F473968

General Info

Members Datasets Scaffolds Average Seq Length
669 297 1338 62

Family's Representative Sequence

Representative Sequence 3300005335|Ga0070666_10018074|Ga0070666_100180745
Length 70
Sequence MAAGHEELMDTRLLEILACPICKGTLKFQRDAQVLVCRMDRLAYPIRDDVPVMLEEEARQLSADDPLLER

Samples

Sample ID Description Type Environment
1 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
66 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
93 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
94 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
95 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
96 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
97 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
153 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
154 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
155 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
156 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
157 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
158 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
159 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
160 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
161 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
162 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
163 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
164 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
165 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
166 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
167 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
168 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
169 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
170 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
171 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
172 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
173 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
175 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
180 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
181 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
182 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
183 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
184 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
185 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
186 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
187 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
188 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
189 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
190 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
191 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
192 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
193 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
194 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
195 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
196 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
197 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
198 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
199 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
200 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
201 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
202 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
203 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
204 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
205 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
206 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
207 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
208 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
209 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
210 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
211 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
212 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
213 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
214 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
215 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
216 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
217 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
218 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
219 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
220 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
221 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
222 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
223 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
224 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
225 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
226 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
227 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
228 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
229 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
230 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
231 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
232 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
233 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
234 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
235 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
236 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
237 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
238 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
239 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
240 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
241 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
242 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
243 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
244 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
245 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
246 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
247 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
248 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
249 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
250 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
251 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
252 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
253 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
254 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
255 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
256 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
257 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
258 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
259 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
260 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
261 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
262 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
263 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
264 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
265 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
266 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
267 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
268 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
269 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
270 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
271 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
272 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
273 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
274 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
275 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
276 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
277 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
278 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
279 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
280 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
281 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
284 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
285 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
286 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
287 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
288 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
289 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
290 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
291 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
292 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
293 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
294 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
295 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
296 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
297 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.86
Metatranscriptomes 3.14
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.94
Nodule 0
Rhizoplane 4.93
Rhizosphere 81.76
Stem 0
Stem Tuber 0
Unclassified 9.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070666_10018074 3300005335 Bacteria 4527
2 rootL2_10186149 3300003322 Bacteria 1837
3 Ga0065707_10600472 3300005295 Bacteria 690
4 Ga0070670_100512914 3300005331 Bacteria 1067
5 Ga0070670_101769990 3300005331 Bacteria 569
6 Ga0068869_100594289 3300005334 Bacteria 934
7 Ga0068869_100996414 3300005334 Bacteria 729
8 Ga0068869_101107467 3300005334 Bacteria 693
9 Ga0070666_10002425 3300005335 Bacteria 11267
10 Ga0070666_10015077 3300005335 Bacteria 4926
11 Ga0070666_10084481 3300005335 Bacteria 2173
12 Ga0070680_100066633 3300005336 Bacteria 2953
13 Ga0070680_100079851 3300005336 Bacteria 2697
14 Ga0070682_101694291 3300005337 Bacteria 549
15 Ga0068868_100101065 3300005338 Bacteria 2333
16 Ga0068868_100407613 3300005338 Bacteria 1174
17 Ga0070689_101192421 3300005340 Bacteria 683
18 Ga0070691_10706713 3300005341 Bacteria 606
19 Ga0070668_100328025 3300005347 Bacteria 1290
20 Ga0070675_100202646 3300005354 Bacteria 1722
21 Ga0070671_100002320 3300005355 Bacteria 14683
22 Ga0070671_100010336 3300005355 Bacteria 7487
23 Ga0070671_100367522 3300005355 Bacteria 1228
24 Ga0070671_101990448 3300005355 Bacteria 517
25 Ga0070674_100092755 3300005356 Bacteria 2183
26 Ga0070674_101216818 3300005356 Bacteria 669
27 Ga0070674_101448888 3300005356 Bacteria 616
28 Ga0070673_100022554 3300005364 Bacteria 4585
29 Ga0070688_101600951 3300005365 Bacteria 532
30 Ga0070667_100000225 3300005367 Bacteria 65088
31 Ga0070667_100027724 3300005367 Bacteria 4713
32 Ga0070667_100030133 3300005367 Bacteria 4524
33 Ga0070667_100049394 3300005367 Bacteria 3543
34 Ga0070667_100651983 3300005367 Bacteria 972
35 Ga0070667_101078615 3300005367 Bacteria 750
36 Ga0070667_101102276 3300005367 Unclassified 742
37 Ga0070709_10027520 3300005434 Bacteria 3381
38 Ga0070714_101414177 3300005435 Bacteria 679
39 Ga0070713_100001336 3300005436 Bacteria 15762
40 Ga0070713_100023726 3300005436 Bacteria 4767
41 Ga0070713_100283721 3300005436 Bacteria 1520
42 Ga0070713_101453616 3300005436 Bacteria 665
43 Ga0070711_100003408 3300005439 Bacteria 9262
44 Ga0070705_100550828 3300005440 Unclassified 884
45 Ga0070700_100185997 3300005441 Bacteria 1449
46 Ga0070694_100256359 3300005444 Bacteria 1325
47 Ga0070663_100536078 3300005455 Bacteria 976
48 Ga0070663_101161032 3300005455 Bacteria 677
49 Ga0070678_100064700 3300005456 Bacteria 2711
50 Ga0070678_101104191 3300005456 Bacteria 732
51 Ga0070662_100384248 3300005457 Bacteria 1156
52 Ga0070662_100896388 3300005457 Bacteria 757
53 Ga0070681_10588097 3300005458 Bacteria 1027
54 Ga0070681_10958529 3300005458 Bacteria 775
55 Ga0070685_10254408 3300005466 Bacteria 1165
56 Ga0070685_10970100 3300005466 Unclassified 636
57 Ga0070707_101326552 3300005468 Bacteria 686
58 Ga0070679_100023458 3300005530 Bacteria 6040
59 Ga0070679_100102733 3300005530 Bacteria 2845
60 Ga0070679_100529570 3300005530 Unclassified 1122
61 Ga0070684_100101496 3300005535 Bacteria 2571
62 Ga0070684_101694586 3300005535 Unclassified 596
63 Ga0070697_101641748 3300005536 Unclassified 575
64 Ga0068853_100422143 3300005539 Bacteria 1251
65 Ga0068853_100540625 3300005539 Bacteria 1103
66 Ga0068853_100985957 3300005539 Unclassified 811
67 Ga0068853_101191840 3300005539 Unclassified 735
68 Ga0070672_100090686 3300005543 Bacteria 2465
69 Ga0070672_102111521 3300005543 Bacteria 508
70 Ga0070686_100079462 3300005544 Bacteria 2168
71 Ga0070686_100692703 3300005544 Bacteria 812
72 Ga0070686_101159965 3300005544 Unclassified 640
73 Ga0070695_101660233 3300005545 Bacteria 534
74 Ga0070665_100002559 3300005548 Bacteria 19953
75 Ga0070665_100008936 3300005548 Bacteria 10152
76 Ga0070665_100010736 3300005548 Bacteria 9267
77 Ga0070665_100024440 3300005548 Bacteria 6085
78 Ga0070665_100040494 3300005548 Bacteria 4683
79 Ga0070665_100070065 3300005548 Bacteria 3513
80 Ga0070665_100086707 3300005548 Bacteria 3136
81 Ga0070665_101588282 3300005548 Bacteria 662
82 Ga0070704_100149064 3300005549 Bacteria 1837
83 Ga0068855_100040150 3300005563 Bacteria 5555
84 Ga0068855_101374487 3300005563 Bacteria 729
85 Ga0070664_101083840 3300005564 Bacteria 754
86 Ga0070664_101323648 3300005564 Bacteria 680
87 Ga0068854_101431880 3300005578 Bacteria 626
88 Ga0068856_100013367 3300005614 Bacteria 7948
89 Ga0068856_100176866 3300005614 Bacteria 2146
90 Ga0068856_101214785 3300005614 Bacteria 770
91 Ga0068856_101976917 3300005614 Unclassified 593
92 Ga0068852_100596332 3300005616 Unclassified 1109
93 Ga0068859_100000678 3300005617 Bacteria 34157
94 Ga0068859_100098122 3300005617 Bacteria 2984
95 Ga0068859_100164528 3300005617 Bacteria 2298
96 Ga0068859_100627590 3300005617 Bacteria 1167
97 Ga0068864_100680216 3300005618 Bacteria 1004
98 Ga0068864_102445873 3300005618 Unclassified 528
99 Ga0068866_10062828 3300005718 Bacteria 1933
100 Ga0068861_100142283 3300005719 Bacteria 1959
101 Ga0068861_102026954 3300005719 Bacteria 574
102 Ga0068861_102261033 3300005719 Unclassified 545
103 Ga0068851_10107302 3300005834 Bacteria 1488
104 Ga0068863_100008716 3300005841 Bacteria 9909
105 Ga0068863_100010041 3300005841 Bacteria 9214
106 Ga0068863_100021996 3300005841 Bacteria 6087
107 Ga0068858_100000883 3300005842 Bacteria 31125
108 Ga0068858_100009954 3300005842 Bacteria 9032
109 Ga0068858_100036153 3300005842 Bacteria 4579
110 Ga0068858_100043127 3300005842 Bacteria 4183
111 Ga0068858_101103390 3300005842 Bacteria 779
112 Ga0068860_100000219 3300005843 Bacteria 89810
113 Ga0068860_100005616 3300005843 Bacteria 12674
114 Ga0068860_100421305 3300005843 Bacteria 1323
115 Ga0068860_100715984 3300005843 Bacteria 1011
116 Ga0068860_101038223 3300005843 Bacteria 838
117 Ga0068862_100055012 3300005844 Bacteria 3408
118 Ga0068862_100164908 3300005844 Bacteria 1980
119 Ga0068862_100419253 3300005844 Bacteria 1256
120 Ga0068862_101098439 3300005844 Unclassified 790
121 Ga0068862_101198664 3300005844 Bacteria 758
122 Ga0081455_10000099 3300005937 Bacteria 95044
123 Ga0081455_10817956 3300005937 Unclassified 584
124 Ga0070715_10021975 3300006163 Bacteria 2482
125 Ga0070716_100003558 3300006173 Bacteria 7352
126 Ga0070716_100330381 3300006173 Bacteria 1072
127 Ga0070712_100015654 3300006175 Bacteria 4889
128 Ga0097621_100004470 3300006237 Bacteria 9744
129 Ga0097621_100024857 3300006237 Bacteria 4683
130 Ga0097621_100121046 3300006237 Bacteria 2220
131 Ga0097621_100308726 3300006237 Bacteria 1399
132 Ga0068871_100023292 3300006358 Bacteria 4787
133 Ga0068871_100106174 3300006358 Bacteria 2357
134 Ga0068871_100202719 3300006358 Bacteria 1713
135 Ga0068871_100903629 3300006358 Bacteria 818
136 Ga0075433_10167900 3300006852 Bacteria 1953
137 Ga0075434_100282153 3300006871 Bacteria 1680
138 Ga0068865_100153790 3300006881 Unclassified 1748
139 Ga0097620_100000678 3300006931 Bacteria 34157
140 Ga0097620_100098114 3300006931 Bacteria 2984
141 Ga0097620_100164529 3300006931 Bacteria 2298
142 Ga0097620_100627584 3300006931 Bacteria 1167
143 Ga0075435_100460270 3300007076 Bacteria 1097
144 Ga0099795_10462428 3300007788 Bacteria 586
145 Ga0105250_10075741 3300009092 Bacteria 1361
146 Ga0105250_10079885 3300009092 Bacteria 1325
147 Ga0105240_10001356 3300009093 Bacteria 42000
148 Ga0105240_10023495 3300009093 Bacteria 8150
149 Ga0105240_10189064 3300009093 Bacteria 2422
150 Ga0105240_10239291 3300009093 Bacteria 2105
151 Ga0105240_10321211 3300009093 Bacteria 1765
152 Ga0105240_10339404 3300009093 Bacteria 1707
153 Ga0105240_10495111 3300009093 Bacteria 1360
154 Ga0105240_11355794 3300009093 Bacteria 749
155 Ga0111539_10756849 3300009094 Bacteria 1131
156 Ga0105245_10050037 3300009098 Bacteria 3744
157 Ga0105245_10470108 3300009098 Bacteria 1269
158 Ga0105245_10525195 3300009098 Bacteria 1203
159 Ga0105247_10000203 3300009101 Bacteria 58331
160 Ga0105247_10042572 3300009101 Bacteria 2782
161 Ga0105247_10046160 3300009101 Bacteria 2673
162 Ga0105247_10386824 3300009101 Bacteria 993
163 Ga0105247_10632596 3300009101 Bacteria 797
164 Ga0105241_10049902 3300009174 Bacteria 3189
165 Ga0105241_10497114 3300009174 Bacteria 1087
166 Ga0105241_12431955 3300009174 Unclassified 523
167 Ga0105242_10013476 3300009176 Bacteria 6321
168 Ga0105248_10031391 3300009177 Bacteria 5939
169 Ga0105248_10088091 3300009177 Bacteria 3494
170 Ga0105248_10160591 3300009177 Bacteria 2535
171 Ga0105248_10597847 3300009177 Bacteria 1245
172 Ga0105237_10007703 3300009545 Bacteria 11765
173 Ga0105237_10089803 3300009545 Bacteria 3062
174 Ga0105237_10561381 3300009545 Bacteria 1148
175 Ga0105237_11006609 3300009545 Bacteria 840
176 Ga0105237_11874416 3300009545 Bacteria 607
177 Ga0105238_10171007 3300009551 Bacteria 2149
178 Ga0105238_10723344 3300009551 Bacteria 1008
179 Ga0105238_10880601 3300009551 Unclassified 913
180 Ga0105238_11623579 3300009551 Unclassified 677
181 Ga0105238_12563174 3300009551 Bacteria 546
182 Ga0105238_12871089 3300009551 Bacteria 518
183 Ga0105249_10016375 3300009553 Bacteria 6577
184 Ga0105249_10584628 3300009553 Bacteria 1170
185 Ga0105249_10667415 3300009553 Bacteria 1098
186 Ga0099796_10217655 3300010159 Unclassified 781
187 Ga0105239_10032675 3300010375 Bacteria 5718
188 Ga0105239_10206728 3300010375 Bacteria 2200
189 Ga0105239_10863095 3300010375 Bacteria 1038
190 Ga0105239_11284479 3300010375 Bacteria 844
191 Ga0105246_10243517 3300011119 Bacteria 1423
192 Ga0157370_10635554 3300013104 Bacteria 976
193 Ga0157369_10084621 3300013105 Bacteria 3390
194 Ga0157369_12104975 3300013105 Unclassified 572
195 Ga0157369_12129617 3300013105 Unclassified 569
196 Ga0157374_10045176 3300013296 Bacteria 4076
197 Ga0157374_11027545 3300013296 Bacteria 844
198 Ga0157374_11050679 3300013296 Bacteria 834
199 Ga0157378_10024530 3300013297 Bacteria 5308
200 Ga0157378_11848848 3300013297 Unclassified 652
201 Ga0163162_10189708 3300013306 Bacteria 2183
202 Ga0163162_10457985 3300013306 Unclassified 1407
203 Ga0163162_12785271 3300013306 Unclassified 563
204 Ga0157372_10236432 3300013307 Bacteria 2119
205 Ga0157372_10715177 3300013307 Bacteria 1165
206 Ga0157372_11142326 3300013307 Unclassified 901
207 Ga0157372_11359425 3300013307 Bacteria 819
208 Ga0157372_12395662 3300013307 Bacteria 606
209 Ga0157375_10372308 3300013308 Bacteria 1595
210 Ga0157375_10758139 3300013308 Bacteria 1121
211 Ga0157375_11805548 3300013308 Bacteria 725
212 Ga0163163_10091401 3300014325 Bacteria 3058
213 Ga0163163_10131400 3300014325 Bacteria 2544
214 Ga0163163_10163687 3300014325 Bacteria 2270
215 Ga0163163_10425814 3300014325 Bacteria 1386
216 Ga0163163_10465513 3300014325 Bacteria 1325
217 Ga0163163_11188948 3300014325 Bacteria 825
218 Ga0163163_11987814 3300014325 Bacteria 641
219 Ga0157377_10423800 3300014745 Bacteria 912
220 Ga0157379_10012507 3300014968 Bacteria 7412
221 Ga0157379_10016845 3300014968 Bacteria 6432
222 Ga0157379_10017199 3300014968 Bacteria 6370
223 Ga0157379_10100984 3300014968 Bacteria 2589
224 Ga0157379_10223710 3300014968 Bacteria 1705
225 Ga0157379_10246944 3300014968 Bacteria 1619
226 Ga0157379_10795481 3300014968 Bacteria 892
227 Ga0157376_10303902 3300014969 Bacteria 1511
228 Ga0157376_10318899 3300014969 Bacteria 1477
229 Ga0157376_10365103 3300014969 Bacteria 1386
230 Ga0157376_10696997 3300014969 Bacteria 1020
231 Ga0157376_11211606 3300014969 Unclassified 783
232 Ga0163161_11215168 3300017792 Bacteria 652
233 Ga0206355_1042601 3300020076 Bacteria 595
234 Ga0213873_10109683 3300021358 Bacteria 801
235 Ga0213874_10030507 3300021377 Bacteria 1554
236 Ga0213874_10240183 3300021377 Bacteria 664
237 Ga0213876_10554434 3300021384 Bacteria 611
238 Ga0213871_10225660 3300021441 Unclassified 590
239 Ga0207656_10704539 3300025321 Unclassified 517
240 Ga0207696_1062930 3300025711 Bacteria 1041
241 Ga0207692_10006226 3300025898 Bacteria 4833
242 Ga0207642_10115749 3300025899 Bacteria 1373
243 Ga0207710_10001184 3300025900 Bacteria 13248
244 Ga0207710_10083881 3300025900 Bacteria 1482
245 Ga0207710_10509338 3300025900 Bacteria 625
246 Ga0207680_10003207 3300025903 Bacteria 7693
247 Ga0207680_10043669 3300025903 Bacteria 2630
248 Ga0207680_10312488 3300025903 Bacteria 1097
249 Ga0207680_10453115 3300025903 Bacteria 911
250 Ga0207680_10514380 3300025903 Bacteria 853
251 Ga0207685_10060520 3300025905 Bacteria 1498
252 Ga0207699_10461261 3300025906 Bacteria 913
253 Ga0207654_10185792 3300025911 Bacteria 1359
254 Ga0207654_10218303 3300025911 Bacteria 1263
255 Ga0207654_10952646 3300025911 Bacteria 623
256 Ga0207707_10097373 3300025912 Bacteria 2571
257 Ga0207707_10151829 3300025912 Bacteria 2025
258 Ga0207695_10046811 3300025913 Bacteria 4582
259 Ga0207695_10060190 3300025913 Bacteria 3932
260 Ga0207695_10095930 3300025913 Bacteria 2968
261 Ga0207695_10111762 3300025913 Bacteria 2711
262 Ga0207695_10174093 3300025913 Bacteria 2075
263 Ga0207695_10340605 3300025913 Bacteria 1387
264 Ga0207695_10906607 3300025913 Bacteria 761
265 Ga0207671_10034317 3300025914 Bacteria 3770
266 Ga0207671_10102705 3300025914 Bacteria 2167
267 Ga0207671_10474863 3300025914 Unclassified 997
268 Ga0207671_11548776 3300025914 Unclassified 511
269 Ga0207693_10000059 3300025915 Bacteria 94053
270 Ga0207693_10389692 3300025915 Bacteria 1089
271 Ga0207663_10732896 3300025916 Bacteria 784
272 Ga0207660_10059686 3300025917 Bacteria 2739
273 Ga0207660_10810059 3300025917 Bacteria 764
274 Ga0207649_10744496 3300025920 Bacteria 762
275 Ga0207652_10412951 3300025921 Bacteria 1217
276 Ga0207652_10605666 3300025921 Bacteria 982
277 Ga0207646_10791082 3300025922 Bacteria 845
278 Ga0207694_10130279 3300025924 Bacteria 2016
279 Ga0207694_11167447 3300025924 Bacteria 652
280 Ga0207694_11281004 3300025924 Bacteria 620
281 Ga0207650_10265168 3300025925 Bacteria 1394
282 Ga0207650_10318400 3300025925 Bacteria 1273
283 Ga0207659_10271480 3300025926 Bacteria 1383
284 Ga0207687_10759345 3300025927 Bacteria 825
285 Ga0207700_10195282 3300025928 Bacteria 1703
286 Ga0207700_10590807 3300025928 Bacteria 988
287 Ga0207700_10802641 3300025928 Unclassified 842
288 Ga0207644_10000592 3300025931 Bacteria 23118
289 Ga0207644_10265476 3300025931 Bacteria 1374
290 Ga0207644_10575060 3300025931 Bacteria 934
291 Ga0207644_11649503 3300025931 Bacteria 537
292 Ga0207706_11164072 3300025933 Bacteria 642
293 Ga0207670_10901166 3300025936 Bacteria 741
294 Ga0207669_10225528 3300025937 Bacteria 1378
295 Ga0207669_11386366 3300025937 Bacteria 598
296 Ga0207704_10026938 3300025938 Bacteria 3161
297 Ga0207665_10038935 3300025939 Bacteria 3167
298 Ga0207665_10145243 3300025939 Bacteria 1695
299 Ga0207691_10048222 3300025940 Bacteria 3906
300 Ga0207711_10123310 3300025941 Bacteria 2315
301 Ga0207711_10669002 3300025941 Bacteria 968
302 Ga0207711_10824062 3300025941 Bacteria 864
303 Ga0207689_11038604 3300025942 Bacteria 691
304 Ga0207689_11046245 3300025942 Bacteria 688
305 Ga0207689_11189946 3300025942 Bacteria 642
306 Ga0207661_10164983 3300025944 Bacteria 1924
307 Ga0207679_10177039 3300025945 Bacteria 1761
308 Ga0207667_10001105 3300025949 Bacteria 34029
309 Ga0207667_10572791 3300025949 Bacteria 1140
310 Ga0207667_11393112 3300025949 Bacteria 675
311 Ga0207651_10024886 3300025960 Bacteria 3712
312 Ga0207712_10409177 3300025961 Bacteria 1142
313 Ga0207712_10503001 3300025961 Bacteria 1036
314 Ga0207712_11688716 3300025961 Unclassified 568
315 Ga0207668_10339954 3300025972 Bacteria 1252
316 Ga0207668_11194898 3300025972 Bacteria 683
317 Ga0207640_10323677 3300025981 Bacteria 1228
318 Ga0207640_11126817 3300025981 Unclassified 695
319 Ga0207658_10000894 3300025986 Bacteria 24824
320 Ga0207658_10014994 3300025986 Bacteria 5314
321 Ga0207658_10120982 3300025986 Bacteria 2087
322 Ga0207658_10625404 3300025986 Bacteria 969
323 Ga0207658_11057533 3300025986 Unclassified 741
324 Ga0207677_10049648 3300026023 Bacteria 2833
325 Ga0207677_11902805 3300026023 Bacteria 553
326 Ga0207703_10000240 3300026035 Bacteria 62235
327 Ga0207703_10000452 3300026035 Bacteria 43202
328 Ga0207703_10053058 3300026035 Bacteria 3295
329 Ga0207639_10427196 3300026041 Bacteria 1199
330 Ga0207639_10778002 3300026041 Bacteria 891
331 Ga0207639_11079600 3300026041 Unclassified 753
332 Ga0207678_10125188 3300026067 Bacteria 2193
333 Ga0207708_10076431 3300026075 Bacteria 2569
334 Ga0207702_10017148 3300026078 Bacteria 5991
335 Ga0207702_10143931 3300026078 Bacteria 2161
336 Ga0207702_10336822 3300026078 Bacteria 1440
337 Ga0207702_11128173 3300026078 Bacteria 778
338 Ga0207641_10001841 3300026088 Bacteria 20375
339 Ga0207641_10011577 3300026088 Bacteria 7240
340 Ga0207641_10067499 3300026088 Bacteria 3064
341 Ga0207641_12248340 3300026088 Bacteria 545
342 Ga0207648_10077981 3300026089 Bacteria 2889
343 Ga0207674_11910952 3300026116 Bacteria 559
344 Ga0207675_100868044 3300026118 Bacteria 918
345 Ga0207683_10002696 3300026121 Bacteria 15516
346 Ga0207698_10576753 3300026142 Bacteria 1106
347 Ga0268266_10003601 3300028379 Bacteria 15324
348 Ga0268266_10005167 3300028379 Bacteria 12298
349 Ga0268266_10040859 3300028379 Bacteria 3954
350 Ga0268266_10076854 3300028379 Bacteria 2902
351 Ga0268266_10138618 3300028379 Bacteria 2181
352 Ga0268266_10679745 3300028379 Bacteria 991
353 Ga0268265_10041087 3300028380 Bacteria 3419
354 Ga0268265_10240172 3300028380 Bacteria 1598
355 Ga0268265_12036563 3300028380 Unclassified 581
356 Ga0268264_10000057 3300028381 Bacteria 309824
357 Ga0268264_10000165 3300028381 Bacteria 147648
358 Ga0268264_10000348 3300028381 Bacteria 70273
359 Ga0268264_10012865 3300028381 Bacteria 6884
360 Ga0268264_10233977 3300028381 Bacteria 1698
361 Ga0268264_10746159 3300028381 Unclassified 975
362 Ga0265334_10028716 3300028573 Bacteria 2232
363 Ga0265334_10098860 3300028573 Bacteria 1058
364 Ga0307511_10002306 3300030521 Bacteria 19914
365 Ga0307511_10041820 3300030521 Bacteria 3862
366 Ga0265340_10032635 3300031247 Bacteria 2598
367 Ga0265331_10032094 3300031250 Bacteria 2605
368 Ga0307509_10000013 3300031507 Bacteria 283027
369 Ga0307509_10871040 3300031507 Bacteria 565
370 Ga0307508_10140598 3300031616 Bacteria 2018
371 Ga0307508_10632522 3300031616 Bacteria 674
372 Ga0316575_10017822 3300031665 Bacteria 2701
373 Ga0316575_10021587 3300031665 Bacteria 2479
374 Ga0316575_10111643 3300031665 Bacteria 1115
375 Ga0316579_10005920 3300031691 Bacteria 4961
376 Ga0316579_10008384 3300031691 Bacteria 4305
377 Ga0316579_10050152 3300031691 Bacteria 1951
378 Ga0316579_10082808 3300031691 Unclassified 1529
379 Ga0316579_10098451 3300031691 Bacteria 1399
380 Ga0316579_10218679 3300031691 Bacteria 921
381 Ga0316576_10100179 3300031727 Bacteria 2165
382 Ga0316576_10160286 3300031727 Bacteria 1697
383 Ga0316576_10250909 3300031727 Bacteria 1328
384 Ga0316578_10041367 3300031728 Bacteria 2668
385 Ga0316578_10080689 3300031728 Bacteria 1935
386 Ga0316578_10099538 3300031728 Bacteria 1742
387 Ga0316578_10145085 3300031728 Bacteria 1429
388 Ga0316578_10204655 3300031728 Bacteria 1188
389 Ga0316578_10365922 3300031728 Bacteria 857
390 Ga0316578_10549712 3300031728 Bacteria 678
391 Ga0316577_10001405 3300031733 Bacteria 11351
392 Ga0316577_10026726 3300031733 Bacteria 3215
393 Ga0316577_10138905 3300031733 Bacteria 1369
394 Ga0316577_10192852 3300031733 Bacteria 1151
395 Ga0316577_10196743 3300031733 Bacteria 1139
396 Ga0307413_10102650 3300031824 Bacteria 1894
397 Ga0307410_10090070 3300031852 Bacteria 2175
398 Ga0307406_10447227 3300031901 Bacteria 1036
399 Ga0307407_10599162 3300031903 Bacteria 820
400 Ga0307409_102417313 3300031995 Bacteria 554
401 Ga0307416_100423801 3300032002 Bacteria 1376
402 Ga0307416_101745159 3300032002 Bacteria 727
403 Ga0307415_100712823 3300032126 Bacteria 907
404 Ga0316583_10016952 3300032133 Bacteria 2621
405 Ga0316583_10051495 3300032133 Bacteria 1449
406 Ga0316585_10000973 3300032137 Bacteria 7373
407 Ga0316585_10006144 3300032137 Bacteria 3425
408 Ga0316585_10101161 3300032137 Bacteria 946
409 Ga0316585_10107363 3300032137 Bacteria 917
410 Ga0316585_10213930 3300032137 Bacteria 637
411 Ga0316580_10013421 3300032139 Bacteria 2497
412 Ga0316580_10031453 3300032139 Bacteria 1643
413 Ga0316580_10148122 3300032139 Bacteria 720
414 Ga0316580_10157745 3300032139 Bacteria 696
415 Ga0316593_10000955 3300032168 Bacteria 5955
416 Ga0316593_10001178 3300032168 Bacteria 5584
417 Ga0316593_10017341 3300032168 Bacteria 2195
418 Ga0316593_10022900 3300032168 Bacteria 1967
419 Ga0316593_10034964 3300032168 Bacteria 1651
420 Ga0316593_10041701 3300032168 Unclassified 1528
421 Ga0316593_10072545 3300032168 Bacteria 1192
422 Ga0316593_10102287 3300032168 Bacteria 1017
423 Ga0316593_10121351 3300032168 Bacteria 939
424 Ga0307510_10000014 3300033180 Bacteria 271607
425 Ga0307510_10018637 3300033180 Bacteria 8162
426 Ga0316592_1003740 3300033524 Bacteria 2774
427 Ga0316592_1007630 3300033524 Bacteria 2117
428 Ga0316592_1022157 3300033524 Bacteria 1357
429 Ga0316592_1056177 3300033524 Bacteria 881
430 Ga0316586_1116740 3300033527 Bacteria 518
431 Ga0316588_1005213 3300033528 Bacteria 2516
432 Ga0316587_1073082 3300033529 Bacteria 643
433 Ga0316596_1000692 3300033541 Bacteria 6111
434 Ga0316596_1001197 3300033541 Bacteria 5115
435 Ga0316596_1004608 3300033541 Bacteria 3105
436 Ga0316596_1026790 3300033541 Bacteria 1487
437 Ga0373923_0337805 3300035111 Bacteria 718
438 Ga0373936_0026146 3300035113 Bacteria 2285
439 Ga0373936_0035004 3300035113 Bacteria 1998
440 Ga0373954_0236442 3300035118 Bacteria 899
441 Ga0373956_0488790 3300035119 Unclassified 587
442 Ga0373957_0146999 3300035120 Bacteria 966
443 Ga0373943_0240575 3300035170 Bacteria 1014
444 Ga0373946_0157842 3300035171 Bacteria 1063
445 Ga0373955_0835751 3300035172 Unclassified 566
446 Ga0316574_0004138 3300035398 Bacteria 7553
447 Ga0316574_0009902 3300035398 Bacteria 5359
448 Ga0316574_0020819 3300035398 Bacteria 3886
449 Ga0316574_0022040 3300035398 Bacteria 3790
450 Ga0316574_0047336 3300035398 Bacteria 2669
451 Ga0316574_0118480 3300035398 Bacteria 1699
452 Ga0316574_0235019 3300035398 Bacteria 1172
453 Ga0316574_0334773 3300035398 Bacteria 959
454 Ga0316574_0372927 3300035398 Bacteria 901
455 Ga0316574_0589677 3300035398 Bacteria 687
456 Ga0373924_0223682 3300035410 Bacteria 832
457 Ga0373935_0243955 3300035692 Bacteria 1255
458 Ga0373927_0017103 3300035695 Bacteria 4778
459 Ga0373927_0226581 3300035695 Unclassified 1228
460 Ga0373927_0669293 3300035695 Bacteria 686
461 Ga0373947_0286738 3300035725 Bacteria 1095
462 Ga0373937_0050902 3300036401 Bacteria 3796
463 Ga0373937_0083653 3300036401 Bacteria 2952
464 Ga0373937_0772324 3300036401 Bacteria 908
465 Ga0316582_0003729 3300036647 Bacteria 7546
466 Ga0316582_0008774 3300036647 Bacteria 5449
467 Ga0316582_0059179 3300036647 Bacteria 2452
468 Ga0316582_0224670 3300036647 Bacteria 1284
469 Ga0316582_0270983 3300036647 Bacteria 1165
470 Ga0316582_0613519 3300036647 Bacteria 748
471 Ga0316582_0900379 3300036647 Bacteria 605
472 Ga0316582_1155314 3300036647 Bacteria 527
473 Ga0316584_0001707 3300036712 Bacteria 13452
474 Ga0316584_0011330 3300036712 Bacteria 6262
475 Ga0316584_0027841 3300036712 Bacteria 4161
476 Ga0316584_0035063 3300036712 Bacteria 3722
477 Ga0316584_0044664 3300036712 Bacteria 3305
478 Ga0316584_0049516 3300036712 Bacteria 3140
479 Ga0316584_0058973 3300036712 Bacteria 2874
480 Ga0316584_0122287 3300036712 Bacteria 1944
481 Ga0316584_0128540 3300036712 Bacteria 1892
482 Ga0316584_0144998 3300036712 Bacteria 1769
483 Ga0316584_0481313 3300036712 Bacteria 874
484 Ga0316584_1076277 3300036712 Bacteria 534
485 Ga0373925_0016431 3300037068 Bacteria 5361
486 Ga0395900_1215165 3300037418 Bacteria 669
487 Ga0395898_0080504 3300037466 Bacteria 3141
488 Ga0316581_0049519 3300037588 Bacteria 1286
489 Ga0316581_0065766 3300037588 Bacteria 1113
490 Ga0436364_0588184 3300037853 Bacteria 1037
491 Ga0436364_1379834 3300037853 Unclassified 855
492 Ga0400484_12302 3300038725 Bacteria 1494
493 Ga0400484_34918 3300038725 Bacteria 1454
494 Ga0400484_45045 3300038725 Bacteria 1691
495 Ga0400490_00200 3300038726 Bacteria 2381
496 Ga0400490_32212 3300038726 Bacteria 7793
497 Ga0400491_02403 3300038727 Bacteria 2120
498 Ga0400491_25561 3300038727 Bacteria 1440
499 Ga0400485_17963 3300038735 Bacteria 81058
500 Ga0400488_23317 3300038741 Bacteria 2679
501 Ga0400488_46779 3300038741 Bacteria 1140
502 Ga0400488_51768 3300038741 Bacteria 1470
503 Ga0400488_58945 3300038741 Bacteria 7566
504 Ga0400486_11595 3300038742 Bacteria 54196
505 Ga0400483_013566 3300039062 Unclassified 2224
506 Ga0400483_023540 3300039062 Unclassified 1072
507 Ga0400483_048680 3300039062 Bacteria 1894
508 Ga0400483_090575 3300039062 Bacteria 2434
509 Ga0400483_138542 3300039062 Bacteria 1262
510 Ga0400483_185887 3300039062 Bacteria 1977
511 Ga0400483_186508 3300039062 Bacteria 4065
512 Ga0400483_213137 3300039062 Bacteria 3297
513 Ga0400483_243431 3300039062 Bacteria 9829
514 Ga0400483_243994 3300039062 Bacteria 1160
515 Ga0400483_260246 3300039062 Bacteria 5452
516 Ga0400483_261700 3300039062 Bacteria 1831
517 Ga0400487_34210 3300039110 Bacteria 84195
518 Ga0400487_38419 3300039110 Bacteria 48743
519 Ga0400487_61406 3300039110 Bacteria 7558
520 Ga0436365_0263164 3300039437 Bacteria 14642
521 Ga0436365_0904710 3300039437 Bacteria 4442
522 Ga0436365_1044761 3300039437 Unclassified 882
523 Ga0436365_1168590 3300039437 Bacteria 2825
524 Ga0436360_0429355 3300039438 Bacteria 542
525 Ga0436360_0730563 3300039438 Bacteria 2830
526 Ga0436360_0816060 3300039438 Bacteria 1254
527 Ga0436361_0804800 3300039447 Bacteria 1009
528 Ga0436363_0301580 3300039450 Bacteria 2078
529 Ga0436363_0554731 3300039450 Bacteria 1463
530 Ga0436363_1521750 3300039450 Unclassified 580
531 Ga0436363_1682150 3300039450 Bacteria 1833
532 Ga0436362_0939706 3300039453 Unclassified 503
533 Ga0436362_1122341 3300039453 Bacteria 2839
534 Ga0451793_1751232 3300041452 Bacteria 536
535 Ga0451798_0350512 3300041458 Bacteria 612
536 Ga0451841_0377057 3300041498 Archaea 528
537 Ga0466969_0003955 3300044656 Bacteria 7869
538 Ga0466969_0017111 3300044656 Bacteria 3789
539 Ga0466972_0059977 3300044658 Bacteria 1826
540 Ga0466972_0381314 3300044658 Bacteria 660
541 Ga0466966_0006076 3300044684 Bacteria 7975
542 Ga0466966_0029812 3300044684 Bacteria 3547
543 Ga0466966_0151763 3300044684 Bacteria 1413
544 Ga0466961_0010904 3300044693 Bacteria 5804
545 Ga0466963_0444923 3300044694 Bacteria 914
546 Ga0466964_0000124 3300044706 Bacteria 20126
547 Ga0466964_0309065 3300044706 Bacteria 799
548 Ga0466971_0007117 3300044719 Bacteria 4868
549 Ga0466968_0052720 3300044735 Bacteria 1741
550 Ga0466970_0004208 3300044765 Bacteria 7083
551 Ga0466970_0318469 3300044765 Unclassified 879
552 Ga0466957_0100099 3300044842 Bacteria 1826
553 Ga0466959_0024867 3300045049 Bacteria 4435
554 Ga0466959_0031743 3300045049 Bacteria 3909
555 Ga0466959_0052664 3300045049 Bacteria 2980
556 Ga0466959_0056096 3300045049 Bacteria 2875
557 Ga0466959_0081283 3300045049 Bacteria 2335
558 Ga0466959_0145026 3300045049 Bacteria 1676
559 Ga0466959_0442529 3300045049 Bacteria 881
560 Ga0495629_0649937 3300046459 Bacteria 703
561 Ga0495580_0009152 3300046472 Bacteria 7808
562 Ga0495580_0095023 3300046472 Bacteria 2073
563 Ga0495582_0123823 3300046473 Bacteria 1458
564 Ga0495639_0176234 3300046475 Bacteria 1040
565 Ga0495583_0297903 3300046506 Bacteria 641
566 Ga0495606_0245849 3300046507 Bacteria 995
567 Ga0495618_0098486 3300046514 Bacteria 1871
568 Ga0495628_0332638 3300046516 Bacteria 1119
569 Ga0495630_0124726 3300046517 Bacteria 1954
570 Ga0495632_0269263 3300046519 Bacteria 760
571 Ga0495648_0161112 3300046524 Bacteria 1160
572 Ga0495652_0868328 3300046529 Bacteria 597
573 Ga0495586_0056108 3300046535 Bacteria 2136
574 Ga0495645_0489581 3300046543 Bacteria 770
575 Ga0495667_0736482 3300046559 Bacteria 610
576 Ga0495634_0461278 3300046642 Bacteria 748
577 Ga0495625_0289802 3300046660 Bacteria 1051
578 Ga0495657_0151089 3300046675 Bacteria 1442
579 Ga0495599_0156677 3300046678 Bacteria 1409
580 Ga0495647_0521293 3300046681 Unclassified 554
581 Ga0495647_0563945 3300046681 Bacteria 533
582 Ga0495669_0231065 3300046684 Bacteria 887
583 Ga0495671_0099963 3300046692 Bacteria 1418
584 Ga0495649_0309001 3300046694 Bacteria 804
585 Ga0495649_0658215 3300046694 Bacteria 515
586 Ga0495581_0198078 3300047315 Bacteria 1175
587 Ga0495674_0458007 3300047319 Bacteria 1024
588 Ga0495674_1311427 3300047319 Bacteria 543
589 Ga0495687_173995 3300047443 Unclassified 710
590 Ga0495593_0572642 3300047673 Bacteria 567
591 Ga0496100_0020875 3300048903 Bacteria 3935
592 Ga0496100_0150843 3300048903 Bacteria 1658
593 Ga0496100_0870555 3300048903 Unclassified 707
594 Ga0496101_0006883 3300048904 Bacteria 7339
595 Ga0496102_0003596 3300048905 Bacteria 13131
596 Ga0496102_0073109 3300048905 Bacteria 3151
597 Ga0496103_0059554 3300048906 Bacteria 2372
598 Ga0496103_0896423 3300048906 Bacteria 556
599 Ga0496104_0554645 3300048907 Bacteria 1060
600 Ga0496104_0925477 3300048907 Bacteria 776
601 Ga0496105_0026074 3300048908 Bacteria 4763
602 Ga0496106_0015853 3300048909 Bacteria 5574
603 Ga0496106_0020229 3300048909 Bacteria 4938
604 Ga0496107_0038331 3300048910 Bacteria 3439
605 Ga0496107_0140170 3300048910 Bacteria 1787
606 Ga0496108_0059978 3300048911 Bacteria 3200
607 Ga0496108_1148455 3300048911 Bacteria 658
608 Ga0496109_0193258 3300048912 Bacteria 1912
609 Ga0496109_1693278 3300048912 Bacteria 566
610 Ga0496110_0033004 3300048913 Bacteria 4475
611 Ga0496110_1715507 3300048913 Unclassified 538
612 Ga0496111_0021195 3300048914 Bacteria 4534
613 Ga0496112_0012694 3300048915 Bacteria 7748
614 Ga0496112_0018039 3300048915 Bacteria 6642
615 Ga0496112_1623583 3300048915 Unclassified 560
616 Ga0496113_0062393 3300048916 Bacteria 2814
617 Ga0496114_0011760 3300048917 Bacteria 7002
618 Ga0496114_0254998 3300048917 Bacteria 1544
619 Ga0496115_0020179 3300048918 Bacteria 5137
620 Ga0496115_0510335 3300048918 Unclassified 965
621 Ga0496115_1347763 3300048918 Unclassified 529
622 Ga0496116_0020507 3300048919 Bacteria 5017
623 Ga0496117_0000228 3300048920 Bacteria 106070
624 Ga0496118_0000005 3300048921 Bacteria 697350
625 Ga0496118_0160773 3300048921 Bacteria 1389
626 Ga0496118_0210527 3300048921 Bacteria 1141
627 Ga0496119_0002586 3300048922 Bacteria 19668
628 Ga0496119_0086023 3300048922 Bacteria 1798
629 Ga0496119_0325453 3300048922 Bacteria 751
630 Ga0496120_0007880 3300048923 Bacteria 7847
631 Ga0496120_0044839 3300048923 Bacteria 2566
632 Ga0496120_0351099 3300048923 Unclassified 662
633 Ga0496121_0000522 3300048924 Bacteria 73298
634 Ga0496121_0058385 3300048924 Bacteria 3190
635 Ga0496124_0036580 3300048927 Bacteria 4280
636 Ga0496124_0419876 3300048927 Unclassified 922
637 Ga0496125_0001732 3300048928 Bacteria 30347
638 Ga0496125_0005091 3300048928 Bacteria 14801
639 Ga0496125_0016278 3300048928 Bacteria 7146
640 Ga0496125_0392582 3300048928 Bacteria 814
641 Ga0496125_0490352 3300048928 Bacteria 694
642 Ga0496125_0587276 3300048928 Unclassified 610
643 Ga0496126_0003793 3300048929 Bacteria 18765
644 Ga0496126_0789906 3300048929 Bacteria 729
645 Ga0496126_0863644 3300048929 Unclassified 689
646 Ga0496126_1113787 3300048929 Bacteria 585
647 Ga0495682_0137718 3300049460 Unclassified 872
648 Ga0501046_0274317 3300049580 Bacteria 1236
649 Ga0501047_0621590 3300049581 Bacteria 901
650 Ga0501080_1488090 3300049742 Unclassified 576
651 Ga0501083_0306550 3300049744 Bacteria 1033
652 nmdc:mga0n895_95877_c1 3300050512 Bacteria 2972
653 nmdc:mga0rr50_1070697_c1 3300050513 Bacteria 686
654 nmdc:mga08x19_51889_c1 3300050514 Bacteria 2636
655 nmdc:mga0a205_446465_c1 3300050515 Bacteria 1154
656 Ga0500583_0009679 3300053092 Bacteria 3537
657 Ga0500558_130512 3300053106 Bacteria 961
658 Ga0500572_057286 3300053111 Unclassified 1176
659 Ga0500572_145187 3300053111 Bacteria 774
660 Ga0500591_082051 3300053115 Bacteria 1430
661 Ga0500559_0246603 3300053136 Bacteria 842
662 Ga0500590_042673 3300053148 Bacteria 2328
663 Ga0500636_0429238 3300053177 Unclassified 604
664 Ga0500637_0000233 3300053178 Bacteria 20689
665 Ga0500637_0011052 3300053178 Bacteria 4648
666 Ga0500637_0185036 3300053178 Unclassified 1192
667 Ga0500637_0283455 3300053178 Bacteria 911
668 Ga0500637_0450416 3300053178 Bacteria 653
669 Ga0466962_0000297 3300061719 Bacteria 21249
670 Ga0070666_10018074
671 rootL2_10186149
672 Ga0065707_10600472
673 Ga0070670_100512914
674 Ga0070670_101769990
675 Ga0068869_100594289
676 Ga0068869_100996414
677 Ga0068869_101107467
678 Ga0070666_10002425
679 Ga0070666_10015077
680 Ga0070666_10084481
681 Ga0070680_100066633
682 Ga0070680_100079851
683 Ga0070682_101694291
684 Ga0068868_100101065
685 Ga0068868_100407613
686 Ga0070689_101192421
687 Ga0070691_10706713
688 Ga0070668_100328025
689 Ga0070675_100202646
690 Ga0070671_100002320
691 Ga0070671_100010336
692 Ga0070671_100367522
693 Ga0070671_101990448
694 Ga0070674_100092755
695 Ga0070674_101216818
696 Ga0070674_101448888
697 Ga0070673_100022554
698 Ga0070688_101600951
699 Ga0070667_100000225
700 Ga0070667_100027724
701 Ga0070667_100030133
702 Ga0070667_100049394
703 Ga0070667_100651983
704 Ga0070667_101078615
705 Ga0070667_101102276
706 Ga0070709_10027520
707 Ga0070714_101414177
708 Ga0070713_100001336
709 Ga0070713_100023726
710 Ga0070713_100283721
711 Ga0070713_101453616
712 Ga0070711_100003408
713 Ga0070705_100550828
714 Ga0070700_100185997
715 Ga0070694_100256359
716 Ga0070663_100536078
717 Ga0070663_101161032
718 Ga0070678_100064700
719 Ga0070678_101104191
720 Ga0070662_100384248
721 Ga0070662_100896388
722 Ga0070681_10588097
723 Ga0070681_10958529
724 Ga0070685_10254408
725 Ga0070685_10970100
726 Ga0070707_101326552
727 Ga0070679_100023458
728 Ga0070679_100102733
729 Ga0070679_100529570
730 Ga0070684_100101496
731 Ga0070684_101694586
732 Ga0070697_101641748
733 Ga0068853_100422143
734 Ga0068853_100540625
735 Ga0068853_100985957
736 Ga0068853_101191840
737 Ga0070672_100090686
738 Ga0070672_102111521
739 Ga0070686_100079462
740 Ga0070686_100692703
741 Ga0070686_101159965
742 Ga0070695_101660233
743 Ga0070665_100002559
744 Ga0070665_100008936
745 Ga0070665_100010736
746 Ga0070665_100024440
747 Ga0070665_100040494
748 Ga0070665_100070065
749 Ga0070665_100086707
750 Ga0070665_101588282
751 Ga0070704_100149064
752 Ga0068855_100040150
753 Ga0068855_101374487
754 Ga0070664_101083840
755 Ga0070664_101323648
756 Ga0068854_101431880
757 Ga0068856_100013367
758 Ga0068856_100176866
759 Ga0068856_101214785
760 Ga0068856_101976917
761 Ga0068852_100596332
762 Ga0068859_100000678
763 Ga0068859_100098122
764 Ga0068859_100164528
765 Ga0068859_100627590
766 Ga0068864_100680216
767 Ga0068864_102445873
768 Ga0068866_10062828
769 Ga0068861_100142283
770 Ga0068861_102026954
771 Ga0068861_102261033
772 Ga0068851_10107302
773 Ga0068863_100008716
774 Ga0068863_100010041
775 Ga0068863_100021996
776 Ga0068858_100000883
777 Ga0068858_100009954
778 Ga0068858_100036153
779 Ga0068858_100043127
780 Ga0068858_101103390
781 Ga0068860_100000219
782 Ga0068860_100005616
783 Ga0068860_100421305
784 Ga0068860_100715984
785 Ga0068860_101038223
786 Ga0068862_100055012
787 Ga0068862_100164908
788 Ga0068862_100419253
789 Ga0068862_101098439
790 Ga0068862_101198664
791 Ga0081455_10000099
792 Ga0081455_10817956
793 Ga0070715_10021975
794 Ga0070716_100003558
795 Ga0070716_100330381
796 Ga0070712_100015654
797 Ga0097621_100004470
798 Ga0097621_100024857
799 Ga0097621_100121046
800 Ga0097621_100308726
801 Ga0068871_100023292
802 Ga0068871_100106174
803 Ga0068871_100202719
804 Ga0068871_100903629
805 Ga0075433_10167900
806 Ga0075434_100282153
807 Ga0068865_100153790
808 Ga0097620_100000678
809 Ga0097620_100098114
810 Ga0097620_100164529
811 Ga0097620_100627584
812 Ga0075435_100460270
813 Ga0099795_10462428
814 Ga0105250_10075741
815 Ga0105250_10079885
816 Ga0105240_10001356
817 Ga0105240_10023495
818 Ga0105240_10189064
819 Ga0105240_10239291
820 Ga0105240_10321211
821 Ga0105240_10339404
822 Ga0105240_10495111
823 Ga0105240_11355794
824 Ga0111539_10756849
825 Ga0105245_10050037
826 Ga0105245_10470108
827 Ga0105245_10525195
828 Ga0105247_10000203
829 Ga0105247_10042572
830 Ga0105247_10046160
831 Ga0105247_10386824
832 Ga0105247_10632596
833 Ga0105241_10049902
834 Ga0105241_10497114
835 Ga0105241_12431955
836 Ga0105242_10013476
837 Ga0105248_10031391
838 Ga0105248_10088091
839 Ga0105248_10160591
840 Ga0105248_10597847
841 Ga0105237_10007703
842 Ga0105237_10089803
843 Ga0105237_10561381
844 Ga0105237_11006609
845 Ga0105237_11874416
846 Ga0105238_10171007
847 Ga0105238_10723344
848 Ga0105238_10880601
849 Ga0105238_11623579
850 Ga0105238_12563174
851 Ga0105238_12871089
852 Ga0105249_10016375
853 Ga0105249_10584628
854 Ga0105249_10667415
855 Ga0099796_10217655
856 Ga0105239_10032675
857 Ga0105239_10206728
858 Ga0105239_10863095
859 Ga0105239_11284479
860 Ga0105246_10243517
861 Ga0157370_10635554
862 Ga0157369_10084621
863 Ga0157369_12104975
864 Ga0157369_12129617
865 Ga0157374_10045176
866 Ga0157374_11027545
867 Ga0157374_11050679
868 Ga0157378_10024530
869 Ga0157378_11848848
870 Ga0163162_10189708
871 Ga0163162_10457985
872 Ga0163162_12785271
873 Ga0157372_10236432
874 Ga0157372_10715177
875 Ga0157372_11142326
876 Ga0157372_11359425
877 Ga0157372_12395662
878 Ga0157375_10372308
879 Ga0157375_10758139
880 Ga0157375_11805548
881 Ga0163163_10091401
882 Ga0163163_10131400
883 Ga0163163_10163687
884 Ga0163163_10425814
885 Ga0163163_10465513
886 Ga0163163_11188948
887 Ga0163163_11987814
888 Ga0157377_10423800
889 Ga0157379_10012507
890 Ga0157379_10016845
891 Ga0157379_10017199
892 Ga0157379_10100984
893 Ga0157379_10223710
894 Ga0157379_10246944
895 Ga0157379_10795481
896 Ga0157376_10303902
897 Ga0157376_10318899
898 Ga0157376_10365103
899 Ga0157376_10696997
900 Ga0157376_11211606
901 Ga0163161_11215168
902 Ga0206355_1042601
903 Ga0213873_10109683
904 Ga0213874_10030507
905 Ga0213874_10240183
906 Ga0213876_10554434
907 Ga0213871_10225660
908 Ga0207656_10704539
909 Ga0207696_1062930
910 Ga0207692_10006226
911 Ga0207642_10115749
912 Ga0207710_10001184
913 Ga0207710_10083881
914 Ga0207710_10509338
915 Ga0207680_10003207
916 Ga0207680_10043669
917 Ga0207680_10312488
918 Ga0207680_10453115
919 Ga0207680_10514380
920 Ga0207685_10060520
921 Ga0207699_10461261
922 Ga0207654_10185792
923 Ga0207654_10218303
924 Ga0207654_10952646
925 Ga0207707_10097373
926 Ga0207707_10151829
927 Ga0207695_10046811
928 Ga0207695_10060190
929 Ga0207695_10095930
930 Ga0207695_10111762
931 Ga0207695_10174093
932 Ga0207695_10340605
933 Ga0207695_10906607
934 Ga0207671_10034317
935 Ga0207671_10102705
936 Ga0207671_10474863
937 Ga0207671_11548776
938 Ga0207693_10000059
939 Ga0207693_10389692
940 Ga0207663_10732896
941 Ga0207660_10059686
942 Ga0207660_10810059
943 Ga0207649_10744496
944 Ga0207652_10412951
945 Ga0207652_10605666
946 Ga0207646_10791082
947 Ga0207694_10130279
948 Ga0207694_11167447
949 Ga0207694_11281004
950 Ga0207650_10265168
951 Ga0207650_10318400
952 Ga0207659_10271480
953 Ga0207687_10759345
954 Ga0207700_10195282
955 Ga0207700_10590807
956 Ga0207700_10802641
957 Ga0207644_10000592
958 Ga0207644_10265476
959 Ga0207644_10575060
960 Ga0207644_11649503
961 Ga0207706_11164072
962 Ga0207670_10901166
963 Ga0207669_10225528
964 Ga0207669_11386366
965 Ga0207704_10026938
966 Ga0207665_10038935
967 Ga0207665_10145243
968 Ga0207691_10048222
969 Ga0207711_10123310
970 Ga0207711_10669002
971 Ga0207711_10824062
972 Ga0207689_11038604
973 Ga0207689_11046245
974 Ga0207689_11189946
975 Ga0207661_10164983
976 Ga0207679_10177039
977 Ga0207667_10001105
978 Ga0207667_10572791
979 Ga0207667_11393112
980 Ga0207651_10024886
981 Ga0207712_10409177
982 Ga0207712_10503001
983 Ga0207712_11688716
984 Ga0207668_10339954
985 Ga0207668_11194898
986 Ga0207640_10323677
987 Ga0207640_11126817
988 Ga0207658_10000894
989 Ga0207658_10014994
990 Ga0207658_10120982
991 Ga0207658_10625404
992 Ga0207658_11057533
993 Ga0207677_10049648
994 Ga0207677_11902805
995 Ga0207703_10000240
996 Ga0207703_10000452
997 Ga0207703_10053058
998 Ga0207639_10427196
999 Ga0207639_10778002
1000 Ga0207639_11079600
1001 Ga0207678_10125188
1002 Ga0207708_10076431
1003 Ga0207702_10017148
1004 Ga0207702_10143931
1005 Ga0207702_10336822
1006 Ga0207702_11128173
1007 Ga0207641_10001841
1008 Ga0207641_10011577
1009 Ga0207641_10067499
1010 Ga0207641_12248340
1011 Ga0207648_10077981
1012 Ga0207674_11910952
1013 Ga0207675_100868044
1014 Ga0207683_10002696
1015 Ga0207698_10576753
1016 Ga0268266_10003601
1017 Ga0268266_10005167
1018 Ga0268266_10040859
1019 Ga0268266_10076854
1020 Ga0268266_10138618
1021 Ga0268266_10679745
1022 Ga0268265_10041087
1023 Ga0268265_10240172
1024 Ga0268265_12036563
1025 Ga0268264_10000057
1026 Ga0268264_10000165
1027 Ga0268264_10000348
1028 Ga0268264_10012865
1029 Ga0268264_10233977
1030 Ga0268264_10746159
1031 Ga0265334_10028716
1032 Ga0265334_10098860
1033 Ga0307511_10002306
1034 Ga0307511_10041820
1035 Ga0265340_10032635
1036 Ga0265331_10032094
1037 Ga0307509_10000013
1038 Ga0307509_10871040
1039 Ga0307508_10140598
1040 Ga0307508_10632522
1041 Ga0316575_10017822
1042 Ga0316575_10021587
1043 Ga0316575_10111643
1044 Ga0316579_10005920
1045 Ga0316579_10008384
1046 Ga0316579_10050152
1047 Ga0316579_10082808
1048 Ga0316579_10098451
1049 Ga0316579_10218679
1050 Ga0316576_10100179
1051 Ga0316576_10160286
1052 Ga0316576_10250909
1053 Ga0316578_10041367
1054 Ga0316578_10080689
1055 Ga0316578_10099538
1056 Ga0316578_10145085
1057 Ga0316578_10204655
1058 Ga0316578_10365922
1059 Ga0316578_10549712
1060 Ga0316577_10001405
1061 Ga0316577_10026726
1062 Ga0316577_10138905
1063 Ga0316577_10192852
1064 Ga0316577_10196743
1065 Ga0307413_10102650
1066 Ga0307410_10090070
1067 Ga0307406_10447227
1068 Ga0307407_10599162
1069 Ga0307409_102417313
1070 Ga0307416_100423801
1071 Ga0307416_101745159
1072 Ga0307415_100712823
1073 Ga0316583_10016952
1074 Ga0316583_10051495
1075 Ga0316585_10000973
1076 Ga0316585_10006144
1077 Ga0316585_10101161
1078 Ga0316585_10107363
1079 Ga0316585_10213930
1080 Ga0316580_10013421
1081 Ga0316580_10031453
1082 Ga0316580_10148122
1083 Ga0316580_10157745
1084 Ga0316593_10000955
1085 Ga0316593_10001178
1086 Ga0316593_10017341
1087 Ga0316593_10022900
1088 Ga0316593_10034964
1089 Ga0316593_10041701
1090 Ga0316593_10072545
1091 Ga0316593_10102287
1092 Ga0316593_10121351
1093 Ga0307510_10000014
1094 Ga0307510_10018637
1095 Ga0316592_1003740
1096 Ga0316592_1007630
1097 Ga0316592_1022157
1098 Ga0316592_1056177
1099 Ga0316586_1116740
1100 Ga0316588_1005213
1101 Ga0316587_1073082
1102 Ga0316596_1000692
1103 Ga0316596_1001197
1104 Ga0316596_1004608
1105 Ga0316596_1026790
1106 Ga0373923_0337805
1107 Ga0373936_0026146
1108 Ga0373936_0035004
1109 Ga0373954_0236442
1110 Ga0373956_0488790
1111 Ga0373957_0146999
1112 Ga0373943_0240575
1113 Ga0373946_0157842
1114 Ga0373955_0835751
1115 Ga0316574_0004138
1116 Ga0316574_0009902
1117 Ga0316574_0020819
1118 Ga0316574_0022040
1119 Ga0316574_0047336
1120 Ga0316574_0118480
1121 Ga0316574_0235019
1122 Ga0316574_0334773
1123 Ga0316574_0372927
1124 Ga0316574_0589677
1125 Ga0373924_0223682
1126 Ga0373935_0243955
1127 Ga0373927_0017103
1128 Ga0373927_0226581
1129 Ga0373927_0669293
1130 Ga0373947_0286738
1131 Ga0373937_0050902
1132 Ga0373937_0083653
1133 Ga0373937_0772324
1134 Ga0316582_0003729
1135 Ga0316582_0008774
1136 Ga0316582_0059179
1137 Ga0316582_0224670
1138 Ga0316582_0270983
1139 Ga0316582_0613519
1140 Ga0316582_0900379
1141 Ga0316582_1155314
1142 Ga0316584_0001707
1143 Ga0316584_0011330
1144 Ga0316584_0027841
1145 Ga0316584_0035063
1146 Ga0316584_0044664
1147 Ga0316584_0049516
1148 Ga0316584_0058973
1149 Ga0316584_0122287
1150 Ga0316584_0128540
1151 Ga0316584_0144998
1152 Ga0316584_0481313
1153 Ga0316584_1076277
1154 Ga0373925_0016431
1155 Ga0395900_1215165
1156 Ga0395898_0080504
1157 Ga0316581_0049519
1158 Ga0316581_0065766
1159 Ga0436364_0588184
1160 Ga0436364_1379834
1161 Ga0400484_12302
1162 Ga0400484_34918
1163 Ga0400484_45045
1164 Ga0400490_00200
1165 Ga0400490_32212
1166 Ga0400491_02403
1167 Ga0400491_25561
1168 Ga0400485_17963
1169 Ga0400488_23317
1170 Ga0400488_46779
1171 Ga0400488_51768
1172 Ga0400488_58945
1173 Ga0400486_11595
1174 Ga0400483_013566
1175 Ga0400483_023540
1176 Ga0400483_048680
1177 Ga0400483_090575
1178 Ga0400483_138542
1179 Ga0400483_185887
1180 Ga0400483_186508
1181 Ga0400483_213137
1182 Ga0400483_243431
1183 Ga0400483_243994
1184 Ga0400483_260246
1185 Ga0400483_261700
1186 Ga0400487_34210
1187 Ga0400487_38419
1188 Ga0400487_61406
1189 Ga0436365_0263164
1190 Ga0436365_0904710
1191 Ga0436365_1044761
1192 Ga0436365_1168590
1193 Ga0436360_0429355
1194 Ga0436360_0730563
1195 Ga0436360_0816060
1196 Ga0436361_0804800
1197 Ga0436363_0301580
1198 Ga0436363_0554731
1199 Ga0436363_1521750
1200 Ga0436363_1682150
1201 Ga0436362_0939706
1202 Ga0436362_1122341
1203 Ga0451793_1751232
1204 Ga0451798_0350512
1205 Ga0451841_0377057
1206 Ga0466969_0003955
1207 Ga0466969_0017111
1208 Ga0466972_0059977
1209 Ga0466972_0381314
1210 Ga0466966_0006076
1211 Ga0466966_0029812
1212 Ga0466966_0151763
1213 Ga0466961_0010904
1214 Ga0466963_0444923
1215 Ga0466964_0000124
1216 Ga0466964_0309065
1217 Ga0466971_0007117
1218 Ga0466968_0052720
1219 Ga0466970_0004208
1220 Ga0466970_0318469
1221 Ga0466957_0100099
1222 Ga0466959_0024867
1223 Ga0466959_0031743
1224 Ga0466959_0052664
1225 Ga0466959_0056096
1226 Ga0466959_0081283
1227 Ga0466959_0145026
1228 Ga0466959_0442529
1229 Ga0495629_0649937
1230 Ga0495580_0009152
1231 Ga0495580_0095023
1232 Ga0495582_0123823
1233 Ga0495639_0176234
1234 Ga0495583_0297903
1235 Ga0495606_0245849
1236 Ga0495618_0098486
1237 Ga0495628_0332638
1238 Ga0495630_0124726
1239 Ga0495632_0269263
1240 Ga0495648_0161112
1241 Ga0495652_0868328
1242 Ga0495586_0056108
1243 Ga0495645_0489581
1244 Ga0495667_0736482
1245 Ga0495634_0461278
1246 Ga0495625_0289802
1247 Ga0495657_0151089
1248 Ga0495599_0156677
1249 Ga0495647_0521293
1250 Ga0495647_0563945
1251 Ga0495669_0231065
1252 Ga0495671_0099963
1253 Ga0495649_0309001
1254 Ga0495649_0658215
1255 Ga0495581_0198078
1256 Ga0495674_0458007
1257 Ga0495674_1311427
1258 Ga0495687_173995
1259 Ga0495593_0572642
1260 Ga0496100_0020875
1261 Ga0496100_0150843
1262 Ga0496100_0870555
1263 Ga0496101_0006883
1264 Ga0496102_0003596
1265 Ga0496102_0073109
1266 Ga0496103_0059554
1267 Ga0496103_0896423
1268 Ga0496104_0554645
1269 Ga0496104_0925477
1270 Ga0496105_0026074
1271 Ga0496106_0015853
1272 Ga0496106_0020229
1273 Ga0496107_0038331
1274 Ga0496107_0140170
1275 Ga0496108_0059978
1276 Ga0496108_1148455
1277 Ga0496109_0193258
1278 Ga0496109_1693278
1279 Ga0496110_0033004
1280 Ga0496110_1715507
1281 Ga0496111_0021195
1282 Ga0496112_0012694
1283 Ga0496112_0018039
1284 Ga0496112_1623583
1285 Ga0496113_0062393
1286 Ga0496114_0011760
1287 Ga0496114_0254998
1288 Ga0496115_0020179
1289 Ga0496115_0510335
1290 Ga0496115_1347763
1291 Ga0496116_0020507
1292 Ga0496117_0000228
1293 Ga0496118_0000005
1294 Ga0496118_0160773
1295 Ga0496118_0210527
1296 Ga0496119_0002586
1297 Ga0496119_0086023
1298 Ga0496119_0325453
1299 Ga0496120_0007880
1300 Ga0496120_0044839
1301 Ga0496120_0351099
1302 Ga0496121_0000522
1303 Ga0496121_0058385
1304 Ga0496124_0036580
1305 Ga0496124_0419876
1306 Ga0496125_0001732
1307 Ga0496125_0005091
1308 Ga0496125_0016278
1309 Ga0496125_0392582
1310 Ga0496125_0490352
1311 Ga0496125_0587276
1312 Ga0496126_0003793
1313 Ga0496126_0789906
1314 Ga0496126_0863644
1315 Ga0496126_1113787
1316 Ga0495682_0137718
1317 Ga0501046_0274317
1318 Ga0501047_0621590
1319 Ga0501080_1488090
1320 Ga0501083_0306550
1321 nmdc:mga0n895_95877_c1
1322 nmdc:mga0rr50_1070697_c1
1323 nmdc:mga08x19_51889_c1
1324 nmdc:mga0a205_446465_c1
1325 Ga0500583_0009679
1326 Ga0500558_130512
1327 Ga0500572_057286
1328 Ga0500572_145187
1329 Ga0500591_082051
1330 Ga0500559_0246603
1331 Ga0500590_042673
1332 Ga0500636_0429238
1333 Ga0500637_0000233
1334 Ga0500637_0011052
1335 Ga0500637_0185036
1336 Ga0500637_0283455
1337 Ga0500637_0450416
1338 Ga0466962_0000297

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03966

Trm112p

Trm112p-like protein

10

49

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1g8j-assembly1.cif.gz_B crystal structure analysis of arsenite oxidase from alcaligenes faecalis 0.9646 10 37
5nqd-assembly2.cif.gz_D arsenite oxidase aioab from rhizobium sp. str. nt-26 mutant aiobf108a 0.9348 11 37
8ed4-assembly1.cif.gz_D structure of the complex between the arsenite oxidase and its native electron acceptor cytochrome c552 from pseudorhizobium sp. str. nt-26 0.9288 11 37
8cgs-assembly1.cif.gz_B crystal structure of arsenite oxidase from alcaligenes faecalis (af aio) bound to antimony oxyanion 0.9274 11 40
2hf1-assembly1.cif.gz_A crystal structure of the putative tetraacyldisaccharide-1-p 4-kinase from chromobacterium violaceum. nesg target cvr39. 0.9212 9 59
ID Description Score Start End Superfamily
4aayB00 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9532 10 37 2.102.10.10
af_Q8LG27_23_76_2.20.25.10 Mainly Beta;Single Sheet;N-terminal domain of TfIIb; 0.9329 9 57 2.20.25.10
2hf1B01 Mainly Beta;Single Sheet;N-terminal domain of TfIIb; 0.9268 9 59 2.20.25.10
af_O33186_9_68_2.20.25.10 Mainly Beta;Single Sheet;N-terminal domain of TfIIb; 0.9068 9 57 2.20.25.10
2js4A01 Mainly Beta;Single Sheet;N-terminal domain of TfIIb; 0.8933 9 54 2.20.25.10
ID Description Score Start End GO Terms
AF-A0A841HGC7-F1-model_v4 UPF0434 protein HNQ60_000672 0.998 1 62 GO:0005829
AF-A0A0Q6AEP6-F1-model_v4 Uncharacterized protein 0.9963 1 53 GO:0005829
AF-A0A2U2C6K6-F1-model_v4 UPF0434 protein C4N9_15940 0.9944 9 54 GO:0005829
AF-A0A1H4XKU4-F1-model_v4 UPF0434 protein SAMN05443249_4314 0.9939 1 54 GO:0005829
AF-A0A3M1UI79-F1-model_v4 UPF0434 protein D6721_09010 0.9931 1 56 GO:0005829

Map