683_10000220 3300026121 Bacteria 50064
388 Ga0207683_10078339 3300026121 Bacteria 2928
389 Ga0207683_10135318 3300026121 Unclassified 2218
390 Ga0207683_10198667 3300026121 Bacteria 1822
391 Ga0209974_10014515 3300027876 Bacteria 2621
392 Ga0207428_10000022 3300027907 Bacteria 273333
393 Ga0207428_10000558 3300027907 Bacteria 44040
394 Ga0207428_10010107 3300027907 Bacteria 8441
395 Ga0207428_10044726 3300027907 Bacteria 3570
396 Ga0207428_10113132 3300027907 Bacteria 2087
397 Ga0207428_10130250 3300027907 Bacteria 1925
398 Ga0207428_10215065 3300027907 Bacteria 1443
399 Ga0268266_10003789 3300028379 Bacteria 14802
400 Ga0268266_10013799 3300028379 Bacteria 6955
401 Ga0268266_10059104 3300028379 Bacteria 3303
402 Ga0268265_10005243 3300028380 Bacteria 8869
403 Ga0268265_10015893 3300028380 Bacteria 5162
404 Ga0268265_10048093 3300028380 Bacteria 3200
405 Ga0268265_10084405 3300028380 Bacteria 2517
406 Ga0268264_10150375 3300028381 Bacteria 2087
407 Ga0268264_10183526 3300028381 Bacteria 1902
408 Ga0268264_10222629 3300028381 Bacteria 1738
409 Ga0307408_100014908 3300031548 Bacteria 5170
410 Ga0307408_100017734 3300031548 Bacteria 4769
411 Ga0307408_100028574 3300031548 Bacteria 3855
412 Ga0307408_100048714 3300031548 Bacteria 3040
413 Ga0307408_100174714 3300031548 Bacteria 1718
414 Ga0316576_10001732 3300031727 Bacteria 12009
415 Ga0316576_10012676 3300031727 Bacteria 5576
416 Ga0316576_10079178 3300031727 Bacteria 2436
417 Ga0316576_10097215 3300031727 Bacteria 2198
418 Ga0316578_10039372 3300031728 Bacteria 2730
419 Ga0316578_10045731 3300031728 Bacteria 2549
420 Ga0307405_10106539 3300031731 Unclassified 1891
421 Ga0307413_10011324 3300031824 Bacteria 4378
422 Ga0307410_10015511 3300031852 Bacteria 4522
423 Ga0307406_10006061 3300031901 Bacteria 6644
424 Ga0307406_10060683 3300031901 Bacteria 2439
425 Ga0307407_10083699 3300031903 Bacteria 1936
426 Ga0307407_10164637 3300031903 Bacteria 1454
427 Ga0307412_10056975 3300031911 Bacteria 2606
428 Ga0307412_10080319 3300031911 Bacteria 2252
429 Ga0307412_10257282 3300031911 Unclassified 1359
430 Ga0307409_100001383 3300031995 Bacteria 11838
431 Ga0307409_100015060 3300031995 Bacteria 5058
432 Ga0307409_100043912 3300031995 Bacteria 3361
433 Ga0307409_100099475 3300031995 Bacteria 2408
434 Ga0307409_100146814 3300031995 Bacteria 2041
435 Ga0307409_100169240 3300031995 Bacteria 1921
436 Ga0307416_100019816 3300032002 Bacteria 4780
437 Ga0307416_100042086 3300032002 Bacteria 3563
438 Ga0307416_100051044 3300032002 Bacteria 3301
439 Ga0307416_100128625 3300032002 Bacteria 2274
440 Ga0307416_100164779 3300032002 Unclassified 2054
441 Ga0307416_100225817 3300032002 Unclassified 1800
442 Ga0307416_100248288 3300032002 Bacteria 1730
443 Ga0307414_10003946 3300032004 Bacteria 7998
444 Ga0307414_10294894 3300032004 Bacteria 1369
445 Ga0307411_10013487 3300032005 Bacteria 4511
446 Ga0307411_10022704 3300032005 Bacteria 3700
447 Ga0307411_10040453 3300032005 Bacteria 2957
448 Ga0307415_100033261 3300032126 Bacteria 3346
449 Ga0307415_100036207 3300032126 Bacteria 3232
450 Ga0307415_100059500 3300032126 Bacteria 2635
451 Ga0307415_100070606 3300032126 Bacteria 2453
452 Ga0307415_100152678 3300032126 Unclassified 1779
453 Ga0307415_100155516 3300032126 Bacteria 1765
454 Ga0316585_10003409 3300032137 Bacteria 4382
455 Ga0373930_0005539 3300034816 Bacteria 2104
456 Ga0373948_0001144 3300034817 Bacteria 3590
457 Ga0373959_0003577 3300034820 Bacteria 2484
458 Ga0373938_0009930 3300034957 Bacteria 1735
459 Ga0373929_0001662 3300035085 Bacteria 4206
460 Ga0373949_0003851 3300035090 Bacteria 3486
461 Ga0373951_0001709 3300035091 Bacteria 5739
462 Ga0373952_0005960 3300035092 Bacteria 2242
463 Ga0373960_0001784 3300035121 Bacteria 4826
464 Ga0373960_0019621 3300035121 Unclassified 1778
465 Ga0373943_0014143 3300035170 Bacteria 3609
466 Ga0373943_0093508 3300035170 Bacteria 1561
467 Ga0373955_0062485 3300035172 Bacteria 2060
468 Ga0373942_0002156 3300035207 Bacteria 4857
469 Ga0373961_0001299 3300035241 Bacteria 7587
470 Ga0373962_0021759 3300035242 Bacteria 1694
471 Ga0316574_0005798 3300035398 Bacteria 6623
472 Ga0373931_0003301 3300035691 Bacteria 7222
473 Ga0373935_0001390 3300035692 Bacteria 13377
474 Ga0373927_0195421 3300035695 Unclassified 1328
475 Ga0373947_0019793 3300035725 Bacteria 3884
476 Ga0373947_0030984 3300035725 Bacteria 3145
477 Ga0373947_0061983 3300035725 Bacteria 2274
478 Ga0373937_0113098 3300036401 Unclassified 2526
479 Ga0373937_0130401 3300036401 Bacteria 2348
480 Ga0373937_0192147 3300036401 Bacteria 1918
481 Ga0373937_0324798 3300036401 Unclassified 1456
482 Ga0316584_0062827 3300036712 Unclassified 2781
483 Ga0316584_0147689 3300036712 Bacteria 1751
484 Ga0395901_0138426 3300038443 Bacteria 2559
485 Ga0400489_79885 3300039093 Bacteria 2165
486 Ga0439450_011231 3300042008 Bacteria 1750
487 Ga0450894_001322 3300042131 Bacteria 3596
488 Ga0450896_003414 3300042133 Bacteria 2108
489 Ga0439446_0005503 3300042156 Bacteria 3260
490 Ga0451577_0009300 3300042876 Bacteria 9473
491 Ga0453683_0101290 3300044673 Bacteria 1808
492 Ga0466963_0043121 3300044694 Bacteria 2965
493 Ga0453684_0189375 3300044712 Archaea 2408
494 Ga0451576_0085794 3300045051 Bacteria 3275
495 Ga0451576_0295006 3300045051 Bacteria 1695
496 Ga0466967_0120944 3300045976 Bacteria 2419
497 Ga0466967_0149774 3300045976 Archaea 2180
498 Ga0495592_0047193 3300046454 Bacteria 3208
499 Ga0495603_0077086 3300046455 Bacteria 1956
500 Ga0495603_0159939 3300046455 Unclassified 1306
501 Ga0495629_0138722 3300046459 Bacteria 1692
502 Ga0495653_0282290 3300046463 Bacteria 1089
503 Ga0495580_0004341 3300046472 Bacteria 11903
504 Ga0495580_0085690 3300046472 Bacteria 2194
505 Ga0495580_0168405 3300046472 Bacteria 1515
506 Ga0495582_0142071 3300046473 Bacteria 1361
507 Ga0495664_0046084 3300046477 Bacteria 2587
508 Ga0495664_0059719 3300046477 Bacteria 2270
509 Ga0495608_0011561 3300046511 Bacteria 6140
510 Ga0495628_0172061 3300046516 Bacteria 1642
511 Ga0495652_0118392 3300046529 Bacteria 2117
512 Ga0495586_0128782 3300046535 Bacteria 1417
513 Ga0495645_0007653 3300046543 Bacteria 7516
514 Ga0495645_0076832 3300046543 Bacteria 2401
515 Ga0495647_0023242 3300046681 Bacteria 2247
516 Ga0495647_0042692 3300046681 Bacteria 1733
517 Ga0495658_0022670 3300046683 Bacteria 3324
518 Ga0495658_0085015 3300046683 Bacteria 1864
519 Ga0495658_0104655 3300046683 Bacteria 1694
520 Ga0495669_0000990 3300046684 Bacteria 11874
521 Ga0495613_0004695 3300046689 Bacteria 10249
522 Ga0495613_0148506 3300046689 Bacteria 1673
523 Ga0495604_0017283 3300047317 Bacteria 5773
524 Ga0495674_0029729 3300047319 Bacteria 4972
525 Ga0495674_0172636 3300047319 Bacteria 1803
526 Ga0495684_0000228 3300047471 Bacteria 43929
527 Ga0496100_0026293 3300048903 Bacteria 3567
528 Ga0496101_0000348 3300048904 Bacteria 31198
529 Ga0496101_0064748 3300048904 Bacteria 2664
530 Ga0496102_0297390 3300048905 Bacteria 1521
531 Ga0496104_0005196 3300048907 Bacteria 11382
532 Ga0496104_0069587 3300048907 Bacteria 3345
533 Ga0496104_0084489 3300048907 Bacteria 3029
534 Ga0496104_0109714 3300048907 Unclassified 2645
535 Ga0496104_0217815 3300048907 Bacteria 1821
536 Ga0496106_0097866 3300048909 Bacteria 2272
537 Ga0496106_0265093 3300048909 Bacteria 1375
538 Ga0496107_0139087 3300048910 Bacteria 1795
539 Ga0496108_0021614 3300048911 Bacteria 5287
540 Ga0496108_0148650 3300048911 Bacteria 2021
541 Ga0496108_0284399 3300048911 Bacteria 1440
542 Ga0496109_0001290 3300048912 Bacteria 20786
543 Ga0496110_0008036 3300048913 Bacteria 8459
544 Ga0496110_0159285 3300048913 Bacteria 2046
545 Ga0496110_0277894 3300048913 Bacteria 1525
546 Ga0496112_0027070 3300048915 Bacteria 5527
547 Ga0496112_0091338 3300048915 Bacteria 3014
548 Ga0496114_0002236 3300048917 Bacteria 14743
549 Ga0496114_0002337 3300048917 Bacteria 14432
550 Ga0496114_0109399 3300048917 Unclassified 2367
551 Ga0496114_0211738 3300048917 Bacteria 1700
552 Ga0496115_0012077 3300048918 Bacteria 6495
553 Ga0501031_0040726 3300049568 Bacteria 3033
554 Ga0501036_0030546 3300049572 Bacteria 4550
555 Ga0501036_0156172 3300049572 Unclassified 1924
556 Ga0501036_0279895 3300049572 Unclassified 1396
557 Ga0501037_0119167 3300049573 Bacteria 1899
558 Ga0501040_0004841 3300049576 Bacteria 8723
559 Ga0501040_0201607 3300049576 Unclassified 1413
560 Ga0501041_0002942 3300049577 Bacteria 9771
561 Ga0501047_0072784 3300049581 Bacteria 3308
562 Ga0501048_0013517 3300049582 Bacteria 6057
563 Ga0501048_0042667 3300049582 Bacteria 3247
564 Ga0501071_0006201 3300049587 Bacteria 7754
565 Ga0501071_0016739 3300049587 Bacteria 5043
566 Ga0501071_0019329 3300049587 Bacteria 4727
567 Ga0501071_0022296 3300049587 Bacteria 4415
568 Ga0501072_0010004 3300049588 Bacteria 7213
569 Ga0501072_0017543 3300049588 Bacteria 5502
570 Ga0501072_0030128 3300049588 Bacteria 4242
571 Ga0501072_0048095 3300049588 Bacteria 3359
572 Ga0501074_0087231 3300049590 Bacteria 2235
573 Ga0501074_0111236 3300049590 Bacteria 1960
574 Ga0501075_0079644 3300049591 Bacteria 2479
575 Ga0501075_0105271 3300049591 Bacteria 2144
576 Ga0501076_0026029 3300049592 Bacteria 4527
577 Ga0501076_0164356 3300049592 Unclassified 1809
578 Ga0501076_0171279 3300049592 Bacteria 1769
579 Ga0501217_028030 3300049661 Bacteria 1370
580 Ga0501079_0007892 3300049741 Bacteria 8066
581 Ga0501079_0029175 3300049741 Bacteria 4234
582 Ga0501080_0055210 3300049742 Bacteria 3700
583 Ga0501081_0000406 3300049743 Bacteria 23901
584 Ga0501081_0136202 3300049743 Bacteria 1758
585 Ga0501081_0160036 3300049743 Unclassified 1622
586 Ga0501081_0177963 3300049743 Bacteria 1537
587 Ga0501083_0149519 3300049744 Bacteria 1529
588 Ga0501035_0076370 3300049822 Bacteria 2963
589 Ga0501045_0002648 3300049824 Bacteria 12203
590 Ga0501045_0007195 3300049824 Bacteria 7722
591 Ga0501045_0011015 3300049824 Bacteria 6338
592 Ga0501045_0193451 3300049824 Unclassified 1516
593 nmdc:mga03683_600_c2 3300050489 Bacteria 8045
594 nmdc:mga00v17_23721_c1 3300050491 Bacteria 3552
595 nmdc:mga00v17_4143_c1 3300050491 Bacteria 7506
596 nmdc:mga0yw44_4147_c1 3300050492 Bacteria 6583
597 nmdc:mga0yw44_61194_c1 3300050492 Bacteria 2309
598 nmdc:mga0k408_4679_c1 3300050493 Bacteria 7252
599 nmdc:mga05p37_121506_c1 3300050507 Unclassified 3208
600 nmdc:mga05p37_1796_c1 3300050507 Bacteria 25058
601 nmdc:mga05p37_200269_c1 3300050507 Archaea 2419
602 nmdc:mga05p37_2105_c1 3300050507 Bacteria 23247
603 nmdc:mga05p37_216566_c1 3300050507 Bacteria 2313
604 nmdc:mga05p37_235500_c1 3300050507 Bacteria 2204
605 nmdc:mga05p37_2819_c1 3300050507 Bacteria 20214
606 nmdc:mga05p37_34458_c1 3300050507 Bacteria 6202
607 nmdc:mga05p37_4142_c1 3300050507 Bacteria 16948
608 nmdc:mga05p37_48480_c1 3300050507 Bacteria 5224
609 nmdc:mga05p37_580882_c1 3300050507 Bacteria 1269
610 nmdc:mga09592_3401_c1 3300050508 Bacteria 12863
611 nmdc:mga09592_4431_c1 3300050508 Bacteria 11368
612 nmdc:mga0qj67_4824_c1 3300050509 Bacteria 9800
613 nmdc:mga0qj67_62847_c1 3300050509 Bacteria 2951
614 nmdc:mga06r32_134482_c1 3300050510 Bacteria 2447
615 nmdc:mga06r32_23254_c1 3300050510 Bacteria 5732
616 nmdc:mga06r32_6534_c1 3300050510 Bacteria 10474
617 nmdc:mga06r32_77179_c1 3300050510 Archaea 3236
618 nmdc:mga06r32_90676_c1 3300050510 Bacteria 2986
619 nmdc:mga08y16_10497_c1 3300050511 Bacteria 9716
620 nmdc:mga08y16_1066_c1 3300050511 Bacteria 26995
621 nmdc:mga08y16_108938_c1 3300050511 Bacteria 2884
622 nmdc:mga08y16_125304_c1 3300050511 Bacteria 2672
623 nmdc:mga08y16_1923_c1 3300050511 Bacteria 21184
624 nmdc:mga08y16_21_c1 3300050511 Bacteria 254790
625 nmdc:mga08y16_282095_c1 3300050511 Bacteria 1713
626 nmdc:mga08y16_35300_c1 3300050511 Bacteria 5251
627 nmdc:mga0n895_153202_c1 3300050512 Unclassified 2336
628 nmdc:mga0n895_2150_c1 3300050512 Bacteria 15218
629 nmdc:mga0n895_31871_c1 3300050512 Bacteria 5053
630 nmdc:mga0n895_3356_c1 3300050512 Bacteria 12873
631 nmdc:mga0n895_400504_c1 3300050512 Bacteria 1388
632 nmdc:mga0n895_59365_c1 3300050512 Bacteria 3774
633 nmdc:mga0n895_74231_c1 3300050512 Bacteria 3378
634 nmdc:mga0n895_97_c2 3300050512 Bacteria 37428
635 nmdc:mga0rr50_20_c1 3300050513 Bacteria 140799
636 nmdc:mga0rr50_214006_c1 3300050513 Bacteria 1589
637 nmdc:mga0rr50_223155_c1 3300050513 Unclassified 1557
638 nmdc:mga0rr50_31819_c1 3300050513 Bacteria 3752
639 nmdc:mga0rr50_41109_c1 3300050513 Bacteria 3366
640 nmdc:mga0rr50_42681_c1 3300050513 Bacteria 3314
641 nmdc:mga0rr50_43911_c1 3300050513 Bacteria 3274
642 nmdc:mga0rr50_62346_c1 3300050513 Bacteria 2812
643 nmdc:mga08x19_178_c1 3300050514 Bacteria 51286
644 nmdc:mga08x19_41524_c1 3300050514 Bacteria 2930
645 nmdc:mga0a205_138041_c1 3300050515 Unclassified 2338
646 nmdc:mga0a205_249232_c1 3300050515 Bacteria 1656
647 nmdc:mga0a205_3446_c1 3300050515 Bacteria 14116
648 nmdc:mga0a205_41616_c1 3300050515 Bacteria 4425
649 Ga0495601_0086087 3300053077 Bacteria 2019
650 Ga0495619_0000422 3300053085 Bacteria 28636
651 Ga0495619_0038606 3300053085 Bacteria 3115
652 Ga0495619_0081819 3300053085 Bacteria 2175
653 Ga0495619_0090977 3300053085 Bacteria 2066
654 Ga0501084_0004142 3300054114 Bacteria 11817
655 Ga0501084_0004916 3300054114 Bacteria 10921
656 Ga0590071_000249 3300059421 Bacteria 15561
657 Ga0590071_000772 3300059421 Bacteria 8967
658 Ga0590071_006188 3300059421 Unclassified 2854
659 Ga0590071_009311 3300059421 Bacteria 2305
660 Ga0590074_000326 3300059423 Bacteria 6606
661 Ga0590075_000576 3300059424 Bacteria 9946
662 Ga0590075_001822 3300059424 Bacteria 5199
663 Ga0590077_000087 3300059426 Bacteria 23513
664 Ga0590077_002482 3300059426 Unclassified 3934
665 Ga0501082_0001528 3300060353 Bacteria 20359
666 Ga0501082_0013241 3300060353 Bacteria 7093
667 Ga0501082_0040443 3300060353 Bacteria 4022
668 Ga0501082_0169842 3300060353 Unclassified 1896
669 Ga0530510_0001387 3300061734 Bacteria 16257
670 Ga0530510_0036178 3300061734 Bacteria 3558
671 Ga0268266_10189584
672 JGI24751J29686_10002791
673 JGI25406J46586_10000491
674 Ga0065712_10020821
675 Ga0065712_10026676
676 Ga0065712_10142213
677 Ga0065715_10094271
678 Ga0065715_10118756
679 Ga0065707_10001449
680 Ga0065707_10006518
681 Ga0065707_10009013
682 Ga0070676_10004192
683 Ga0070676_10021642
684 Ga0070676_10038590
685 Ga0070676_10038917
686 Ga0070683_100000702
687 Ga0070683_100119518
688 Ga0070683_100136965
689 Ga0070690_100131778
690 Ga0070670_100003306
691 Ga0070670_100014348
692 Ga0070670_100078964
693 Ga0070670_100098815
694 Ga0070670_100187951
695 Ga0070677_10005129
696 Ga0068869_100222030
697 Ga0070666_10004947
698 Ga0070666_10126739
699 Ga0070680_100041031
700 Ga0068868_100011616
701 Ga0068868_100095107
702 Ga0070660_100088263
703 Ga0070689_100069246
704 Ga0070689_100132421
705 Ga0070689_100199512
706 Ga0070691_10000473
707 Ga0070692_10094327
708 Ga0070668_100091583
709 Ga0070669_100060746
710 Ga0070669_100088294
711 Ga0070669_100168146
712 Ga0070675_100000202
713 Ga0070675_100038954
714 Ga0070675_100223235
715 Ga0070671_100061790
716 Ga0070671_100064146
717 Ga0070674_100024262
718 Ga0070674_100045893
719 Ga0070674_100133085
720 Ga0070674_100153363
721 Ga0070673_100000282
722 Ga0070673_100002528
723 Ga0070673_100071179
724 Ga0070688_100029128
725 Ga0070688_100115143
726 Ga0070659_100233553
727 Ga0070667_100013136
728 Ga0070667_100072801
729 Ga0070714_100020682
730 Ga0070714_100347481
731 Ga0070701_10014384
732 Ga0070705_100006359
733 Ga0070700_100006004
734 Ga0070700_100070143
735 Ga0070700_100079587
736 Ga0070700_100095906
737 Ga0070700_100125087
738 Ga0070694_100010880
739 Ga0070694_100079292
740 Ga0070708_100075792
741 Ga0070708_100275386
742 Ga0070678_100002631
743 Ga0070678_100028953
744 Ga0070662_100223431
745 Ga0070681_10019500
746 Ga0070681_10108226
747 Ga0068867_100009353
748 Ga0068867_100013323
749 Ga0068867_100025953
750 Ga0068867_100065776
751 Ga0070706_100000101
752 Ga0070706_100087293
753 Ga0070707_100014493
754 Ga0070707_100058637
755 Ga0070707_100079899
756 Ga0070707_100195747
757 Ga0070698_100029348
758 Ga0070698_100040293
759 Ga0070698_100054630
760 Ga0070698_100229468
761 Ga0070699_100003668
762 Ga0070699_100008689
763 Ga0070699_100030443
764 Ga0070699_100093431
765 Ga0070699_100172458
766 Ga0070679_100022602
767 Ga0070679_100174362
768 Ga0070684_100000068
769 Ga0070684_100009549
770 Ga0070697_100000189
771 Ga0070697_100038812
772 Ga0070697_100189167
773 Ga0070672_100029894
774 Ga0070695_100000785
775 Ga0070695_100014083
776 Ga0070696_100029118
777 Ga0070696_100058504
778 Ga0070696_100078877
779 Ga0070696_100125583
780 Ga0070693_100047782
781 Ga0070665_100006386
782 Ga0070665_100008967
783 Ga0070665_100010405
784 Ga0070665_100033210
785 Ga0070704_100001151
786 Ga0070704_100011495
787 Ga0070704_100055179
788 Ga0070704_100089098
789 Ga0070704_100103135
790 Ga0070704_100140567
791 Ga0070704_100146319
792 Ga0068855_100322533
793 Ga0070664_100008127
794 Ga0068857_100050996
795 Ga0068854_100050997
796 Ga0068854_100052821
797 Ga0070702_100001302
798 Ga0068859_100005666
799 Ga0068859_100024547
800 Ga0068859_100227254
801 Ga0068859_100266819
802 Ga0068859_100328683
803 Ga0068864_100006553
804 Ga0068866_10010359
805 Ga0068861_100003622
806 Ga0068863_100066986
807 Ga0068863_100140256
808 Ga0068863_100194278
809 Ga0068858_100005453
810 Ga0068858_100013146
811 Ga0068858_100034125
812 Ga0068858_100180904
813 Ga0068860_100061312
814 Ga0068860_100185959
815 Ga0068862_100016452
816 Ga0068862_100046267
817 Ga0068862_100234264
818 Ga0068862_100323912
819 Ga0081455_10013648
820 Ga0081455_10102180
821 Ga0081455_10116831
822 Ga0081538_10001528
823 Ga0081538_10058983
824 Ga0081539_10000093
825 Ga0075365_10007190
826 Ga0075364_10047399
827 Ga0075362_10000421
828 Ga0075367_10003356
829 Ga0075366_10013364
830 Ga0097621_100000477
831 Ga0097621_100002349
832 Ga0097621_100013417
833 Ga0097621_100022317
834 Ga0097621_100030260
835 Ga0097621_100040296
836 Ga0097621_100192429
837 Ga0075370_10006888
838 Ga0068871_100005279
839 Ga0068871_100012430
840 Ga0068871_100015114
841 Ga0068871_100032832
842 Ga0075428_100000080
843 Ga0075428_100032730
844 Ga0075428_100131866
845 Ga0075428_100414895
846 Ga0075430_100002473
847 Ga0075430_100078679
848 Ga0075431_100002515
849 Ga0075431_100011777
850 Ga0075431_100133808
851 Ga0075433_10007021
852 Ga0075433_10016600
853 Ga0075433_10129598
854 Ga0075434_100004294
855 Ga0075434_100005549
856 Ga0075434_100010893
857 Ga0075434_100035368
858 Ga0075434_100045559
859 Ga0075434_100059288
860 Ga0075434_100162802
861 Ga0075434_100302637
862 Ga0075429_100000156
863 Ga0075429_100001098
864 Ga0075429_100050306
865 Ga0075429_100093444
866 Ga0068865_100008148
867 Ga0068865_100039835
868 Ga0068865_100058204
869 Ga0068865_100089278
870 Ga0075436_100000295
871 Ga0075436_100007582
872 Ga0097620_100005666
873 Ga0097620_100024547
874 Ga0097620_100227264
875 Ga0097620_100266820
876 Ga0097620_100328726
877 Ga0075435_100000147
878 Ga0075435_100002656
879 Ga0075435_100030102
880 Ga0075435_100036648
881 Ga0075435_100037478
882 Ga0075435_100091312
883 Ga0075435_100149449
884 Ga0105240_10011792
885 Ga0105240_10034088
886 Ga0105240_10178022
887 Ga0105240_10180230
888 Ga0105240_10197850
889 Ga0111539_10000059
890 Ga0111539_10000181
891 Ga0111539_10000209
892 Ga0111539_10002429
893 Ga0111539_10009783
894 Ga0111539_10043681
895 Ga0111539_10047449
896 Ga0111539_10100907
897 Ga0111539_10115071
898 Ga0111539_10137313
899 Ga0111539_10145053
900 Ga0111539_10164168
901 Ga0105245_10005530
902 Ga0105245_10324095
903 Ga0105247_10019812
904 Ga0105247_10031210
905 Ga0105247_10040093
906 Ga0114129_10000077
907 Ga0114129_10001820
908 Ga0114129_10009067
909 Ga0114129_10034155
910 Ga0114129_10036366
911 Ga0114129_10043732
912 Ga0114129_10106350
913 Ga0114129_10108011
914 Ga0114129_10112109
915 Ga0105243_10016882
916 Ga0105243_10054372
917 Ga0105242_10003632
918 Ga0105242_10027319
919 Ga0105242_10097791
920 Ga0105248_10004014
921 Ga0105248_10014318
922 Ga0105248_10018395
923 Ga0105248_10023744
924 Ga0105248_10033764
925 Ga0105248_10043896
926 Ga0105248_10148605
927 Ga0105248_10317020
928 Ga0105237_10176890
929 Ga0105249_10153421
930 Ga0105249_10154010
931 Ga0105249_10232698
932 Ga0157370_10278479
933 Ga0157374_10128612
934 Ga0157374_10305188
935 Ga0157378_10000578
936 Ga0157378_10023338
937 Ga0163162_10056599
938 Ga0157372_10140203
939 Ga0157375_10002741
940 Ga0157375_10028668
941 Ga0157375_10132350
942 Ga0157375_10218723
943 Ga0163163_10010892
944 Ga0163163_10013097
945 Ga0163163_10023177
946 Ga0157380_10034162
947 Ga0157380_10051633
948 Ga0157380_10065967
949 Ga0157380_10114672
950 Ga0157379_10000584
951 Ga0157379_10017975
952 Ga0157379_10018346
953 Ga0157379_10021777
954 Ga0157379_10044495
955 Ga0157379_10171473
956 Ga0157376_10019378
957 Ga0157376_10034338
958 Ga0157376_10041762
959 Ga0157376_10124749
960 Ga0207682_10011954
961 Ga0207682_10015468
962 Ga0207680_10004015
963 Ga0207680_10019777
964 Ga0207680_10030934
965 Ga0207680_10041021
966 Ga0207699_10077698
967 Ga0207645_10041479
968 Ga0207684_10000584
969 Ga0207684_10000607
970 Ga0207684_10214483
971 Ga0207684_10325909
972 Ga0207707_10036870
973 Ga0207707_10039875
974 Ga0207707_10230432
975 Ga0207695_10136275
976 Ga0207695_10165469
977 Ga0207671_10111125
978 Ga0207660_10029026
979 Ga0207662_10009833
980 Ga0207662_10064804
981 Ga0207657_10114870
982 Ga0207649_10022407
983 Ga0207652_10038008
984 Ga0207652_10210762
985 Ga0207646_10024832
986 Ga0207646_10036794
987 Ga0207646_10036937
988 Ga0207681_10012038
989 Ga0207681_10019225
990 Ga0207681_10244036
991 Ga0207650_10008008
992 Ga0207650_10030010
993 Ga0207650_10180756
994 Ga0207650_10188207
995 Ga0207659_10000076
996 Ga0207659_10017562
997 Ga0207659_10096939
998 Ga0207687_10008541
999 Ga0207664_10177549
1000 Ga0207644_10022378
1001 Ga0207706_10066896
1002 Ga0207706_10084052
1003 Ga0207706_10099614
1004 Ga0207686_10017136
1005 Ga0207686_10020853
1006 Ga0207709_10048363
1007 Ga0207670_10131699
1008 Ga0207669_10015080
1009 Ga0207669_10046761
1010 Ga0207669_10062920
1011 Ga0207669_10093624
1012 Ga0207669_10221925
1013 Ga0207704_10010703
1014 Ga0207704_10062347
1015 Ga0207704_10132313
1016 Ga0207691_10000274
1017 Ga0207691_10022903
1018 Ga0207691_10095964
1019 Ga0207711_10016158
1020 Ga0207711_10030976
1021 Ga0207711_10033697
1022 Ga0207711_10042071
1023 Ga0207711_10073136
1024 Ga0207711_10091941
1025 Ga0207711_10114557
1026 Ga0207661_10002311
1027 Ga0207661_10031293
1028 Ga0207679_10002489
1029 Ga0207679_10193752
1030 Ga0207651_10000358
1031 Ga0207668_10051113
1032 Ga0207640_10026213
1033 Ga0207640_10040545
1034 Ga0207658_10053150
1035 Ga0207677_10029159
1036 Ga0207677_10038536
1037 Ga0207677_10098597
1038 Ga0207703_10021562
1039 Ga0207703_10024618
1040 Ga0207703_10136597
1041 Ga0207703_10225785
1042 Ga0207678_10030823
1043 Ga0207708_10067610
1044 Ga0207641_10001113
1045 Ga0207641_10099587
1046 Ga0207641_10188514
1047 Ga0207648_10015198
1048 Ga0207648_10017181
1049 Ga0207648_10024699
1050 Ga0207676_10090218
1051 Ga0207676_10139761
1052 Ga0207674_10102743
1053 Ga0207675_100009497
1054 Ga0207675_100015621
1055 Ga0207675_100030251
1056 Ga0207675_100044375
1057 Ga0207683_10000220
1058 Ga0207683_10078339
1059 Ga0207683_10135318
1060 Ga0207683_10198667
1061 Ga0209974_10014515
1062 Ga0207428_10000022
1063 Ga0207428_10000558
1064 Ga0207428_10010107
1065 Ga0207428_10044726
1066 Ga0207428_10113132
1067 Ga0207428_10130250
1068 Ga0207428_10215065
1069 Ga0268266_10003789
1070 Ga0268266_10013799
1071 Ga0268266_10059104
1072 Ga0268265_10005243
1073 Ga0268265_10015893
1074 Ga0268265_10048093
1075 Ga0268265_10084405
1076 Ga0268264_10150375
1077 Ga0268264_10183526
1078 Ga0268264_10222629
1079 Ga0307408_100014908
1080 Ga0307408_100017734
1081 Ga0307408_100028574
1082 Ga0307408_100048714
1083 Ga0307408_100174714
1084 Ga0316576_10001732
1085 Ga0316576_10012676
1086 Ga0316576_10079178
1087 Ga0316576_10097215
1088 Ga0316578_10039372
1089 Ga0316578_10045731
1090 Ga0307405_10106539
1091 Ga0307413_10011324
1092 Ga0307410_10015511
1093 Ga0307406_10006061
1094 Ga0307406_10060683
1095 Ga0307407_10083699
1096 Ga0307407_10164637
1097 Ga0307412_10056975
1098 Ga0307412_10080319
1099 Ga0307412_10257282
1100 Ga0307409_100001383
1101 Ga0307409_100015060
1102 Ga0307409_100043912
1103 Ga0307409_100099475
1104 Ga0307409_100146814
1105 Ga0307409_100169240
1106 Ga0307416_100019816
1107 Ga0307416_100042086
1108 Ga0307416_100051044
1109 Ga0307416_100128625
1110 Ga0307416_100164779
1111 Ga0307416_100225817
1112 Ga0307416_100248288
1113 Ga0307414_10003946
1114 Ga0307414_10294894
1115 Ga0307411_10013487
1116 Ga0307411_10022704
1117 Ga0307411_10040453
1118 Ga0307415_100033261
1119 Ga0307415_100036207
1120 Ga0307415_100059500
1121 Ga0307415_100070606
1122 Ga0307415_100152678
1123 Ga0307415_100155516
1124 Ga0316585_10003409
1125 Ga0373930_0005539
1126 Ga0373948_0001144
1127 Ga0373959_0003577
1128 Ga0373938_0009930
1129 Ga0373929_0001662
1130 Ga0373949_0003851
1131 Ga0373951_0001709
1132 Ga0373952_0005960
1133 Ga0373960_0001784
1134 Ga0373960_0019621
1135 Ga0373943_0014143
1136 Ga0373943_0093508
1137 Ga0373955_0062485
1138 Ga0373942_0002156
1139 Ga0373961_0001299
1140 Ga0373962_0021759
1141 Ga0316574_0005798
1142 Ga0373931_0003301
1143 Ga0373935_0001390
1144 Ga0373927_0195421
1145 Ga0373947_0019793
1146 Ga0373947_0030984
1147 Ga0373947_0061983
1148 Ga0373937_0113098
1149 Ga0373937_0130401
1150 Ga0373937_0192147
1151 Ga0373937_0324798
1152 Ga0316584_0062827
1153 Ga0316584_0147689
1154 Ga0395901_0138426
1155 Ga0400489_79885
1156 Ga0439450_011231
1157 Ga0450894_001322
1158 Ga0450896_003414
1159 Ga0439446_0005503
1160 Ga0451577_0009300
1161 Ga0453683_0101290
1162 Ga0466963_0043121
1163 Ga0453684_0189375
1164 Ga0451576_0085794
1165 Ga0451576_0295006
1166 Ga0466967_0120944
1167 Ga0466967_0149774
1168 Ga0495592_0047193
1169 Ga0495603_0077086
1170 Ga0495603_0159939
1171 Ga0495629_0138722
1172 Ga0495653_0282290
1173 Ga0495580_0004341
1174 Ga0495580_0085690
1175 Ga0495580_0168405
1176 Ga0495582_0142071
1177 Ga0495664_0046084
1178 Ga0495664_0059719
1179 Ga0495608_0011561
1180 Ga0495628_0172061
1181 Ga0495652_0118392
1182 Ga0495586_0128782
1183 Ga0495645_0007653
1184 Ga0495645_0076832
1185 Ga0495647_0023242
1186 Ga0495647_0042692
1187 Ga0495658_0022670
1188 Ga0495658_0085015
1189 Ga0495658_0104655
1190 Ga0495669_0000990
1191 Ga0495613_0004695
1192 Ga0495613_0148506
1193 Ga0495604_0017283
1194 Ga0495674_0029729
1195 Ga0495674_0172636
1196 Ga0495684_0000228
1197 Ga0496100_0026293
1198 Ga0496101_0000348
1199 Ga0496101_0064748
1200 Ga0496102_0297390
1201 Ga0496104_0005196
1202 Ga0496104_0069587
1203 Ga0496104_0084489
1204 Ga0496104_0109714
1205 Ga0496104_0217815
1206 Ga0496106_0097866
1207 Ga0496106_0265093
1208 Ga0496107_0139087
1209 Ga0496108_0021614
1210 Ga0496108_0148650
1211 Ga0496108_0284399
1212 Ga0496109_0001290
1213 Ga0496110_0008036
1214 Ga0496110_0159285
1215 Ga0496110_0277894
1216 Ga0496112_0027070
1217 Ga0496112_0091338
1218 Ga0496114_0002236
1219 Ga0496114_0002337
1220 Ga0496114_0109399
1221 Ga0496114_0211738
1222 Ga0496115_0012077
1223 Ga0501031_0040726
1224 Ga0501036_0030546
1225 Ga0501036_0156172
1226 Ga0501036_0279895
1227 Ga0501037_0119167
1228 Ga0501040_0004841
1229 Ga0501040_0201607
1230 Ga0501041_0002942
1231 Ga0501047_0072784
1232 Ga0501048_0013517
1233 Ga0501048_0042667
1234 Ga0501071_0006201
1235 Ga0501071_0016739
1236 Ga0501071_0019329
1237 Ga0501071_0022296
1238 Ga0501072_0010004
1239 Ga0501072_0017543
1240 Ga0501072_0030128
1241 Ga0501072_0048095
1242 Ga0501074_0087231
1243 Ga0501074_0111236
1244 Ga0501075_0079644
1245 Ga0501075_0105271
1246 Ga0501076_0026029
1247 Ga0501076_0164356
1248 Ga0501076_0171279
1249 Ga0501217_028030
1250 Ga0501079_0007892
1251 Ga0501079_0029175
1252 Ga0501080_0055210
1253 Ga0501081_0000406
1254 Ga0501081_0136202
1255 Ga0501081_0160036
1256 Ga0501081_0177963
1257 Ga0501083_0149519
1258 Ga0501035_0076370
1259 Ga0501045_0002648
1260 Ga0501045_0007195
1261 Ga0501045_0011015
1262 Ga0501045_0193451
1263 nmdc:mga03683_600_c2
1264 nmdc:mga00v17_23721_c1
1265 nmdc:mga00v17_4143_c1
1266 nmdc:mga0yw44_4147_c1
1267 nmdc:mga0yw44_61194_c1
1268 nmdc:mga0k408_4679_c1
1269 nmdc:mga05p37_121506_c1
1270 nmdc:mga05p37_1796_c1
1271 nmdc:mga05p37_200269_c1
1272 nmdc:mga05p37_2105_c1
1273 nmdc:mga05p37_216566_c1
1274 nmdc:mga05p37_235500_c1
1275 nmdc:mga05p37_2819_c1
1276 nmdc:mga05p37_34458_c1
1277 nmdc:mga05p37_4142_c1
1278 nmdc:mga05p37_48480_c1
1279 nmdc:mga05p37_580882_c1
1280 nmdc:mga09592_3401_c1
1281 nmdc:mga09592_4431_c1
1282 nmdc:mga0qj67_4824_c1
1283 nmdc:mga0qj67_62847_c1
1284 nmdc:mga06r32_134482_c1
1285 nmdc:mga06r32_23254_c1
1286 nmdc:mga06r32_6534_c1
1287 nmdc:mga06r32_77179_c1
1288 nmdc:mga06r32_90676_c1
1289 nmdc:mga08y16_10497_c1
1290 nmdc:mga08y16_1066_c1
1291 nmdc:mga08y16_108938_c1
1292 nmdc:mga08y16_125304_c1
1293 nmdc:mga08y16_1923_c1
1294 nmdc:mga08y16_21_c1
1295 nmdc:mga08y16_282095_c1
1296 nmdc:mga08y16_35300_c1
1297 nmdc:mga0n895_153202_c1
1298 nmdc:mga0n895_2150_c1
1299 nmdc:mga0n895_31871_c1
1300 nmdc:mga0n895_3356_c1
1301 nmdc:mga0n895_400504_c1
1302 nmdc:mga0n895_59365_c1
1303 nmdc:mga0n895_74231_c1
1304 nmdc:mga0n895_97_c2
1305 nmdc:mga0rr50_20_c1
1306 nmdc:mga0rr50_214006_c1
1307 nmdc:mga0rr50_223155_c1
1308 nmdc:mga0rr50_31819_c1
1309 nmdc:mga0rr50_41109_c1
1310 nmdc:mga0rr50_42681_c1
1311 nmdc:mga0rr50_43911_c1
1312 nmdc:mga0rr50_62346_c1
1313 nmdc:mga08x19_178_c1
1314 nmdc:mga08x19_41524_c1
1315 nmdc:mga0a205_138041_c1
1316 nmdc:mga0a205_249232_c1
1317 nmdc:mga0a205_3446_c1
1318 nmdc:mga0a205_41616_c1
1319 Ga0495601_0086087
1320 Ga0495619_0000422
1321 Ga0495619_0038606
1322 Ga0495619_0081819
1323 Ga0495619_0090977
1324 Ga0501084_0004142
1325 Ga0501084_0004916
1326 Ga0590071_000249
1327 Ga0590071_000772
1328 Ga0590071_006188
1329 Ga0590071_009311
1330 Ga0590074_000326
1331 Ga0590075_000576
1332 Ga0590075_001822
1333 Ga0590077_000087
1334 Ga0590077_002482
1335 Ga0501082_0001528
1336 Ga0501082_0013241
1337 Ga0501082_0040443
1338 Ga0501082_0169842
1339 Ga0530510_0001387
1340 Ga0530510_0036178

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02568

ThiI

Thiamine biosynthesis protein (ThiI)

213

409

0.98

PF22025

ThiI_fer

ThiI ferredoxin-like domain

3

63

0.92

PF02926

THUMP

THUMP domain

122

201

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4kr7-assembly1.cif.gz_A crystal structure of a 4-thiouridine synthetase - rna complex with bound atp 0.9154 1 384
2c5s-assembly1.cif.gz_A-2 crystal structure of bacillus anthracis thii, a trna-modifying enzyme containing the predicted rna-binding thump domain 0.9103 1 385
4kr7-assembly1.cif.gz_A crystal structure of a 4-thiouridine synthetase - rna complex with bound atp 0.9086 1 384
2c5s-assembly1.cif.gz_A-2 crystal structure of bacillus anthracis thii, a trna-modifying enzyme containing the predicted rna-binding thump domain 0.9033 1 385
1vbk-assembly1.cif.gz_B crystal structure of ph1313 from pyrococcus horikoshii ot3 0.8362 1 328
ID Description Score Start End Superfamily
af_Q2FXL1_175_403_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9641 171 390 3.40.50.620
4kr9B02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9626 171 384 3.40.50.620
af_Q58341_186_381_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9508 171 364 3.40.50.620
2c5sA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9475 171 385 3.40.50.620
af_P77718_175_396_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9458 171 382 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A382X7T7-F1-model_v4 Thil AANH domain-containing protein 0.9942 192 387 GO:0002937
GO:0004810
GO:0005524
GO:0005829
GO:0052837
AF-A0A2V6WSR5-F1-model_v4 tRNA 4-thiouridine(8) synthase ThiI 0.9939 162 277 GO:0002937
GO:0004810
GO:0005524
GO:0005829
GO:0052837
AF-A0A1J1EQ10-F1-model_v4 deleted 0.9908 189 387
AF-A0A662PQ11-F1-model_v4 Probable tRNA sulfurtransferase (EC 2.8.1.4) (Sulfur carrier protein ThiS sulfurtransferase) (Thiamine biosynthesis protein ThiI) (tRNA 4-thiouridine synthase) 0.99 175 384 GO:0002937
GO:0004810
GO:0005524
GO:0005829
GO:0009228
GO:0009229
GO:0052837
GO:0140741
AF-A0A6B3H0H0-F1-model_v4 tRNA 4-thiouridine(8) synthase ThiI 0.9877 174 382 GO:0002937
GO:0004810
GO:0005524
GO:0005829
GO:0052837

Map