F473993

General Info

Members Datasets Scaffolds Average Seq Length
669 260 1338 279

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10093462|Ga0114129_100934623
Length 297
Sequence MKEAEMTEPRATGGTAGGVDAETLTPKYDRLVALLREMGSVVVAFSGGVDSTFLARAAKDALGERALLVTADSETYPVAELEETRRLAGLLAMRHEVIRTRELDRPEYARNGPDRCFHCKEELFSRLEPIAGRAGTARMVYGANMDDLGDHRPGMKAAEAHGVRAPLIEAELWKSEIRALSRALGLPTWDKPSFACLSSRFQYGDAITGEKLRQIDAAEAFVRSLGFRQFRVRHHDRLARIELPPEEMPRLWAEGRHDAIVRRFRELGYLYVTLDLQGFRSGSANEALRTLRWTGKK

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
63 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
66 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
137 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
141 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
142 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
143 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
144 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
145 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
146 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
147 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
148 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
149 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
150 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
151 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
152 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
153 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
154 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
155 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
156 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
157 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
158 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
159 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
160 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
161 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
162 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
163 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
164 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
165 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
166 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
167 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
168 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
169 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
170 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
171 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
172 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
173 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
174 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
175 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
176 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
177 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
178 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
179 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
180 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
181 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
182 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
183 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
184 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
185 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
186 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
187 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
188 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
189 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
190 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
191 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
192 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
193 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
194 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
195 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
196 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
197 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
198 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
199 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
200 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
201 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
202 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
203 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
204 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
205 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
206 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
207 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
208 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
209 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
210 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
211 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
212 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
213 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
214 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
215 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
216 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
217 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
218 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
233 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
234 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
235 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
236 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
237 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
238 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
239 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
240 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
241 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
242 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
243 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
244 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
245 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
246 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
247 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
249 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
250 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
251 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
252 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
253 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
254 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
255 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
256 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
257 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
258 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
259 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
260 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.09
Rhizosphere 97.61
Stem 0
Stem Tuber 0
Unclassified 3.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10093462 3300009147 Bacteria 4166
2 JGI25406J46586_10013381 3300003203 Bacteria 3526
3 rootH1_10017798 3300003323 Bacteria 8997
4 Ga0065707_10240704 3300005295 Bacteria 1156
5 Ga0070676_10019692 3300005328 Bacteria 3759
6 Ga0070676_10040429 3300005328 Bacteria 2700
7 Ga0070683_100007795 3300005329 Bacteria 9067
8 Ga0070683_100050557 3300005329 Bacteria 3848
9 Ga0070690_100040042 3300005330 Bacteria 2962
10 Ga0070670_100010134 3300005331 Bacteria 8039
11 Ga0068869_100015201 3300005334 Bacteria 5157
12 Ga0068869_100018803 3300005334 Bacteria 4710
13 Ga0070680_100001301 3300005336 Bacteria 18070
14 Ga0070680_100025171 3300005336 Bacteria 4755
15 Ga0070680_100025490 3300005336 Bacteria 4727
16 Ga0070682_100000495 3300005337 Bacteria 24734
17 Ga0068868_100113034 3300005338 Bacteria 2208
18 Ga0070660_100000124 3300005339 Bacteria 48699
19 Ga0070660_100181551 3300005339 Bacteria 1703
20 Ga0070687_100007678 3300005343 Bacteria 4516
21 Ga0070687_100022100 3300005343 Bacteria 3002
22 Ga0070687_100077212 3300005343 Bacteria 1806
23 Ga0070661_100001023 3300005344 Bacteria 19826
24 Ga0070692_10000618 3300005345 Bacteria 11209
25 Ga0070669_100015111 3300005353 Bacteria 5499
26 Ga0070669_100375102 3300005353 Bacteria 1159
27 Ga0070671_100135620 3300005355 Bacteria 2075
28 Ga0070673_100202684 3300005364 Bacteria 1709
29 Ga0070688_100029610 3300005365 Bacteria 3280
30 Ga0070659_100000618 3300005366 Bacteria 26085
31 Ga0070703_10047798 3300005406 Bacteria 1357
32 Ga0070703_10073826 3300005406 Bacteria 1145
33 Ga0070714_100335897 3300005435 Unclassified 1416
34 Ga0070711_100085111 3300005439 Bacteria 2264
35 Ga0070711_100117982 3300005439 Bacteria 1958
36 Ga0070705_100002091 3300005440 Bacteria 10176
37 Ga0070705_100007031 3300005440 Bacteria 5531
38 Ga0070705_100165044 3300005440 Bacteria 1485
39 Ga0070700_100027450 3300005441 Bacteria 3375
40 Ga0070694_100000602 3300005444 Bacteria 19806
41 Ga0070694_100009007 3300005444 Bacteria 6115
42 Ga0070694_100050723 3300005444 Bacteria 2798
43 Ga0070694_100216739 3300005444 Bacteria 1434
44 Ga0070694_100345136 3300005444 Bacteria 1152
45 Ga0070708_100011468 3300005445 Bacteria 7213
46 Ga0070708_100018666 3300005445 Bacteria 5806
47 Ga0070708_100046653 3300005445 Bacteria 3823
48 Ga0070708_100077613 3300005445 Bacteria 3001
49 Ga0070708_100115502 3300005445 Bacteria 2470
50 Ga0070708_100174712 3300005445 Bacteria 2007
51 Ga0070708_100248134 3300005445 Bacteria 1672
52 Ga0070663_100001130 3300005455 Bacteria 14695
53 Ga0070662_100034468 3300005457 Bacteria 3570
54 Ga0070662_100061978 3300005457 Bacteria 2731
55 Ga0070681_10124185 3300005458 Bacteria 2514
56 Ga0070681_10165945 3300005458 Bacteria 2131
57 Ga0070681_10551979 3300005458 Bacteria 1066
58 Ga0068867_100001188 3300005459 Bacteria 17857
59 Ga0068867_100057683 3300005459 Bacteria 2876
60 Ga0068867_100154904 3300005459 Bacteria 1803
61 Ga0068867_100265875 3300005459 Bacteria 1400
62 Ga0070685_10056573 3300005466 Bacteria 2280
63 Ga0070685_10288254 3300005466 Bacteria 1102
64 Ga0070706_100005315 3300005467 Bacteria 12273
65 Ga0070706_100015987 3300005467 Bacteria 6930
66 Ga0070706_100100494 3300005467 Bacteria 2688
67 Ga0070706_100158756 3300005467 Bacteria 2111
68 Ga0070706_100185916 3300005467 Bacteria 1941
69 Ga0070706_100235173 3300005467 Bacteria 1711
70 Ga0070707_100004506 3300005468 Bacteria 13045
71 Ga0070707_100014301 3300005468 Bacteria 7441
72 Ga0070707_100041133 3300005468 Bacteria 4423
73 Ga0070707_100050599 3300005468 Bacteria 3983
74 Ga0070707_100068007 3300005468 Bacteria 3427
75 Ga0070707_100137985 3300005468 Bacteria 2372
76 Ga0070707_100216398 3300005468 Bacteria 1867
77 Ga0070707_100244196 3300005468 Bacteria 1747
78 Ga0070707_100335906 3300005468 Bacteria 1468
79 Ga0070698_100004253 3300005471 Bacteria 15741
80 Ga0070698_100010504 3300005471 Bacteria 9871
81 Ga0070698_100109192 3300005471 Bacteria 2733
82 Ga0070698_100120390 3300005471 Bacteria 2585
83 Ga0070699_100016065 3300005518 Bacteria 6426
84 Ga0070699_100016802 3300005518 Bacteria 6282
85 Ga0070699_100047672 3300005518 Bacteria 3707
86 Ga0070699_100066616 3300005518 Bacteria 3126
87 Ga0070699_100097556 3300005518 Bacteria 2575
88 Ga0070699_100116619 3300005518 Bacteria 2347
89 Ga0070699_100135370 3300005518 Bacteria 2174
90 Ga0070699_100166037 3300005518 Bacteria 1955
91 Ga0070699_100291162 3300005518 Bacteria 1464
92 Ga0070679_100002293 3300005530 Bacteria 17300
93 Ga0070679_100240099 3300005530 Bacteria 1769
94 Ga0070679_100422127 3300005530 Unclassified 1279
95 Ga0070684_100017601 3300005535 Bacteria 5871
96 Ga0070697_100003019 3300005536 Bacteria 12921
97 Ga0070697_100006703 3300005536 Bacteria 8935
98 Ga0070697_100027295 3300005536 Bacteria 4567
99 Ga0070697_100031842 3300005536 Bacteria 4243
100 Ga0070697_100040146 3300005536 Bacteria 3785
101 Ga0070697_100042539 3300005536 Bacteria 3677
102 Ga0070697_100127089 3300005536 Bacteria 2136
103 Ga0070697_100169620 3300005536 Bacteria 1846
104 Ga0070697_100332017 3300005536 Bacteria 1311
105 Ga0068853_100002543 3300005539 Bacteria 13697
106 Ga0070686_100007224 3300005544 Bacteria 6187
107 Ga0070695_100001813 3300005545 Bacteria 12064
108 Ga0070695_100003165 3300005545 Bacteria 9608
109 Ga0070695_100011343 3300005545 Bacteria 5332
110 Ga0070695_100013100 3300005545 Bacteria 4982
111 Ga0070695_100022601 3300005545 Bacteria 3858
112 Ga0070696_100017867 3300005546 Bacteria 4788
113 Ga0070696_100065161 3300005546 Bacteria 2554
114 Ga0070693_100005884 3300005547 Bacteria 5927
115 Ga0070693_100027473 3300005547 Bacteria 3085
116 Ga0070704_100004784 3300005549 Bacteria 7839
117 Ga0070704_100011235 3300005549 Bacteria 5480
118 Ga0070704_100201680 3300005549 Unclassified 1606
119 Ga0070704_100625445 3300005549 Bacteria 948
120 Ga0068855_100001575 3300005563 Bacteria 28647
121 Ga0068855_100413864 3300005563 Bacteria 1476
122 Ga0068855_100559261 3300005563 Bacteria 1237
123 Ga0070664_100004693 3300005564 Bacteria 10959
124 Ga0068857_100025153 3300005577 Bacteria 5242
125 Ga0068857_100038352 3300005577 Bacteria 4244
126 Ga0068854_100518780 3300005578 Bacteria 1006
127 Ga0068856_100001635 3300005614 Bacteria 23471
128 Ga0070702_100021333 3300005615 Bacteria 3407
129 Ga0070702_100026105 3300005615 Bacteria 3136
130 Ga0068859_100002312 3300005617 Bacteria 19368
131 Ga0068859_100039939 3300005617 Bacteria 4710
132 Ga0068859_100346234 3300005617 Bacteria 1581
133 Ga0068859_100426882 3300005617 Bacteria 1422
134 Ga0068866_10274960 3300005718 Bacteria 1041
135 Ga0068861_100007920 3300005719 Bacteria 7310
136 Ga0068861_100409459 3300005719 Bacteria 1205
137 Ga0068870_10000321 3300005840 Bacteria 17794
138 Ga0068863_100030156 3300005841 Bacteria 5181
139 Ga0068858_100067051 3300005842 Bacteria 3324
140 Ga0068860_100009220 3300005843 Bacteria 9809
141 Ga0068860_100040767 3300005843 Bacteria 4436
142 Ga0068860_100060692 3300005843 Bacteria 3593
143 Ga0068860_100144743 3300005843 Bacteria 2286
144 Ga0068860_100464627 3300005843 Bacteria 1259
145 Ga0068862_100001081 3300005844 Bacteria 26024
146 Ga0068862_100033702 3300005844 Bacteria 4331
147 Ga0068862_100314573 3300005844 Bacteria 1444
148 Ga0081455_10000250 3300005937 Bacteria 70308
149 Ga0081538_10005196 3300005981 Bacteria 11776
150 Ga0081540_1007094 3300005983 Bacteria 8049
151 Ga0081539_10000050 3300005985 Bacteria 269342
152 Ga0075432_10022384 3300006058 Bacteria 2161
153 Ga0070715_10030865 3300006163 Bacteria 2171
154 Ga0075428_100000028 3300006844 Bacteria 119875
155 Ga0075428_100001102 3300006844 Bacteria 28759
156 Ga0075428_100045334 3300006844 Bacteria 4831
157 Ga0075428_100071293 3300006844 Bacteria 3798
158 Ga0075428_100073039 3300006844 Bacteria 3746
159 Ga0075428_100180772 3300006844 Bacteria 2283
160 Ga0075428_100303611 3300006844 Bacteria 1716
161 Ga0075430_100000017 3300006846 Bacteria 88487
162 Ga0075430_100000699 3300006846 Bacteria 25570
163 Ga0075430_100001447 3300006846 Bacteria 19282
164 Ga0075430_100078114 3300006846 Bacteria 2775
165 Ga0075431_100000550 3300006847 Bacteria 31550
166 Ga0075431_100001250 3300006847 Bacteria 23097
167 Ga0075431_100001338 3300006847 Bacteria 22530
168 Ga0075431_100001417 3300006847 Bacteria 22023
169 Ga0075431_100020101 3300006847 Bacteria 6820
170 Ga0075431_100114301 3300006847 Bacteria 2786
171 Ga0075431_100163911 3300006847 Bacteria 2285
172 Ga0075431_100246764 3300006847 Bacteria 1815
173 Ga0075431_100452154 3300006847 Bacteria 1280
174 Ga0075433_10005556 3300006852 Bacteria 9902
175 Ga0075433_10032826 3300006852 Bacteria 4448
176 Ga0075433_10033029 3300006852 Bacteria 4435
177 Ga0075433_10036029 3300006852 Bacteria 4259
178 Ga0075433_10044305 3300006852 Bacteria 3865
179 Ga0075433_10064130 3300006852 Bacteria 3220
180 Ga0075433_10097058 3300006852 Bacteria 2608
181 Ga0075433_10100972 3300006852 Bacteria 2554
182 Ga0075433_10125787 3300006852 Bacteria 2276
183 Ga0075433_10222081 3300006852 Bacteria 1678
184 Ga0075433_10235480 3300006852 Bacteria 1625
185 Ga0075433_10336964 3300006852 Bacteria 1333
186 Ga0075434_100005577 3300006871 Bacteria 11467
187 Ga0075434_100038616 3300006871 Bacteria 4729
188 Ga0075434_100045492 3300006871 Bacteria 4354
189 Ga0075434_100058410 3300006871 Bacteria 3834
190 Ga0075434_100070139 3300006871 Bacteria 3495
191 Ga0075434_100142521 3300006871 Bacteria 2417
192 Ga0075434_100268184 3300006871 Bacteria 1726
193 Ga0075434_100282558 3300006871 Bacteria 1679
194 Ga0075434_100605174 3300006871 Bacteria 1115
195 Ga0075429_100000040 3300006880 Bacteria 59305
196 Ga0075429_100000964 3300006880 Bacteria 22844
197 Ga0075429_100013907 3300006880 Bacteria 6979
198 Ga0075429_100047256 3300006880 Bacteria 3744
199 Ga0068865_100095505 3300006881 Bacteria 2166
200 Ga0097620_100002312 3300006931 Bacteria 19368
201 Ga0097620_100039939 3300006931 Bacteria 4710
202 Ga0097620_100346201 3300006931 Bacteria 1581
203 Ga0097620_100391605 3300006931 Bacteria 1485
204 Ga0097620_100426912 3300006931 Bacteria 1422
205 Ga0075435_100010250 3300007076 Bacteria 6847
206 Ga0075435_100018730 3300007076 Bacteria 5273
207 Ga0075435_100030640 3300007076 Bacteria 4232
208 Ga0075435_100041599 3300007076 Bacteria 3674
209 Ga0075435_100070880 3300007076 Bacteria 2845
210 Ga0075435_100121904 3300007076 Bacteria 2176
211 Ga0075435_100196021 3300007076 Bacteria 1710
212 Ga0099794_10018965 3300007265 Bacteria 3092
213 Ga0111539_10002900 3300009094 Bacteria 22767
214 Ga0111539_10004264 3300009094 Bacteria 18725
215 Ga0111539_10008891 3300009094 Bacteria 12716
216 Ga0111539_10015843 3300009094 Bacteria 9365
217 Ga0111539_10041379 3300009094 Bacteria 5540
218 Ga0111539_10116983 3300009094 Bacteria 3125
219 Ga0111539_10559075 3300009094 Unclassified 1332
220 Ga0114129_10000319 3300009147 Bacteria 56353
221 Ga0114129_10003397 3300009147 Bacteria 22363
222 Ga0114129_10003824 3300009147 Bacteria 21222
223 Ga0114129_10007004 3300009147 Bacteria 16050
224 Ga0114129_10010804 3300009147 Bacteria 13005
225 Ga0114129_10080401 3300009147 Bacteria 4530
226 Ga0114129_10104820 3300009147 Bacteria 3908
227 Ga0114129_10191068 3300009147 Bacteria 2780
228 Ga0114129_10233239 3300009147 Bacteria 2478
229 Ga0114129_10252908 3300009147 Bacteria 2364
230 Ga0114129_10447137 3300009147 Bacteria 1695
231 Ga0114129_10851021 3300009147 Bacteria 1159
232 Ga0105243_10002367 3300009148 Bacteria 15776
233 Ga0105243_10323908 3300009148 Bacteria 1405
234 Ga0105241_10001443 3300009174 Bacteria 18219
235 Ga0105241_10065879 3300009174 Bacteria 2800
236 Ga0105242_10251998 3300009176 Bacteria 1591
237 Ga0105248_10134231 3300009177 Bacteria 2792
238 Ga0105249_10090267 3300009553 Bacteria 2864
239 Ga0105249_10408810 3300009553 Unclassified 1389
240 Ga0105249_10764166 3300009553 Unclassified 1029
241 Ga0105246_10047535 3300011119 Bacteria 2931
242 Ga0157369_10005427 3300013105 Bacteria 14824
243 Ga0157378_10901843 3300013297 Unclassified 915
244 Ga0163162_10045522 3300013306 Bacteria 4396
245 Ga0157372_10007418 3300013307 Bacteria 11662
246 Ga0157372_10144817 3300013307 Bacteria 2740
247 Ga0207653_10011511 3300025885 Bacteria 2759
248 Ga0207688_10055052 3300025901 Bacteria 2232
249 Ga0207645_10004413 3300025907 Bacteria 10414
250 Ga0207645_10045678 3300025907 Bacteria 2799
251 Ga0207643_10000461 3300025908 Bacteria 26348
252 Ga0207643_10035799 3300025908 Bacteria 2784
253 Ga0207684_10004170 3300025910 Bacteria 13734
254 Ga0207684_10005941 3300025910 Bacteria 11174
255 Ga0207684_10011177 3300025910 Bacteria 7861
256 Ga0207684_10012541 3300025910 Bacteria 7365
257 Ga0207684_10057686 3300025910 Bacteria 3294
258 Ga0207684_10078923 3300025910 Bacteria 2800
259 Ga0207684_10127354 3300025910 Bacteria 2185
260 Ga0207684_10214520 3300025910 Bacteria 1660
261 Ga0207684_10279460 3300025910 Bacteria 1440
262 Ga0207654_10016845 3300025911 Bacteria 3812
263 Ga0207654_10123695 3300025911 Bacteria 1628
264 Ga0207707_10001118 3300025912 Bacteria 25493
265 Ga0207707_10066719 3300025912 Bacteria 3134
266 Ga0207707_10112072 3300025912 Bacteria 2385
267 Ga0207663_10037213 3300025916 Bacteria 2933
268 Ga0207660_10001709 3300025917 Bacteria 14714
269 Ga0207660_10009892 3300025917 Bacteria 6178
270 Ga0207660_10079768 3300025917 Bacteria 2402
271 Ga0207662_10010651 3300025918 Bacteria 5084
272 Ga0207657_10001077 3300025919 Bacteria 28924
273 Ga0207649_10004293 3300025920 Bacteria 7754
274 Ga0207652_10005519 3300025921 Bacteria 10252
275 Ga0207646_10002644 3300025922 Bacteria 21042
276 Ga0207646_10006493 3300025922 Bacteria 12072
277 Ga0207646_10012456 3300025922 Bacteria 8176
278 Ga0207646_10016459 3300025922 Bacteria 6936
279 Ga0207646_10020517 3300025922 Bacteria 6121
280 Ga0207646_10041935 3300025922 Bacteria 4112
281 Ga0207646_10056778 3300025922 Bacteria 3499
282 Ga0207646_10088806 3300025922 Bacteria 2766
283 Ga0207646_10274675 3300025922 Bacteria 1523
284 Ga0207646_10303282 3300025922 Bacteria 1443
285 Ga0207646_10320559 3300025922 Bacteria 1400
286 Ga0207681_10056128 3300025923 Bacteria 2685
287 Ga0207650_10026464 3300025925 Bacteria 4138
288 Ga0207650_10290335 3300025925 Bacteria 1333
289 Ga0207659_10379137 3300025926 Bacteria 1179
290 Ga0207690_10001644 3300025932 Bacteria 13815
291 Ga0207706_10003042 3300025933 Bacteria 16168
292 Ga0207706_10055688 3300025933 Bacteria 3487
293 Ga0207709_10079551 3300025935 Bacteria 2108
294 Ga0207709_10271610 3300025935 Bacteria 1248
295 Ga0207704_10312936 3300025938 Bacteria 1208
296 Ga0207665_10058031 3300025939 Bacteria 2616
297 Ga0207689_10000056 3300025942 Bacteria 86419
298 Ga0207689_10002038 3300025942 Bacteria 19075
299 Ga0207661_10031764 3300025944 Bacteria 4083
300 Ga0207661_10147643 3300025944 Bacteria 2030
301 Ga0207679_10019624 3300025945 Bacteria 4545
302 Ga0207667_10030328 3300025949 Bacteria 5852
303 Ga0207667_10251324 3300025949 Bacteria 1808
304 Ga0207667_10310132 3300025949 Bacteria 1612
305 Ga0207651_10475533 3300025960 Bacteria 1076
306 Ga0207712_10095924 3300025961 Bacteria 2194
307 Ga0207712_10101406 3300025961 Bacteria 2141
308 Ga0207640_10022086 3300025981 Bacteria 3803
309 Ga0207677_10077905 3300026023 Bacteria 2365
310 Ga0207703_10045350 3300026035 Bacteria 3536
311 Ga0207639_10000271 3300026041 Bacteria 37090
312 Ga0207678_10001361 3300026067 Bacteria 22534
313 Ga0207708_10101641 3300026075 Bacteria 2225
314 Ga0207702_10018831 3300026078 Bacteria 5710
315 Ga0207641_10119436 3300026088 Bacteria 2350
316 Ga0207641_10143674 3300026088 Bacteria 2156
317 Ga0207648_10001741 3300026089 Bacteria 23830
318 Ga0207648_10057618 3300026089 Bacteria 3389
319 Ga0207676_10022017 3300026095 Bacteria 4683
320 Ga0207674_10000173 3300026116 Bacteria 78321
321 Ga0207674_10047913 3300026116 Bacteria 4378
322 Ga0207675_100010989 3300026118 Bacteria 8482
323 Ga0209981_1003595 3300027378 Bacteria 2013
324 Ga0209968_1005732 3300027526 Bacteria 1866
325 Ga0209970_1000574 3300027614 Bacteria 6385
326 Ga0209588_1038257 3300027671 Bacteria 1545
327 Ga0209588_1051701 3300027671 Bacteria 1329
328 Ga0209971_1000199 3300027682 Bacteria 17944
329 Ga0209966_1000475 3300027695 Bacteria 10912
330 Ga0209998_10003490 3300027717 Bacteria 3433
331 Ga0209974_10013380 3300027876 Bacteria 2733
332 Ga0207428_10000132 3300027907 Bacteria 101581
333 Ga0207428_10000882 3300027907 Bacteria 33668
334 Ga0207428_10011733 3300027907 Bacteria 7728
335 Ga0207428_10045386 3300027907 Bacteria 3540
336 Ga0207428_10191071 3300027907 Unclassified 1543
337 Ga0268266_10082566 3300028379 Bacteria 2804
338 Ga0268265_10003526 3300028380 Bacteria 11190
339 Ga0268265_10015083 3300028380 Bacteria 5279
340 Ga0268265_10017079 3300028380 Bacteria 5000
341 Ga0268265_10176177 3300028380 Bacteria 1833
342 Ga0268264_10095522 3300028381 Bacteria 2572
343 Ga0268264_10111423 3300028381 Bacteria 2397
344 Ga0268264_10529565 3300028381 Bacteria 1153
345 Ga0265337_1006585 3300028556 Bacteria 4456
346 Ga0265326_10011753 3300028558 Bacteria 2578
347 Ga0265326_10035002 3300028558 Bacteria 1428
348 Ga0265323_10002103 3300028653 Bacteria 9293
349 Ga0265323_10005585 3300028653 Bacteria 5337
350 Ga0265323_10011188 3300028653 Bacteria 3622
351 Ga0265322_10005337 3300028654 Unclassified 3805
352 Ga0265336_10015942 3300028666 Bacteria 2463
353 Ga0265338_10010677 3300028800 Bacteria 10731
354 Ga0265338_10435251 3300028800 Bacteria 930
355 Ga0265324_10000080 3300029957 Bacteria 75366
356 Ga0265324_10055270 3300029957 Unclassified 1361
357 Ga0265330_10000701 3300031235 Bacteria 21281
358 Ga0265330_10002971 3300031235 Bacteria 9028
359 Ga0265330_10003082 3300031235 Bacteria 8820
360 Ga0265330_10011926 3300031235 Bacteria 4066
361 Ga0265330_10023994 3300031235 Unclassified 2766
362 Ga0265330_10024875 3300031235 Unclassified 2715
363 Ga0265330_10029407 3300031235 Bacteria 2471
364 Ga0265332_10005940 3300031238 Bacteria 5582
365 Ga0265332_10012739 3300031238 Bacteria 3730
366 Ga0265332_10046753 3300031238 Unclassified 1864
367 Ga0265320_10023434 3300031240 Bacteria 3286
368 Ga0265320_10060336 3300031240 Bacteria 1811
369 Ga0265325_10004917 3300031241 Bacteria 8337
370 Ga0265325_10035585 3300031241 Bacteria 2644
371 Ga0265329_10000399 3300031242 Bacteria 22840
372 Ga0265329_10000970 3300031242 Bacteria 14382
373 Ga0265340_10000600 3300031247 Bacteria 20099
374 Ga0265339_10000094 3300031249 Bacteria 75397
375 Ga0265339_10024997 3300031249 Bacteria 3435
376 Ga0265339_10025196 3300031249 Bacteria 3417
377 Ga0265339_10026588 3300031249 Bacteria 3313
378 Ga0265331_10005138 3300031250 Bacteria 7972
379 Ga0265331_10006026 3300031250 Bacteria 7225
380 Ga0265316_10000065 3300031344 Bacteria 111353
381 Ga0265316_10000826 3300031344 Bacteria 34298
382 Ga0265316_10000992 3300031344 Bacteria 30827
383 Ga0265316_10006038 3300031344 Bacteria 11637
384 Ga0265316_10009498 3300031344 Bacteria 8957
385 Ga0265316_10012087 3300031344 Bacteria 7756
386 Ga0265316_10019264 3300031344 Bacteria 5841
387 Ga0265316_10133653 3300031344 Bacteria 1867
388 Ga0307408_100017735 3300031548 Bacteria 4769
389 Ga0307408_100266464 3300031548 Bacteria 1420
390 Ga0265313_10012643 3300031595 Bacteria 5133
391 Ga0265313_10030287 3300031595 Unclassified 2788
392 Ga0265313_10068718 3300031595 Bacteria 1636
393 Ga0316579_10064811 3300031691 Bacteria 1723
394 Ga0265314_10000017 3300031711 Bacteria 340498
395 Ga0265314_10001627 3300031711 Bacteria 24594
396 Ga0265314_10010503 3300031711 Bacteria 7720
397 Ga0265314_10113276 3300031711 Bacteria 1720
398 Ga0265342_10000375 3300031712 Bacteria 49288
399 Ga0265342_10000580 3300031712 Bacteria 38622
400 Ga0265342_10000742 3300031712 Bacteria 33536
401 Ga0265342_10000922 3300031712 Bacteria 29211
402 Ga0265342_10003290 3300031712 Bacteria 13373
403 Ga0265342_10024636 3300031712 Unclassified 3796
404 Ga0265342_10024849 3300031712 Unclassified 3775
405 Ga0265342_10038913 3300031712 Bacteria 2893
406 Ga0265342_10129643 3300031712 Bacteria 1414
407 Ga0316576_10317148 3300031727 Bacteria 1163
408 Ga0316578_10052040 3300031728 Bacteria 2399
409 Ga0316578_10095624 3300031728 Bacteria 1778
410 Ga0307405_10069335 3300031731 Bacteria 2260
411 Ga0316577_10021113 3300031733 Bacteria 3611
412 Ga0307409_100247908 3300031995 Bacteria 1626
413 Ga0307416_100005687 3300032002 Bacteria 7705
414 Ga0307411_10057601 3300032005 Bacteria 2568
415 Ga0373948_0002540 3300034817 Bacteria 2713
416 Ga0373951_0017974 3300035091 Bacteria 1603
417 Ga0373932_0032939 3300035112 Bacteria 1453
418 Ga0373939_0048194 3300035114 Bacteria 1312
419 Ga0373941_0020651 3300035115 Bacteria 1849
420 Ga0373954_0002028 3300035118 Bacteria 8418
421 Ga0373954_0038561 3300035118 Bacteria 2223
422 Ga0373956_0008557 3300035119 Bacteria 4143
423 Ga0373960_0002696 3300035121 Bacteria 4016
424 Ga0373960_0018815 3300035121 Bacteria 1807
425 Ga0373946_0104538 3300035171 Bacteria 1274
426 Ga0373955_0015727 3300035172 Bacteria 3712
427 Ga0373955_0101263 3300035172 Bacteria 1654
428 Ga0373962_0004473 3300035242 Bacteria 3378
429 Ga0373962_0027874 3300035242 Bacteria 1530
430 Ga0373924_0016741 3300035410 Bacteria 2803
431 Ga0373931_0046186 3300035691 Bacteria 2301
432 Ga0373931_0050008 3300035691 Bacteria 2223
433 Ga0373931_0197369 3300035691 Bacteria 1200
434 Ga0373947_0103853 3300035725 Bacteria 1789
435 Ga0373937_0007030 3300036401 Bacteria 9714
436 Ga0373937_0060062 3300036401 Bacteria 3493
437 Ga0316582_0077665 3300036647 Bacteria 2161
438 Ga0316584_0085030 3300036712 Bacteria 2368
439 Ga0373925_0021917 3300037068 Bacteria 4657
440 Ga0395899_0211267 3300037312 Bacteria 1348
441 Ga0395899_0263012 3300037312 Bacteria 1179
442 Ga0395900_0005691 3300037418 Bacteria 13029
443 Ga0395898_0201811 3300037466 Bacteria 1898
444 Ga0395905_0032464 3300037471 Bacteria 4910
445 Ga0395901_0018867 3300038443 Bacteria 7051
446 Ga0436365_1126243 3300039437 Bacteria 5091
447 Ga0439455_0066959 3300042012 Unclassified 960
448 Ga0450889_005460 3300042144 Bacteria 1266
449 Ga0439458_0017198 3300042157 Bacteria 1649
450 Ga0439459_0000491 3300042438 Bacteria 5180
451 Ga0439460_0081594 3300042461 Bacteria 1016
452 Ga0451577_0001990 3300042876 Bacteria 25566
453 Ga0451577_0053767 3300042876 Bacteria 3595
454 Ga0451577_0087346 3300042876 Bacteria 2782
455 Ga0451577_0151192 3300042876 Bacteria 2089
456 Ga0451577_0206147 3300042876 Bacteria 1775
457 Ga0451577_0342995 3300042876 Unclassified 1355
458 Ga0453683_0062842 3300044673 Bacteria 2321
459 Ga0453683_0091662 3300044673 Bacteria 1905
460 Ga0453684_0011624 3300044712 Bacteria 14705
461 Ga0453684_0164407 3300044712 Bacteria 2622
462 Ga0453684_0405354 3300044712 Unclassified 1526
463 Ga0451576_0008274 3300045051 Bacteria 12229
464 Ga0451576_0009168 3300045051 Bacteria 11499
465 Ga0451576_0009918 3300045051 Bacteria 10998
466 Ga0451576_0031610 3300045051 Bacteria 5641
467 Ga0451576_0256253 3300045051 Bacteria 1829
468 Ga0451576_0326863 3300045051 Bacteria 1605
469 Ga0451576_0772816 3300045051 Archaea 1009
470 Ga0495580_0005348 3300046472 Bacteria 10639
471 Ga0495586_0025342 3300046535 Bacteria 3173
472 Ga0495634_0034228 3300046642 Bacteria 3487
473 Ga0495659_0005977 3300046664 Bacteria 3848
474 Ga0495659_0063960 3300046664 Unclassified 1365
475 Ga0495659_0104125 3300046664 Bacteria 1102
476 Ga0495669_0113661 3300046684 Bacteria 1266
477 Ga0495674_0005331 3300047319 Bacteria 12335
478 Ga0496100_0018695 3300048903 Bacteria 4117
479 Ga0496101_0028160 3300048904 Bacteria 3921
480 Ga0496102_0174367 3300048905 Bacteria 2024
481 Ga0496102_0355646 3300048905 Bacteria 1379
482 Ga0496104_0082999 3300048907 Bacteria 3056
483 Ga0496106_0063882 3300048909 Bacteria 2799
484 Ga0496108_0071461 3300048911 Bacteria 2928
485 Ga0496109_0114036 3300048912 Bacteria 2514
486 Ga0496110_0345186 3300048913 Bacteria 1356
487 Ga0496112_0020424 3300048915 Bacteria 6279
488 Ga0496112_0204511 3300048915 Unclassified 1933
489 Ga0496114_0000221 3300048917 Bacteria 41396
490 Ga0496114_0051798 3300048917 Bacteria 3418
491 Ga0496115_0438292 3300048918 Bacteria 1057
492 Ga0501032_0166909 3300049569 Bacteria 1444
493 Ga0501033_0032927 3300049570 Bacteria 3892
494 Ga0501034_0056846 3300049571 Bacteria 3935
495 Ga0501036_0028787 3300049572 Unclassified 4695
496 Ga0501036_0271546 3300049572 Bacteria 1420
497 Ga0501037_0185589 3300049573 Bacteria 1474
498 Ga0501038_0223887 3300049574 Bacteria 1500
499 Ga0501038_0389256 3300049574 Bacteria 1080
500 Ga0501039_0020570 3300049575 Bacteria 5057
501 Ga0501039_0238177 3300049575 Bacteria 1431
502 Ga0501039_0356509 3300049575 Bacteria 1149
503 Ga0501040_0003099 3300049576 Bacteria 10777
504 Ga0501040_0033045 3300049576 Bacteria 3503
505 Ga0501040_0038878 3300049576 Bacteria 3235
506 Ga0501040_0134450 3300049576 Bacteria 1740
507 Ga0501041_0012883 3300049577 Bacteria 4954
508 Ga0501041_0056424 3300049577 Bacteria 2400
509 Ga0501041_0081490 3300049577 Bacteria 1993
510 Ga0501042_0014035 3300049578 Bacteria 5462
511 Ga0501042_0192648 3300049578 Bacteria 1470
512 Ga0501043_0365443 3300049579 Unclassified 1095
513 Ga0501046_0001061 3300049580 Bacteria 26920
514 Ga0501046_0094908 3300049580 Bacteria 2292
515 Ga0501047_0047216 3300049581 Bacteria 4160
516 Ga0501048_0007909 3300049582 Bacteria 8052
517 Ga0501048_0095645 3300049582 Bacteria 2095
518 Ga0501048_0127710 3300049582 Bacteria 1798
519 Ga0501067_0001676 3300049583 Bacteria 12179
520 Ga0501067_0002509 3300049583 Bacteria 10134
521 Ga0501067_0017538 3300049583 Bacteria 3962
522 Ga0501068_0086873 3300049584 Bacteria 1926
523 Ga0501068_0101448 3300049584 Bacteria 1784
524 Ga0501069_0215828 3300049585 Bacteria 1114
525 Ga0501070_0000323 3300049586 Bacteria 43475
526 Ga0501070_0294423 3300049586 Bacteria 1323
527 Ga0501071_0151120 3300049587 Bacteria 1732
528 Ga0501072_0021192 3300049588 Bacteria 5041
529 Ga0501072_0031768 3300049588 Bacteria 4134
530 Ga0501072_0285237 3300049588 Bacteria 1313
531 Ga0501073_0000158 3300049589 Bacteria 44606
532 Ga0501073_0006633 3300049589 Bacteria 8619
533 Ga0501073_0012053 3300049589 Bacteria 6311
534 Ga0501073_0013933 3300049589 Bacteria 5844
535 Ga0501073_0044360 3300049589 Bacteria 3134
536 Ga0501074_0008631 3300049590 Bacteria 7381
537 Ga0501074_0039071 3300049590 Bacteria 3437
538 Ga0501074_0133093 3300049590 Bacteria 1778
539 Ga0501074_0146450 3300049590 Bacteria 1689
540 Ga0501074_0229665 3300049590 Bacteria 1321
541 Ga0501074_0241037 3300049590 Bacteria 1286
542 Ga0501074_0420248 3300049590 Bacteria 948
543 Ga0501075_0024237 3300049591 Bacteria 4446
544 Ga0501075_0162277 3300049591 Bacteria 1705
545 Ga0501075_0330614 3300049591 Bacteria 1161
546 Ga0501075_0476259 3300049591 Bacteria 952
547 Ga0501076_0001460 3300049592 Bacteria 15855
548 Ga0501076_0053624 3300049592 Bacteria 3196
549 Ga0501076_0056719 3300049592 Bacteria 3109
550 Ga0501076_0185531 3300049592 Bacteria 1696
551 Ga0501076_0263139 3300049592 Bacteria 1412
552 Ga0501077_0010940 3300049593 Bacteria 5655
553 Ga0501077_0012847 3300049593 Bacteria 5247
554 Ga0501079_0011180 3300049741 Bacteria 6847
555 Ga0501079_0018988 3300049741 Bacteria 5252
556 Ga0501079_0024193 3300049741 Bacteria 4661
557 Ga0501079_0060069 3300049741 Bacteria 2933
558 Ga0501079_0063867 3300049741 Bacteria 2840
559 Ga0501079_0088156 3300049741 Bacteria 2403
560 Ga0501079_0531753 3300049741 Bacteria 924
561 Ga0501080_0007388 3300049742 Bacteria 9916
562 Ga0501080_0031207 3300049742 Bacteria 4965
563 Ga0501080_0061114 3300049742 Bacteria 3508
564 Ga0501080_0088086 3300049742 Bacteria 2884
565 Ga0501080_0196930 3300049742 Bacteria 1850
566 Ga0501081_0002044 3300049743 Bacteria 12579
567 Ga0501081_0022258 3300049743 Bacteria 4238
568 Ga0501081_0127676 3300049743 Bacteria 1815
569 Ga0501083_0003984 3300049744 Bacteria 10372
570 Ga0501083_0012061 3300049744 Bacteria 6052
571 Ga0501083_0104497 3300049744 Bacteria 1866
572 Ga0501035_0542015 3300049822 Bacteria 954
573 Ga0501045_0007362 3300049824 Bacteria 7653
574 Ga0501045_0041632 3300049824 Bacteria 3342
575 Ga0501045_0059359 3300049824 Bacteria 2802
576 Ga0501045_0074467 3300049824 Bacteria 2500
577 Ga0501045_0210475 3300049824 Bacteria 1448
578 nmdc:mga05p37_123382_c1 3300050507 Bacteria 3182
579 nmdc:mga05p37_1506_c1 3300050507 Bacteria 27090
580 nmdc:mga05p37_170658_c1 3300050507 Bacteria 2653
581 nmdc:mga05p37_185927_c1 3300050507 Unclassified 2151
582 nmdc:mga05p37_20979_c1 3300050507 Bacteria 7908
583 nmdc:mga05p37_2390_c1 3300050507 Bacteria 21826
584 nmdc:mga05p37_254696_c1 3300050507 Bacteria 2104
585 nmdc:mga05p37_3086_c1 3300050507 Bacteria 19352
586 nmdc:mga05p37_316137_c1 3300050507 Bacteria 1850
587 nmdc:mga05p37_316944_c1 3300050507 Bacteria 1847
588 nmdc:mga05p37_358372_c1 3300050507 Bacteria 1715
589 nmdc:mga05p37_445668_c1 3300050507 Bacteria 1500
590 nmdc:mga05p37_5028_c1 3300050507 Bacteria 2775
591 nmdc:mga05p37_51356_c1 3300050507 Bacteria 5070
592 nmdc:mga05p37_69866_c1 3300050507 Bacteria 4320
593 nmdc:mga05p37_75004_c1 3300050507 Bacteria 4163
594 nmdc:mga05p37_77806_c1 3300050507 Bacteria 4084
595 nmdc:mga09592_104554_c1 3300050508 Bacteria 2427
596 nmdc:mga09592_178532_c1 3300050508 Bacteria 1836
597 nmdc:mga09592_3992_c1 3300050508 Bacteria 11892
598 nmdc:mga09592_861_c1 3300050508 Bacteria 23697
599 nmdc:mga0qj67_287937_c1 3300050509 Bacteria 1331
600 nmdc:mga0qj67_358058_c1 3300050509 Unclassified 1179
601 nmdc:mga0qj67_463_c1 3300050509 Bacteria 27779
602 nmdc:mga0qj67_562256_c1 3300050509 Bacteria 914
603 nmdc:mga0qj67_68749_c1 3300050509 Bacteria 2824
604 nmdc:mga0qj67_79097_c1 3300050509 Bacteria 2632
605 nmdc:mga0qj67_826_c1 3300050509 Bacteria 21216
606 nmdc:mga06r32_113473_c1 3300050510 Bacteria 2668
607 nmdc:mga06r32_123086_c1 3300050510 Bacteria 2560
608 nmdc:mga06r32_1372_c1 3300050510 Bacteria 22005
609 nmdc:mga06r32_2413_c1 3300050510 Bacteria 16714
610 nmdc:mga06r32_303018_c1 3300050510 Bacteria 1584
611 nmdc:mga06r32_339832_c1 3300050510 Bacteria 1486
612 nmdc:mga06r32_406776_c1 3300050510 Bacteria 1343
613 nmdc:mga06r32_456956_c1 3300050510 Bacteria 1256
614 nmdc:mga06r32_478909_c1 3300050510 Bacteria 1223
615 nmdc:mga06r32_537_c1 3300050510 Bacteria 32881
616 nmdc:mga06r32_8740_c1 3300050510 Bacteria 9126
617 nmdc:mga08y16_13022_c1 3300050511 Bacteria 8754
618 nmdc:mga08y16_24805_c1 3300050511 Bacteria 6327
619 nmdc:mga08y16_2939_c1 3300050511 Bacteria 17547
620 nmdc:mga08y16_56083_c1 3300050511 Bacteria 4118
621 nmdc:mga08y16_627_c1 3300050511 Bacteria 33082
622 nmdc:mga08y16_65626_c1 3300050511 Bacteria 3789
623 nmdc:mga0n895_140405_c1 3300050512 Bacteria 2444
624 nmdc:mga0n895_168768_c1 3300050512 Bacteria 2220
625 nmdc:mga0n895_27256_c1 3300050512 Bacteria 5426
626 nmdc:mga0n895_409_c1 3300050512 Bacteria 28758
627 nmdc:mga0n895_4434_c1 3300050512 Bacteria 11533
628 nmdc:mga0n895_5272_c1 3300050512 Bacteria 10765
629 nmdc:mga0n895_559575_c1 3300050512 Bacteria 1149
630 nmdc:mga0n895_63533_c1 3300050512 Bacteria 3651
631 nmdc:mga0n895_99808_c1 3300050512 Bacteria 2912
632 nmdc:mga0rr50_149333_c1 3300050513 Bacteria 1887
633 nmdc:mga0rr50_396762_c1 3300050513 Bacteria 1165
634 nmdc:mga0rr50_5352_c1 3300050513 Bacteria 7646
635 nmdc:mga0rr50_60191_c1 3300050513 Bacteria 2856
636 nmdc:mga0rr50_65188_c1 3300050513 Bacteria 2758
637 nmdc:mga0rr50_76337_c1 3300050513 Bacteria 2572
638 nmdc:mga0rr50_88152_c1 3300050513 Bacteria 2410
639 nmdc:mga08x19_2458_c1 3300050514 Bacteria 11272
640 nmdc:mga08x19_326955_c1 3300050514 Unclassified 1068
641 nmdc:mga08x19_41190_c1 3300050514 Bacteria 2942
642 nmdc:mga08x19_60462_c1 3300050514 Bacteria 2454
643 nmdc:mga0a205_12705_c1 3300050515 Bacteria 7804
644 nmdc:mga0a205_131399_c1 3300050515 Bacteria 2404
645 nmdc:mga0a205_134554_c1 3300050515 Bacteria 2372
646 nmdc:mga0a205_15324_c1 3300050515 Bacteria 7163
647 nmdc:mga0a205_1687_c1 3300050515 Bacteria 10150
648 nmdc:mga0a205_220711_c1 3300050515 Bacteria 1781
649 nmdc:mga0a205_228477_c1 3300050515 Bacteria 1745
650 nmdc:mga0a205_39209_c1 3300050515 Bacteria 4559
651 nmdc:mga0a205_420991_c1 3300050515 Bacteria 1198
652 nmdc:mga0a205_44958_c1 3300050515 Bacteria 4259
653 nmdc:mga0a205_71330_c1 3300050515 Bacteria 3355
654 nmdc:mga0a205_73133_c1 3300050515 Bacteria 3312
655 nmdc:mga0a205_9294_c1 3300050515 Bacteria 8977
656 Ga0501084_0004627 3300054114 Bacteria 11244
657 Ga0501084_0007940 3300054114 Bacteria 8738
658 Ga0501084_0040264 3300054114 Bacteria 3908
659 Ga0501082_0004199 3300060353 Bacteria 12589
660 Ga0501082_0006632 3300060353 Bacteria 10016
661 Ga0501082_0008410 3300060353 Bacteria 8903
662 Ga0501082_0038863 3300060353 Bacteria 4105
663 Ga0501082_0052503 3300060353 Bacteria 3514
664 Ga0501082_0177835 3300060353 Bacteria 1850
665 Ga0501082_0541300 3300060353 Bacteria 1018
666 Ga0530510_0015435 3300061734 Bacteria 5398
667 Ga0530510_0063359 3300061734 Bacteria 2677
668 Ga0530510_0156315 3300061734 Bacteria 1685
669 Ga0530510_0258329 3300061734 Bacteria 1298
670 Ga0114129_10093462
671 JGI25406J46586_10013381
672 rootH1_10017798
673 Ga0065707_10240704
674 Ga0070676_10019692
675 Ga0070676_10040429
676 Ga0070683_100007795
677 Ga0070683_100050557
678 Ga0070690_100040042
679 Ga0070670_100010134
680 Ga0068869_100015201
681 Ga0068869_100018803
682 Ga0070680_100001301
683 Ga0070680_100025171
684 Ga0070680_100025490
685 Ga0070682_100000495
686 Ga0068868_100113034
687 Ga0070660_100000124
688 Ga0070660_100181551
689 Ga0070687_100007678
690 Ga0070687_100022100
691 Ga0070687_100077212
692 Ga0070661_100001023
693 Ga0070692_10000618
694 Ga0070669_100015111
695 Ga0070669_100375102
696 Ga0070671_100135620
697 Ga0070673_100202684
698 Ga0070688_100029610
699 Ga0070659_100000618
700 Ga0070703_10047798
701 Ga0070703_10073826
702 Ga0070714_100335897
703 Ga0070711_100085111
704 Ga0070711_100117982
705 Ga0070705_100002091
706 Ga0070705_100007031
707 Ga0070705_100165044
708 Ga0070700_100027450
709 Ga0070694_100000602
710 Ga0070694_100009007
711 Ga0070694_100050723
712 Ga0070694_100216739
713 Ga0070694_100345136
714 Ga0070708_100011468
715 Ga0070708_100018666
716 Ga0070708_100046653
717 Ga0070708_100077613
718 Ga0070708_100115502
719 Ga0070708_100174712
720 Ga0070708_100248134
721 Ga0070663_100001130
722 Ga0070662_100034468
723 Ga0070662_100061978
724 Ga0070681_10124185
725 Ga0070681_10165945
726 Ga0070681_10551979
727 Ga0068867_100001188
728 Ga0068867_100057683
729 Ga0068867_100154904
730 Ga0068867_100265875
731 Ga0070685_10056573
732 Ga0070685_10288254
733 Ga0070706_100005315
734 Ga0070706_100015987
735 Ga0070706_100100494
736 Ga0070706_100158756
737 Ga0070706_100185916
738 Ga0070706_100235173
739 Ga0070707_100004506
740 Ga0070707_100014301
741 Ga0070707_100041133
742 Ga0070707_100050599
743 Ga0070707_100068007
744 Ga0070707_100137985
745 Ga0070707_100216398
746 Ga0070707_100244196
747 Ga0070707_100335906
748 Ga0070698_100004253
749 Ga0070698_100010504
750 Ga0070698_100109192
751 Ga0070698_100120390
752 Ga0070699_100016065
753 Ga0070699_100016802
754 Ga0070699_100047672
755 Ga0070699_100066616
756 Ga0070699_100097556
757 Ga0070699_100116619
758 Ga0070699_100135370
759 Ga0070699_100166037
760 Ga0070699_100291162
761 Ga0070679_100002293
762 Ga0070679_100240099
763 Ga0070679_100422127
764 Ga0070684_100017601
765 Ga0070697_100003019
766 Ga0070697_100006703
767 Ga0070697_100027295
768 Ga0070697_100031842
769 Ga0070697_100040146
770 Ga0070697_100042539
771 Ga0070697_100127089
772 Ga0070697_100169620
773 Ga0070697_100332017
774 Ga0068853_100002543
775 Ga0070686_100007224
776 Ga0070695_100001813
777 Ga0070695_100003165
778 Ga0070695_100011343
779 Ga0070695_100013100
780 Ga0070695_100022601
781 Ga0070696_100017867
782 Ga0070696_100065161
783 Ga0070693_100005884
784 Ga0070693_100027473
785 Ga0070704_100004784
786 Ga0070704_100011235
787 Ga0070704_100201680
788 Ga0070704_100625445
789 Ga0068855_100001575
790 Ga0068855_100413864
791 Ga0068855_100559261
792 Ga0070664_100004693
793 Ga0068857_100025153
794 Ga0068857_100038352
795 Ga0068854_100518780
796 Ga0068856_100001635
797 Ga0070702_100021333
798 Ga0070702_100026105
799 Ga0068859_100002312
800 Ga0068859_100039939
801 Ga0068859_100346234
802 Ga0068859_100426882
803 Ga0068866_10274960
804 Ga0068861_100007920
805 Ga0068861_100409459
806 Ga0068870_10000321
807 Ga0068863_100030156
808 Ga0068858_100067051
809 Ga0068860_100009220
810 Ga0068860_100040767
811 Ga0068860_100060692
812 Ga0068860_100144743
813 Ga0068860_100464627
814 Ga0068862_100001081
815 Ga0068862_100033702
816 Ga0068862_100314573
817 Ga0081455_10000250
818 Ga0081538_10005196
819 Ga0081540_1007094
820 Ga0081539_10000050
821 Ga0075432_10022384
822 Ga0070715_10030865
823 Ga0075428_100000028
824 Ga0075428_100001102
825 Ga0075428_100045334
826 Ga0075428_100071293
827 Ga0075428_100073039
828 Ga0075428_100180772
829 Ga0075428_100303611
830 Ga0075430_100000017
831 Ga0075430_100000699
832 Ga0075430_100001447
833 Ga0075430_100078114
834 Ga0075431_100000550
835 Ga0075431_100001250
836 Ga0075431_100001338
837 Ga0075431_100001417
838 Ga0075431_100020101
839 Ga0075431_100114301
840 Ga0075431_100163911
841 Ga0075431_100246764
842 Ga0075431_100452154
843 Ga0075433_10005556
844 Ga0075433_10032826
845 Ga0075433_10033029
846 Ga0075433_10036029
847 Ga0075433_10044305
848 Ga0075433_10064130
849 Ga0075433_10097058
850 Ga0075433_10100972
851 Ga0075433_10125787
852 Ga0075433_10222081
853 Ga0075433_10235480
854 Ga0075433_10336964
855 Ga0075434_100005577
856 Ga0075434_100038616
857 Ga0075434_100045492
858 Ga0075434_100058410
859 Ga0075434_100070139
860 Ga0075434_100142521
861 Ga0075434_100268184
862 Ga0075434_100282558
863 Ga0075434_100605174
864 Ga0075429_100000040
865 Ga0075429_100000964
866 Ga0075429_100013907
867 Ga0075429_100047256
868 Ga0068865_100095505
869 Ga0097620_100002312
870 Ga0097620_100039939
871 Ga0097620_100346201
872 Ga0097620_100391605
873 Ga0097620_100426912
874 Ga0075435_100010250
875 Ga0075435_100018730
876 Ga0075435_100030640
877 Ga0075435_100041599
878 Ga0075435_100070880
879 Ga0075435_100121904
880 Ga0075435_100196021
881 Ga0099794_10018965
882 Ga0111539_10002900
883 Ga0111539_10004264
884 Ga0111539_10008891
885 Ga0111539_10015843
886 Ga0111539_10041379
887 Ga0111539_10116983
888 Ga0111539_10559075
889 Ga0114129_10000319
890 Ga0114129_10003397
891 Ga0114129_10003824
892 Ga0114129_10007004
893 Ga0114129_10010804
894 Ga0114129_10080401
895 Ga0114129_10104820
896 Ga0114129_10191068
897 Ga0114129_10233239
898 Ga0114129_10252908
899 Ga0114129_10447137
900 Ga0114129_10851021
901 Ga0105243_10002367
902 Ga0105243_10323908
903 Ga0105241_10001443
904 Ga0105241_10065879
905 Ga0105242_10251998
906 Ga0105248_10134231
907 Ga0105249_10090267
908 Ga0105249_10408810
909 Ga0105249_10764166
910 Ga0105246_10047535
911 Ga0157369_10005427
912 Ga0157378_10901843
913 Ga0163162_10045522
914 Ga0157372_10007418
915 Ga0157372_10144817
916 Ga0207653_10011511
917 Ga0207688_10055052
918 Ga0207645_10004413
919 Ga0207645_10045678
920 Ga0207643_10000461
921 Ga0207643_10035799
922 Ga0207684_10004170
923 Ga0207684_10005941
924 Ga0207684_10011177
925 Ga0207684_10012541
926 Ga0207684_10057686
927 Ga0207684_10078923
928 Ga0207684_10127354
929 Ga0207684_10214520
930 Ga0207684_10279460
931 Ga0207654_10016845
932 Ga0207654_10123695
933 Ga0207707_10001118
934 Ga0207707_10066719
935 Ga0207707_10112072
936 Ga0207663_10037213
937 Ga0207660_10001709
938 Ga0207660_10009892
939 Ga0207660_10079768
940 Ga0207662_10010651
941 Ga0207657_10001077
942 Ga0207649_10004293
943 Ga0207652_10005519
944 Ga0207646_10002644
945 Ga0207646_10006493
946 Ga0207646_10012456
947 Ga0207646_10016459
948 Ga0207646_10020517
949 Ga0207646_10041935
950 Ga0207646_10056778
951 Ga0207646_10088806
952 Ga0207646_10274675
953 Ga0207646_10303282
954 Ga0207646_10320559
955 Ga0207681_10056128
956 Ga0207650_10026464
957 Ga0207650_10290335
958 Ga0207659_10379137
959 Ga0207690_10001644
960 Ga0207706_10003042
961 Ga0207706_10055688
962 Ga0207709_10079551
963 Ga0207709_10271610
964 Ga0207704_10312936
965 Ga0207665_10058031
966 Ga0207689_10000056
967 Ga0207689_10002038
968 Ga0207661_10031764
969 Ga0207661_10147643
970 Ga0207679_10019624
971 Ga0207667_10030328
972 Ga0207667_10251324
973 Ga0207667_10310132
974 Ga0207651_10475533
975 Ga0207712_10095924
976 Ga0207712_10101406
977 Ga0207640_10022086
978 Ga0207677_10077905
979 Ga0207703_10045350
980 Ga0207639_10000271
981 Ga0207678_10001361
982 Ga0207708_10101641
983 Ga0207702_10018831
984 Ga0207641_10119436
985 Ga0207641_10143674
986 Ga0207648_10001741
987 Ga0207648_10057618
988 Ga0207676_10022017
989 Ga0207674_10000173
990 Ga0207674_10047913
991 Ga0207675_100010989
992 Ga0209981_1003595
993 Ga0209968_1005732
994 Ga0209970_1000574
995 Ga0209588_1038257
996 Ga0209588_1051701
997 Ga0209971_1000199
998 Ga0209966_1000475
999 Ga0209998_10003490
1000 Ga0209974_10013380
1001 Ga0207428_10000132
1002 Ga0207428_10000882
1003 Ga0207428_10011733
1004 Ga0207428_10045386
1005 Ga0207428_10191071
1006 Ga0268266_10082566
1007 Ga0268265_10003526
1008 Ga0268265_10015083
1009 Ga0268265_10017079
1010 Ga0268265_10176177
1011 Ga0268264_10095522
1012 Ga0268264_10111423
1013 Ga0268264_10529565
1014 Ga0265337_1006585
1015 Ga0265326_10011753
1016 Ga0265326_10035002
1017 Ga0265323_10002103
1018 Ga0265323_10005585
1019 Ga0265323_10011188
1020 Ga0265322_10005337
1021 Ga0265336_10015942
1022 Ga0265338_10010677
1023 Ga0265338_10435251
1024 Ga0265324_10000080
1025 Ga0265324_10055270
1026 Ga0265330_10000701
1027 Ga0265330_10002971
1028 Ga0265330_10003082
1029 Ga0265330_10011926
1030 Ga0265330_10023994
1031 Ga0265330_10024875
1032 Ga0265330_10029407
1033 Ga0265332_10005940
1034 Ga0265332_10012739
1035 Ga0265332_10046753
1036 Ga0265320_10023434
1037 Ga0265320_10060336
1038 Ga0265325_10004917
1039 Ga0265325_10035585
1040 Ga0265329_10000399
1041 Ga0265329_10000970
1042 Ga0265340_10000600
1043 Ga0265339_10000094
1044 Ga0265339_10024997
1045 Ga0265339_10025196
1046 Ga0265339_10026588
1047 Ga0265331_10005138
1048 Ga0265331_10006026
1049 Ga0265316_10000065
1050 Ga0265316_10000826
1051 Ga0265316_10000992
1052 Ga0265316_10006038
1053 Ga0265316_10009498
1054 Ga0265316_10012087
1055 Ga0265316_10019264
1056 Ga0265316_10133653
1057 Ga0307408_100017735
1058 Ga0307408_100266464
1059 Ga0265313_10012643
1060 Ga0265313_10030287
1061 Ga0265313_10068718
1062 Ga0316579_10064811
1063 Ga0265314_10000017
1064 Ga0265314_10001627
1065 Ga0265314_10010503
1066 Ga0265314_10113276
1067 Ga0265342_10000375
1068 Ga0265342_10000580
1069 Ga0265342_10000742
1070 Ga0265342_10000922
1071 Ga0265342_10003290
1072 Ga0265342_10024636
1073 Ga0265342_10024849
1074 Ga0265342_10038913
1075 Ga0265342_10129643
1076 Ga0316576_10317148
1077 Ga0316578_10052040
1078 Ga0316578_10095624
1079 Ga0307405_10069335
1080 Ga0316577_10021113
1081 Ga0307409_100247908
1082 Ga0307416_100005687
1083 Ga0307411_10057601
1084 Ga0373948_0002540
1085 Ga0373951_0017974
1086 Ga0373932_0032939
1087 Ga0373939_0048194
1088 Ga0373941_0020651
1089 Ga0373954_0002028
1090 Ga0373954_0038561
1091 Ga0373956_0008557
1092 Ga0373960_0002696
1093 Ga0373960_0018815
1094 Ga0373946_0104538
1095 Ga0373955_0015727
1096 Ga0373955_0101263
1097 Ga0373962_0004473
1098 Ga0373962_0027874
1099 Ga0373924_0016741
1100 Ga0373931_0046186
1101 Ga0373931_0050008
1102 Ga0373931_0197369
1103 Ga0373947_0103853
1104 Ga0373937_0007030
1105 Ga0373937_0060062
1106 Ga0316582_0077665
1107 Ga0316584_0085030
1108 Ga0373925_0021917
1109 Ga0395899_0211267
1110 Ga0395899_0263012
1111 Ga0395900_0005691
1112 Ga0395898_0201811
1113 Ga0395905_0032464
1114 Ga0395901_0018867
1115 Ga0436365_1126243
1116 Ga0439455_0066959
1117 Ga0450889_005460
1118 Ga0439458_0017198
1119 Ga0439459_0000491
1120 Ga0439460_0081594
1121 Ga0451577_0001990
1122 Ga0451577_0053767
1123 Ga0451577_0087346
1124 Ga0451577_0151192
1125 Ga0451577_0206147
1126 Ga0451577_0342995
1127 Ga0453683_0062842
1128 Ga0453683_0091662
1129 Ga0453684_0011624
1130 Ga0453684_0164407
1131 Ga0453684_0405354
1132 Ga0451576_0008274
1133 Ga0451576_0009168
1134 Ga0451576_0009918
1135 Ga0451576_0031610
1136 Ga0451576_0256253
1137 Ga0451576_0326863
1138 Ga0451576_0772816
1139 Ga0495580_0005348
1140 Ga0495586_0025342
1141 Ga0495634_0034228
1142 Ga0495659_0005977
1143 Ga0495659_0063960
1144 Ga0495659_0104125
1145 Ga0495669_0113661
1146 Ga0495674_0005331
1147 Ga0496100_0018695
1148 Ga0496101_0028160
1149 Ga0496102_0174367
1150 Ga0496102_0355646
1151 Ga0496104_0082999
1152 Ga0496106_0063882
1153 Ga0496108_0071461
1154 Ga0496109_0114036
1155 Ga0496110_0345186
1156 Ga0496112_0020424
1157 Ga0496112_0204511
1158 Ga0496114_0000221
1159 Ga0496114_0051798
1160 Ga0496115_0438292
1161 Ga0501032_0166909
1162 Ga0501033_0032927
1163 Ga0501034_0056846
1164 Ga0501036_0028787
1165 Ga0501036_0271546
1166 Ga0501037_0185589
1167 Ga0501038_0223887
1168 Ga0501038_0389256
1169 Ga0501039_0020570
1170 Ga0501039_0238177
1171 Ga0501039_0356509
1172 Ga0501040_0003099
1173 Ga0501040_0033045
1174 Ga0501040_0038878
1175 Ga0501040_0134450
1176 Ga0501041_0012883
1177 Ga0501041_0056424
1178 Ga0501041_0081490
1179 Ga0501042_0014035
1180 Ga0501042_0192648
1181 Ga0501043_0365443
1182 Ga0501046_0001061
1183 Ga0501046_0094908
1184 Ga0501047_0047216
1185 Ga0501048_0007909
1186 Ga0501048_0095645
1187 Ga0501048_0127710
1188 Ga0501067_0001676
1189 Ga0501067_0002509
1190 Ga0501067_0017538
1191 Ga0501068_0086873
1192 Ga0501068_0101448
1193 Ga0501069_0215828
1194 Ga0501070_0000323
1195 Ga0501070_0294423
1196 Ga0501071_0151120
1197 Ga0501072_0021192
1198 Ga0501072_0031768
1199 Ga0501072_0285237
1200 Ga0501073_0000158
1201 Ga0501073_0006633
1202 Ga0501073_0012053
1203 Ga0501073_0013933
1204 Ga0501073_0044360
1205 Ga0501074_0008631
1206 Ga0501074_0039071
1207 Ga0501074_0133093
1208 Ga0501074_0146450
1209 Ga0501074_0229665
1210 Ga0501074_0241037
1211 Ga0501074_0420248
1212 Ga0501075_0024237
1213 Ga0501075_0162277
1214 Ga0501075_0330614
1215 Ga0501075_0476259
1216 Ga0501076_0001460
1217 Ga0501076_0053624
1218 Ga0501076_0056719
1219 Ga0501076_0185531
1220 Ga0501076_0263139
1221 Ga0501077_0010940
1222 Ga0501077_0012847
1223 Ga0501079_0011180
1224 Ga0501079_0018988
1225 Ga0501079_0024193
1226 Ga0501079_0060069
1227 Ga0501079_0063867
1228 Ga0501079_0088156
1229 Ga0501079_0531753
1230 Ga0501080_0007388
1231 Ga0501080_0031207
1232 Ga0501080_0061114
1233 Ga0501080_0088086
1234 Ga0501080_0196930
1235 Ga0501081_0002044
1236 Ga0501081_0022258
1237 Ga0501081_0127676
1238 Ga0501083_0003984
1239 Ga0501083_0012061
1240 Ga0501083_0104497
1241 Ga0501035_0542015
1242 Ga0501045_0007362
1243 Ga0501045_0041632
1244 Ga0501045_0059359
1245 Ga0501045_0074467
1246 Ga0501045_0210475
1247 nmdc:mga05p37_123382_c1
1248 nmdc:mga05p37_1506_c1
1249 nmdc:mga05p37_170658_c1
1250 nmdc:mga05p37_185927_c1
1251 nmdc:mga05p37_20979_c1
1252 nmdc:mga05p37_2390_c1
1253 nmdc:mga05p37_254696_c1
1254 nmdc:mga05p37_3086_c1
1255 nmdc:mga05p37_316137_c1
1256 nmdc:mga05p37_316944_c1
1257 nmdc:mga05p37_358372_c1
1258 nmdc:mga05p37_445668_c1
1259 nmdc:mga05p37_5028_c1
1260 nmdc:mga05p37_51356_c1
1261 nmdc:mga05p37_69866_c1
1262 nmdc:mga05p37_75004_c1
1263 nmdc:mga05p37_77806_c1
1264 nmdc:mga09592_104554_c1
1265 nmdc:mga09592_178532_c1
1266 nmdc:mga09592_3992_c1
1267 nmdc:mga09592_861_c1
1268 nmdc:mga0qj67_287937_c1
1269 nmdc:mga0qj67_358058_c1
1270 nmdc:mga0qj67_463_c1
1271 nmdc:mga0qj67_562256_c1
1272 nmdc:mga0qj67_68749_c1
1273 nmdc:mga0qj67_79097_c1
1274 nmdc:mga0qj67_826_c1
1275 nmdc:mga06r32_113473_c1
1276 nmdc:mga06r32_123086_c1
1277 nmdc:mga06r32_1372_c1
1278 nmdc:mga06r32_2413_c1
1279 nmdc:mga06r32_303018_c1
1280 nmdc:mga06r32_339832_c1
1281 nmdc:mga06r32_406776_c1
1282 nmdc:mga06r32_456956_c1
1283 nmdc:mga06r32_478909_c1
1284 nmdc:mga06r32_537_c1
1285 nmdc:mga06r32_8740_c1
1286 nmdc:mga08y16_13022_c1
1287 nmdc:mga08y16_24805_c1
1288 nmdc:mga08y16_2939_c1
1289 nmdc:mga08y16_56083_c1
1290 nmdc:mga08y16_627_c1
1291 nmdc:mga08y16_65626_c1
1292 nmdc:mga0n895_140405_c1
1293 nmdc:mga0n895_168768_c1
1294 nmdc:mga0n895_27256_c1
1295 nmdc:mga0n895_409_c1
1296 nmdc:mga0n895_4434_c1
1297 nmdc:mga0n895_5272_c1
1298 nmdc:mga0n895_559575_c1
1299 nmdc:mga0n895_63533_c1
1300 nmdc:mga0n895_99808_c1
1301 nmdc:mga0rr50_149333_c1
1302 nmdc:mga0rr50_396762_c1
1303 nmdc:mga0rr50_5352_c1
1304 nmdc:mga0rr50_60191_c1
1305 nmdc:mga0rr50_65188_c1
1306 nmdc:mga0rr50_76337_c1
1307 nmdc:mga0rr50_88152_c1
1308 nmdc:mga08x19_2458_c1
1309 nmdc:mga08x19_326955_c1
1310 nmdc:mga08x19_41190_c1
1311 nmdc:mga08x19_60462_c1
1312 nmdc:mga0a205_12705_c1
1313 nmdc:mga0a205_131399_c1
1314 nmdc:mga0a205_134554_c1
1315 nmdc:mga0a205_15324_c1
1316 nmdc:mga0a205_1687_c1
1317 nmdc:mga0a205_220711_c1
1318 nmdc:mga0a205_228477_c1
1319 nmdc:mga0a205_39209_c1
1320 nmdc:mga0a205_420991_c1
1321 nmdc:mga0a205_44958_c1
1322 nmdc:mga0a205_71330_c1
1323 nmdc:mga0a205_73133_c1
1324 nmdc:mga0a205_9294_c1
1325 Ga0501084_0004627
1326 Ga0501084_0007940
1327 Ga0501084_0040264
1328 Ga0501082_0004199
1329 Ga0501082_0006632
1330 Ga0501082_0008410
1331 Ga0501082_0038863
1332 Ga0501082_0052503
1333 Ga0501082_0177835
1334 Ga0501082_0541300
1335 Ga0530510_0015435
1336 Ga0530510_0063359
1337 Ga0530510_0156315
1338 Ga0530510_0258329

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02540

NAD_synthase

NAD synthase

16

122

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
5udw-assembly1.cif.gz_B lare, a sulfur transferase involved in synthesis of the cofactor for lactate racemase, in complex with nickel 0.931 5 261
6dg3-assembly2.cif.gz_D lare, a sulfur transferase involved in synthesis of the cofactor for lactate racemase, in complex with caesium 0.9308 5 260
5udv-assembly1.cif.gz_B lare, a sulfur transferase involved in synthesis of the cofactor for lactate racemase, in complex with iron 0.9284 5 261
6b2o-assembly1.cif.gz_B lare, a sulfur transferase involved in synthesis of the cofactor for lactate racemase, c176a variant 0.9263 5 261
6utq-assembly1.cif.gz_B lare, a sulfur transferase involved in synthesis of the cofactor for lactate racemase in complex with cadmium 0.9249 5 261
ID Description Score Start End Superfamily
af_Q58240_5_163_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9052 8 167 3.40.50.620
af_Q58240_5_163_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8838 8 167 3.40.50.620
3n05B02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8017 5 164 3.40.50.620
af_P77718_175_396_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7914 21 170 3.40.50.620
af_O96136_47_161_3.40.50.10130 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7813 35 79 3.40.50.10130
ID Description Score Start End GO Terms
AF-A0A2V7ASI4-F1-model_v4 ATP-dependent sacrificial sulfur transferase LarE 0.9845 5 226 GO:0016783
AF-A0A353MYQ7-F1-model_v4 deleted 0.9821 5 184
AF-A0A1F3BG15-F1-model_v4 TIGR00268 family protein 0.9816 3 264 GO:0016783
AF-A0A1G1QJS3-F1-model_v4 TIGR00268 family protein 0.9814 3 199 GO:0016783
AF-A0A1Q7UJJ5-F1-model_v4 TIGR00268 family protein 0.9813 7 273 GO:0016783

Map