F473937

General Info

Members Datasets Scaffolds Average Seq Length
668 278 1336 261

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0560452|Ga0451577_0560452_102_995
Length 297
Sequence VASVSDRNAERPEPALAGLAQSNSASTNTGSAPRRSAAGGRSLSTTRWLALTVAGFVAFFAVWWLVAASGLVQRQFLPTPLEVLDRFVLLTRSPFVGYTLQQHLASSFGRFALGFGLAVVVGIPLGLLMGWFRWLDAIVTPLFDALRFVAPIAWVPFAALWFGTGIGGPVLVIFSGAFPPCLINAYRGAKYVEPRLVEAAQTLGASHLRMITDVLLPASVPSIVAGLRISAGLGWQSLVGAELIVASSGIGYLLVKGQANISTSIVMSGMIAIGIVGFAIDALLRLLERRIHARRGQ

Samples

Sample ID Description Type Environment
1 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
111 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
112 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
180 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
185 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
186 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
187 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
188 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
189 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
190 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
191 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
192 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
193 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
194 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
195 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
196 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
197 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
198 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
199 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
200 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
201 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
202 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
203 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
204 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
205 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
206 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
207 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
208 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
209 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
210 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
211 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
212 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
213 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
214 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
215 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
216 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
217 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
218 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
219 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
220 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
221 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
222 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
223 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
224 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
225 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
226 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
227 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
228 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
229 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
230 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
231 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
232 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
233 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
234 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
235 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
236 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
237 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
238 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
239 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
240 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
241 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
242 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
243 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
244 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
245 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
246 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
247 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
248 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
249 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
252 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
253 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
254 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
255 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
256 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
257 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
258 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
259 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
260 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
261 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
262 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
263 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
264 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
265 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
266 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
267 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
268 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
269 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
270 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
271 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
272 2643221621 Achromobacter sp. Root83 Isolate Unclassified
273 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
274 2643221736 Bosea sp. Root483D1 Isolate Unclassified
275 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
276 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
277 2858950400 Achromobacter sp. K91 Isolate Unclassified
278 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.8
Metatranscriptomes 0.15
Isolates 1.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.59
Rhizosphere 90.57
Stem 0
Stem Tuber 0
Unclassified 2.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451577_0560452 3300042876 Bacteria 1037
2 JGI24743J22301_10020482 3300001991 Bacteria 1260
3 Ga0065715_10106868 3300005293 Bacteria 2804
4 Ga0065715_10131617 3300005293 Bacteria 2004
5 Ga0070658_10023848 3300005327 Bacteria 4908
6 Ga0070658_10068631 3300005327 Bacteria 2899
7 Ga0070658_10072910 3300005327 Bacteria 2815
8 Ga0070658_10159393 3300005327 Bacteria 1893
9 Ga0070676_10011579 3300005328 Bacteria 4797
10 Ga0070676_10056312 3300005328 Bacteria 2323
11 Ga0070676_10199984 3300005328 Bacteria 1309
12 Ga0070676_10399702 3300005328 Bacteria 956
13 Ga0070683_100050405 3300005329 Bacteria 3854
14 Ga0070683_100091068 3300005329 Bacteria 2863
15 Ga0070683_100309004 3300005329 Bacteria 1504
16 Ga0070690_100018659 3300005330 Bacteria 4193
17 Ga0070670_100020479 3300005331 Bacteria 5686
18 Ga0070670_100022230 3300005331 Bacteria 5458
19 Ga0070670_100049927 3300005331 Bacteria 3596
20 Ga0070670_100070650 3300005331 Bacteria 2997
21 Ga0070677_10012316 3300005333 Bacteria 2969
22 Ga0070677_10012932 3300005333 Bacteria 2907
23 Ga0070666_10222378 3300005335 Bacteria 1332
24 Ga0070682_100200815 3300005337 Unclassified 1406
25 Ga0070660_100000853 3300005339 Bacteria 20293
26 Ga0070660_100140866 3300005339 Bacteria 1935
27 Ga0070660_100157443 3300005339 Bacteria 1829
28 Ga0070660_100537675 3300005339 Bacteria 974
29 Ga0070689_100004722 3300005340 Bacteria 9247
30 Ga0070689_100537778 3300005340 Bacteria 1005
31 Ga0070691_10021522 3300005341 Bacteria 2984
32 Ga0070691_10074654 3300005341 Bacteria 1650
33 Ga0070687_100197207 3300005343 Unclassified 1217
34 Ga0070661_100007062 3300005344 Bacteria 7747
35 Ga0070661_100031526 3300005344 Bacteria 3835
36 Ga0070661_100060276 3300005344 Bacteria 2785
37 Ga0070661_100068845 3300005344 Bacteria 2601
38 Ga0070692_10045900 3300005345 Bacteria 2255
39 Ga0070668_100015208 3300005347 Bacteria 5750
40 Ga0070668_100441293 3300005347 Bacteria 1117
41 Ga0070669_100031702 3300005353 Bacteria 3818
42 Ga0070669_100058322 3300005353 Bacteria 2833
43 Ga0070669_100073222 3300005353 Bacteria 2537
44 Ga0070669_100160796 3300005353 Bacteria 1745
45 Ga0070669_100434977 3300005353 Bacteria 1079
46 Ga0070669_100439308 3300005353 Bacteria 1074
47 Ga0070675_100004083 3300005354 Bacteria 11085
48 Ga0070675_100052817 3300005354 Bacteria 3342
49 Ga0070671_100004994 3300005355 Bacteria 10571
50 Ga0070671_100008932 3300005355 Bacteria 8042
51 Ga0070671_100042662 3300005355 Bacteria 3770
52 Ga0070671_100151006 3300005355 Bacteria 1962
53 Ga0070671_100240457 3300005355 Bacteria 1537
54 Ga0070671_100432747 3300005355 Bacteria 1127
55 Ga0070674_100033146 3300005356 Bacteria 3436
56 Ga0070674_100044938 3300005356 Bacteria 3015
57 Ga0070673_100014895 3300005364 Bacteria 5441
58 Ga0070673_100027607 3300005364 Bacteria 4210
59 Ga0070673_100144177 3300005364 Bacteria 2012
60 Ga0070673_100186393 3300005364 Bacteria 1779
61 Ga0070673_100456661 3300005364 Bacteria 1150
62 Ga0070688_100025660 3300005365 Bacteria 3491
63 Ga0070688_100496764 3300005365 Bacteria 920
64 Ga0070659_100001250 3300005366 Bacteria 18454
65 Ga0070659_100012718 3300005366 Bacteria 6246
66 Ga0070659_100050567 3300005366 Bacteria 3267
67 Ga0070659_100208054 3300005366 Bacteria 1612
68 Ga0070667_100044748 3300005367 Bacteria 3719
69 Ga0070667_100067463 3300005367 Bacteria 3042
70 Ga0070709_10005497 3300005434 Bacteria 6867
71 Ga0070709_10026832 3300005434 Bacteria 3418
72 Ga0070709_10101550 3300005434 Bacteria 1917
73 Ga0070714_100056608 3300005435 Bacteria 3354
74 Ga0070714_100408353 3300005435 Bacteria 1285
75 Ga0070713_100003263 3300005436 Bacteria 10702
76 Ga0070713_100092191 3300005436 Bacteria 2608
77 Ga0070713_100366154 3300005436 Bacteria 1340
78 Ga0070713_100562569 3300005436 Unclassified 1080
79 Ga0070710_10006882 3300005437 Bacteria 5488
80 Ga0070710_10060954 3300005437 Bacteria 2148
81 Ga0070710_10347664 3300005437 Bacteria 981
82 Ga0070701_10026604 3300005438 Bacteria 2823
83 Ga0070711_100092988 3300005439 Bacteria 2177
84 Ga0070705_100115265 3300005440 Bacteria 1725
85 Ga0070705_100309869 3300005440 Unclassified 1135
86 Ga0070705_100357418 3300005440 Bacteria 1067
87 Ga0070700_100011554 3300005441 Bacteria 4894
88 Ga0070700_100037403 3300005441 Bacteria 2951
89 Ga0070694_100030510 3300005444 Bacteria 3528
90 Ga0070694_100104986 3300005444 Bacteria 2005
91 Ga0070663_100006817 3300005455 Bacteria 6906
92 Ga0070663_100190434 3300005455 Bacteria 1596
93 Ga0070678_100012411 3300005456 Bacteria 5293
94 Ga0070678_100018143 3300005456 Bacteria 4555
95 Ga0070678_100142449 3300005456 Bacteria 1920
96 Ga0070678_100179364 3300005456 Bacteria 1732
97 Ga0070662_100000743 3300005457 Bacteria 19966
98 Ga0070662_100162255 3300005457 Bacteria 1749
99 Ga0070662_100270232 3300005457 Bacteria 1372
100 Ga0070681_10011907 3300005458 Bacteria 8626
101 Ga0070681_10063601 3300005458 Bacteria 3662
102 Ga0070681_10076132 3300005458 Bacteria 3315
103 Ga0070681_10126700 3300005458 Bacteria 2486
104 Ga0068867_100008012 3300005459 Bacteria 7465
105 Ga0068867_100063116 3300005459 Bacteria 2753
106 Ga0068867_100716413 3300005459 Bacteria 884
107 Ga0070685_10015648 3300005466 Bacteria 4032
108 Ga0070685_10178681 3300005466 Bacteria 1365
109 Ga0070706_100124298 3300005467 Bacteria 2405
110 Ga0070707_100250322 3300005468 Unclassified 1724
111 Ga0070707_100411474 3300005468 Bacteria 1313
112 Ga0070707_100432358 3300005468 Bacteria 1277
113 Ga0070699_100641237 3300005518 Bacteria 969
114 Ga0070679_100013769 3300005530 Bacteria 7750
115 Ga0070679_100134189 3300005530 Bacteria 2457
116 Ga0070684_100048923 3300005535 Bacteria 3668
117 Ga0070684_100077649 3300005535 Bacteria 2933
118 Ga0070697_100007393 3300005536 Bacteria 8552
119 Ga0070697_100172637 3300005536 Bacteria 1830
120 Ga0068853_100020799 3300005539 Bacteria 5459
121 Ga0068853_100049011 3300005539 Bacteria 3628
122 Ga0068853_100092624 3300005539 Bacteria 2659
123 Ga0068853_100214636 3300005539 Bacteria 1755
124 Ga0070672_100006185 3300005543 Bacteria 8016
125 Ga0070672_100082219 3300005543 Bacteria 2584
126 Ga0070672_100183373 3300005543 Bacteria 1745
127 Ga0070686_100024132 3300005544 Bacteria 3642
128 Ga0070695_100016886 3300005545 Bacteria 4424
129 Ga0070695_100050971 3300005545 Bacteria 2654
130 Ga0070695_100297042 3300005545 Bacteria 1192
131 Ga0070696_100001787 3300005546 Bacteria 14090
132 Ga0070696_100058331 3300005546 Bacteria 2695
133 Ga0070696_100060819 3300005546 Unclassified 2642
134 Ga0070665_100258647 3300005548 Bacteria 1742
135 Ga0070665_100830485 3300005548 Bacteria 937
136 Ga0070704_100363785 3300005549 Bacteria 1225
137 Ga0068855_100000596 3300005563 Bacteria 44278
138 Ga0068855_100011783 3300005563 Bacteria 10574
139 Ga0068855_100026429 3300005563 Bacteria 6944
140 Ga0068855_100034322 3300005563 Bacteria 6052
141 Ga0068855_100048108 3300005563 Bacteria 5035
142 Ga0070664_100005713 3300005564 Bacteria 10021
143 Ga0070664_100007799 3300005564 Bacteria 8645
144 Ga0070664_100020855 3300005564 Bacteria 5398
145 Ga0070664_100049635 3300005564 Bacteria 3549
146 Ga0070664_100074462 3300005564 Bacteria 2914
147 Ga0070664_100238189 3300005564 Bacteria 1633
148 Ga0070664_100296740 3300005564 Bacteria 1460
149 Ga0070664_100314863 3300005564 Bacteria 1417
150 Ga0068857_100003353 3300005577 Bacteria 13334
151 Ga0068857_100210414 3300005577 Bacteria 1774
152 Ga0068857_100418601 3300005577 Bacteria 1249
153 Ga0068854_100011456 3300005578 Bacteria 5777
154 Ga0068854_100047715 3300005578 Bacteria 3053
155 Ga0068854_100160170 3300005578 Unclassified 1742
156 Ga0068856_100000656 3300005614 Bacteria 37454
157 Ga0068856_100006376 3300005614 Bacteria 11575
158 Ga0068856_100011933 3300005614 Bacteria 8414
159 Ga0068856_100030251 3300005614 Bacteria 5294
160 Ga0068856_100081934 3300005614 Bacteria 3202
161 Ga0068856_100171761 3300005614 Bacteria 2180
162 Ga0068852_100080563 3300005616 Bacteria 2887
163 Ga0068852_100128538 3300005616 Bacteria 2330
164 Ga0068852_100186056 3300005616 Bacteria 1956
165 Ga0068852_100316226 3300005616 Bacteria 1515
166 Ga0068852_100320074 3300005616 Unclassified 1506
167 Ga0068852_100437272 3300005616 Bacteria 1293
168 Ga0068859_100022726 3300005617 Bacteria 6288
169 Ga0068859_100030419 3300005617 Bacteria 5418
170 Ga0068859_100052111 3300005617 Bacteria 4114
171 Ga0068859_100102823 3300005617 Bacteria 2915
172 Ga0068859_100224128 3300005617 Bacteria 1968
173 Ga0068859_100228199 3300005617 Bacteria 1950
174 Ga0068864_100001742 3300005618 Bacteria 17878
175 Ga0068864_100028082 3300005618 Bacteria 4755
176 Ga0068864_100399409 3300005618 Bacteria 1306
177 Ga0068864_100690252 3300005618 Bacteria 997
178 Ga0068866_10002436 3300005718 Bacteria 7679
179 Ga0068866_10075067 3300005718 Bacteria 1799
180 Ga0068861_100011444 3300005719 Bacteria 6170
181 Ga0068861_100014823 3300005719 Bacteria 5477
182 Ga0068861_100019436 3300005719 Bacteria 4853
183 Ga0068861_100285351 3300005719 Bacteria 1423
184 Ga0068861_100353711 3300005719 Bacteria 1289
185 Ga0068851_10009318 3300005834 Bacteria 4559
186 Ga0068851_10088834 3300005834 Bacteria 1625
187 Ga0068870_10007545 3300005840 Bacteria 4854
188 Ga0068863_100003719 3300005841 Bacteria 15086
189 Ga0068863_100039996 3300005841 Bacteria 4459
190 Ga0068863_100159307 3300005841 Bacteria 2162
191 Ga0068858_100004438 3300005842 Bacteria 13763
192 Ga0068858_100035782 3300005842 Bacteria 4604
193 Ga0068858_100327906 3300005842 Bacteria 1464
194 Ga0068858_100625293 3300005842 Bacteria 1045
195 Ga0068860_100064516 3300005843 Bacteria 3478
196 Ga0068860_100122530 3300005843 Bacteria 2491
197 Ga0068860_100171730 3300005843 Bacteria 2094
198 Ga0068862_100149778 3300005844 Bacteria 2076
199 Ga0068862_100156174 3300005844 Bacteria 2034
200 Ga0068862_100167066 3300005844 Bacteria 1967
201 Ga0070717_10394216 3300006028 Bacteria 1243
202 Ga0070712_100000426 3300006175 Bacteria 24129
203 Ga0097621_100194750 3300006237 Bacteria 1757
204 Ga0097621_100471327 3300006237 Bacteria 1134
205 Ga0068871_100047381 3300006358 Bacteria 3466
206 Ga0068871_100432887 3300006358 Bacteria 1176
207 Ga0075428_100009931 3300006844 Bacteria 10572
208 Ga0075428_100039732 3300006844 Bacteria 5178
209 Ga0075430_100012656 3300006846 Bacteria 7185
210 Ga0075431_100006357 3300006847 Bacteria 11731
211 Ga0075433_10145512 3300006852 Bacteria 2107
212 Ga0075434_100007102 3300006871 Bacteria 10344
213 Ga0075434_100008439 3300006871 Bacteria 9580
214 Ga0075434_100280467 3300006871 Bacteria 1686
215 Ga0075434_100674682 3300006871 Bacteria 1051
216 Ga0075429_100023291 3300006880 Bacteria 5371
217 Ga0068865_100147793 3300006881 Bacteria 1779
218 Ga0075436_100031349 3300006914 Bacteria 3661
219 Ga0075436_100137534 3300006914 Bacteria 1716
220 Ga0097620_100022724 3300006931 Bacteria 6288
221 Ga0097620_100030419 3300006931 Bacteria 5418
222 Ga0097620_100052110 3300006931 Bacteria 4114
223 Ga0097620_100102819 3300006931 Bacteria 2915
224 Ga0097620_100224120 3300006931 Bacteria 1968
225 Ga0097620_100228198 3300006931 Bacteria 1950
226 Ga0075435_100170689 3300007076 Bacteria 1835
227 Ga0105240_10015537 3300009093 Bacteria 10349
228 Ga0105240_10040698 3300009093 Bacteria 5941
229 Ga0105240_10055303 3300009093 Bacteria 4969
230 Ga0111539_10056368 3300009094 Bacteria 4670
231 Ga0105245_10527149 3300009098 Bacteria 1200
232 Ga0114129_10063996 3300009147 Bacteria 5133
233 Ga0114129_10094386 3300009147 Bacteria 4143
234 Ga0114129_10890861 3300009147 Bacteria 1128
235 Ga0105242_10004690 3300009176 Bacteria 10583
236 Ga0105242_10035629 3300009176 Bacteria 3990
237 Ga0105242_10049972 3300009176 Bacteria 3404
238 Ga0105248_10045830 3300009177 Bacteria 4902
239 Ga0105248_10060386 3300009177 Bacteria 4256
240 Ga0105248_10095492 3300009177 Bacteria 3347
241 Ga0105248_10581671 3300009177 Bacteria 1263
242 Ga0105248_10796356 3300009177 Bacteria 1067
243 Ga0105237_10041585 3300009545 Bacteria 4635
244 Ga0105237_10297269 3300009545 Bacteria 1617
245 Ga0105238_10011338 3300009551 Bacteria 8969
246 Ga0105238_10014121 3300009551 Bacteria 8076
247 Ga0105238_10025842 3300009551 Bacteria 5986
248 Ga0105238_10123751 3300009551 Bacteria 2566
249 Ga0105238_10164927 3300009551 Bacteria 2191
250 Ga0105249_10076189 3300009553 Bacteria 3108
251 Ga0105239_10006811 3300010375 Bacteria 13183
252 Ga0105239_10768347 3300010375 Bacteria 1103
253 Ga0105246_10135008 3300011119 Bacteria 1848
254 Ga0157373_10001644 3300013100 Bacteria 17070
255 Ga0157373_10003612 3300013100 Bacteria 11682
256 Ga0157371_10001047 3300013102 Bacteria 30349
257 Ga0157370_10010656 3300013104 Bacteria 9676
258 Ga0157370_10028554 3300013104 Bacteria 5486
259 Ga0157370_10070574 3300013104 Bacteria 3297
260 Ga0157370_10075385 3300013104 Bacteria 3180
261 Ga0157370_10083450 3300013104 Bacteria 3004
262 Ga0157369_10002279 3300013105 Bacteria 23079
263 Ga0157369_10048263 3300013105 Bacteria 4620
264 Ga0157369_10117954 3300013105 Bacteria 2817
265 Ga0157369_10380433 3300013105 Bacteria 1465
266 Ga0157369_10650067 3300013105 Bacteria 1087
267 Ga0157374_10023006 3300013296 Bacteria 5566
268 Ga0157374_10367653 3300013296 Unclassified 1431
269 Ga0157378_10029136 3300013297 Bacteria 4873
270 Ga0157378_10312938 3300013297 Bacteria 1523
271 Ga0157378_10520991 3300013297 Bacteria 1190
272 Ga0163162_10043324 3300013306 Bacteria 4506
273 Ga0163162_10139225 3300013306 Bacteria 2539
274 Ga0163162_10265302 3300013306 Bacteria 1849
275 Ga0163162_10359309 3300013306 Bacteria 1589
276 Ga0163162_10715546 3300013306 Bacteria 1122
277 Ga0157372_10003409 3300013307 Bacteria 17153
278 Ga0157372_10005089 3300013307 Bacteria 13979
279 Ga0157372_10006487 3300013307 Bacteria 12450
280 Ga0157372_10013966 3300013307 Bacteria 8581
281 Ga0157372_10021378 3300013307 Bacteria 6991
282 Ga0157372_10063844 3300013307 Bacteria 4131
283 Ga0157372_10076831 3300013307 Bacteria 3771
284 Ga0157372_10156523 3300013307 Bacteria 2632
285 Ga0157372_10274817 3300013307 Bacteria 1958
286 Ga0157372_10975603 3300013307 Bacteria 982
287 Ga0157375_10016376 3300013308 Bacteria 6658
288 Ga0157375_10136239 3300013308 Bacteria 2579
289 Ga0157375_10222617 3300013308 Bacteria 2045
290 Ga0157375_10226495 3300013308 Bacteria 2028
291 Ga0163163_10001473 3300014325 Bacteria 19921
292 Ga0163163_10031491 3300014325 Bacteria 5119
293 Ga0163163_10060180 3300014325 Bacteria 3760
294 Ga0163163_10098462 3300014325 Bacteria 2946
295 Ga0157380_10026357 3300014326 Bacteria 4413
296 Ga0157380_10043606 3300014326 Bacteria 3512
297 Ga0157380_10046657 3300014326 Bacteria 3404
298 Ga0157380_10051507 3300014326 Bacteria 3256
299 Ga0157380_10530258 3300014326 Bacteria 1150
300 Ga0157380_10936198 3300014326 Bacteria 895
301 Ga0157379_10017141 3300014968 Bacteria 6379
302 Ga0157379_10058814 3300014968 Bacteria 3437
303 Ga0157379_10247556 3300014968 Bacteria 1617
304 Ga0157376_10099327 3300014969 Bacteria 2539
305 Ga0157376_10156481 3300014969 Bacteria 2061
306 Ga0157376_10195680 3300014969 Bacteria 1857
307 Ga0163161_10048425 3300017792 Bacteria 3069
308 Ga0213876_10001158 3300021384 Bacteria 16663
309 Ga0213876_10003578 3300021384 Bacteria 8840
310 Ga0213875_10009363 3300021388 Bacteria 4966
311 Ga0207697_10002525 3300025315 Bacteria 9433
312 Ga0207656_10091947 3300025321 Bacteria 1378
313 Ga0207656_10113814 3300025321 Bacteria 1253
314 Ga0207682_10002139 3300025893 Bacteria 8951
315 Ga0207682_10004743 3300025893 Bacteria 5639
316 Ga0207692_10268591 3300025898 Bacteria 1028
317 Ga0207642_10054355 3300025899 Bacteria 1826
318 Ga0207642_10064340 3300025899 Bacteria 1719
319 Ga0207688_10011428 3300025901 Bacteria 4834
320 Ga0207688_10098043 3300025901 Bacteria 1689
321 Ga0207680_10225171 3300025903 Bacteria 1287
322 Ga0207680_10415221 3300025903 Bacteria 952
323 Ga0207647_10043338 3300025904 Bacteria 2817
324 Ga0207699_10010380 3300025906 Bacteria 4673
325 Ga0207699_10021064 3300025906 Bacteria 3506
326 Ga0207699_10100806 3300025906 Bacteria 1832
327 Ga0207645_10004476 3300025907 Bacteria 10339
328 Ga0207645_10011574 3300025907 Bacteria 6015
329 Ga0207645_10017620 3300025907 Bacteria 4710
330 Ga0207643_10002190 3300025908 Bacteria 10658
331 Ga0207643_10036782 3300025908 Bacteria 2746
332 Ga0207705_10075713 3300025909 Bacteria 2445
333 Ga0207684_10455207 3300025910 Unclassified 1098
334 Ga0207707_10010759 3300025912 Bacteria 7950
335 Ga0207707_10027434 3300025912 Bacteria 4980
336 Ga0207707_10176948 3300025912 Unclassified 1864
337 Ga0207707_10487157 3300025912 Bacteria 1053
338 Ga0207695_10030785 3300025913 Bacteria 5904
339 Ga0207695_10050055 3300025913 Bacteria 4398
340 Ga0207695_10073983 3300025913 Bacteria 3469
341 Ga0207695_10088501 3300025913 Bacteria 3117
342 Ga0207671_10014674 3300025914 Bacteria 6180
343 Ga0207671_10047357 3300025914 Bacteria 3182
344 Ga0207693_10008837 3300025915 Bacteria 8230
345 Ga0207663_10065560 3300025916 Bacteria 2322
346 Ga0207662_10029560 3300025918 Bacteria 3176
347 Ga0207662_10221984 3300025918 Bacteria 1231
348 Ga0207662_10297917 3300025918 Bacteria 1071
349 Ga0207657_10001180 3300025919 Bacteria 27737
350 Ga0207657_10078885 3300025919 Bacteria 2771
351 Ga0207657_10124625 3300025919 Bacteria 2117
352 Ga0207649_10013618 3300025920 Bacteria 4544
353 Ga0207649_10029144 3300025920 Bacteria 3258
354 Ga0207652_10194877 3300025921 Bacteria 1823
355 Ga0207652_10219115 3300025921 Bacteria 1714
356 Ga0207652_10362160 3300025921 Bacteria 1309
357 Ga0207646_10003026 3300025922 Bacteria 19360
358 Ga0207646_10072081 3300025922 Bacteria 3086
359 Ga0207681_10005501 3300025923 Bacteria 7777
360 Ga0207681_10023632 3300025923 Bacteria 3935
361 Ga0207681_10174455 3300025923 Bacteria 1632
362 Ga0207694_10008187 3300025924 Bacteria 7901
363 Ga0207694_10049346 3300025924 Bacteria 3258
364 Ga0207694_10138090 3300025924 Bacteria 1959
365 Ga0207694_10165467 3300025924 Bacteria 1788
366 Ga0207694_10220318 3300025924 Bacteria 1548
367 Ga0207650_10000755 3300025925 Bacteria 24847
368 Ga0207650_10003114 3300025925 Bacteria 11426
369 Ga0207650_10004774 3300025925 Bacteria 9259
370 Ga0207650_10007706 3300025925 Bacteria 7337
371 Ga0207659_10005630 3300025926 Bacteria 7617
372 Ga0207659_10017772 3300025926 Bacteria 4650
373 Ga0207659_10019507 3300025926 Bacteria 4466
374 Ga0207659_10273544 3300025926 Bacteria 1378
375 Ga0207687_10011546 3300025927 Bacteria 5773
376 Ga0207700_10041076 3300025928 Bacteria 3381
377 Ga0207700_10109166 3300025928 Bacteria 2223
378 Ga0207700_10157809 3300025928 Unclassified 1881
379 Ga0207700_10505010 3300025928 Bacteria 1070
380 Ga0207664_10000505 3300025929 Bacteria 27821
381 Ga0207664_10045256 3300025929 Bacteria 3450
382 Ga0207664_10075295 3300025929 Bacteria 2728
383 Ga0207644_10006858 3300025931 Bacteria 7420
384 Ga0207644_10015129 3300025931 Bacteria 5175
385 Ga0207644_10212159 3300025931 Bacteria 1531
386 Ga0207644_10230890 3300025931 Bacteria 1470
387 Ga0207644_10280004 3300025931 Bacteria 1339
388 Ga0207690_10000937 3300025932 Bacteria 18676
389 Ga0207690_10043983 3300025932 Bacteria 2942
390 Ga0207690_10081054 3300025932 Bacteria 2266
391 Ga0207690_10092107 3300025932 Bacteria 2144
392 Ga0207690_10229518 3300025932 Bacteria 1424
393 Ga0207706_10000144 3300025933 Bacteria 76997
394 Ga0207706_10075873 3300025933 Bacteria 2957
395 Ga0207706_10293459 3300025933 Bacteria 1417
396 Ga0207686_10067524 3300025934 Bacteria 2288
397 Ga0207669_10009032 3300025937 Bacteria 4720
398 Ga0207669_10010773 3300025937 Bacteria 4416
399 Ga0207669_10070744 3300025937 Bacteria 2189
400 Ga0207669_10170864 3300025937 Bacteria 1547
401 Ga0207669_10414702 3300025937 Bacteria 1058
402 Ga0207704_10072418 3300025938 Bacteria 2190
403 Ga0207665_10046905 3300025939 Bacteria 2895
404 Ga0207691_10006914 3300025940 Bacteria 10940
405 Ga0207711_10001814 3300025941 Bacteria 19514
406 Ga0207711_10031395 3300025941 Bacteria 4484
407 Ga0207711_10073518 3300025941 Bacteria 2971
408 Ga0207711_10211261 3300025941 Bacteria 1772
409 Ga0207689_10002758 3300025942 Bacteria 16247
410 Ga0207689_10006317 3300025942 Bacteria 10497
411 Ga0207661_10160815 3300025944 Unclassified 1948
412 Ga0207661_10320420 3300025944 Bacteria 1393
413 Ga0207679_10003930 3300025945 Bacteria 9232
414 Ga0207679_10020548 3300025945 Bacteria 4457
415 Ga0207679_10028230 3300025945 Bacteria 3891
416 Ga0207679_10028608 3300025945 Bacteria 3870
417 Ga0207679_10034409 3300025945 Bacteria 3574
418 Ga0207679_10314423 3300025945 Bacteria 1354
419 Ga0207667_10007162 3300025949 Bacteria 13464
420 Ga0207667_10013736 3300025949 Bacteria 9255
421 Ga0207667_10014392 3300025949 Bacteria 9022
422 Ga0207667_10288643 3300025949 Bacteria 1676
423 Ga0207667_10567731 3300025949 Unclassified 1146
424 Ga0207651_10016940 3300025960 Bacteria 4289
425 Ga0207651_10022219 3300025960 Bacteria 3873
426 Ga0207651_10112777 3300025960 Bacteria 2044
427 Ga0207712_10117431 3300025961 Bacteria 2006
428 Ga0207668_10020268 3300025972 Bacteria 4221
429 Ga0207668_10344824 3300025972 Bacteria 1243
430 Ga0207640_10021532 3300025981 Bacteria 3844
431 Ga0207640_10100067 3300025981 Bacteria 2030
432 Ga0207640_10158851 3300025981 Bacteria 1670
433 Ga0207658_10084026 3300025986 Bacteria 2449
434 Ga0207658_10186182 3300025986 Bacteria 1722
435 Ga0207658_10536558 3300025986 Bacteria 1045
436 Ga0207677_10130949 3300026023 Bacteria 1904
437 Ga0207677_10265486 3300026023 Bacteria 1401
438 Ga0207703_10009917 3300026035 Bacteria 7473
439 Ga0207703_10080266 3300026035 Bacteria 2716
440 Ga0207703_10201417 3300026035 Bacteria 1769
441 Ga0207703_10277927 3300026035 Bacteria 1520
442 Ga0207639_10007370 3300026041 Bacteria 7500
443 Ga0207639_10037931 3300026041 Bacteria 3582
444 Ga0207639_10215855 3300026041 Bacteria 1654
445 Ga0207639_10252999 3300026041 Bacteria 1537
446 Ga0207678_10006255 3300026067 Bacteria 10576
447 Ga0207678_10014916 3300026067 Bacteria 6835
448 Ga0207678_10083811 3300026067 Bacteria 2727
449 Ga0207678_10703277 3300026067 Bacteria 889
450 Ga0207708_10012680 3300026075 Bacteria 6284
451 Ga0207708_10030803 3300026075 Bacteria 4069
452 Ga0207708_10081780 3300026075 Bacteria 2483
453 Ga0207702_10000127 3300026078 Bacteria 89755
454 Ga0207702_10009516 3300026078 Bacteria 8160
455 Ga0207702_10113043 3300026078 Bacteria 2418
456 Ga0207702_10247433 3300026078 Bacteria 1673
457 Ga0207702_10337451 3300026078 Bacteria 1439
458 Ga0207641_10006823 3300026088 Bacteria 9563
459 Ga0207641_10080083 3300026088 Bacteria 2833
460 Ga0207641_10115938 3300026088 Bacteria 2382
461 Ga0207641_10144363 3300026088 Bacteria 2151
462 Ga0207641_10145435 3300026088 Bacteria 2143
463 Ga0207648_10020140 3300026089 Bacteria 6014
464 Ga0207648_10022503 3300026089 Bacteria 5657
465 Ga0207648_10061486 3300026089 Bacteria 3275
466 Ga0207648_10303694 3300026089 Bacteria 1432
467 Ga0207648_10478454 3300026089 Bacteria 1137
468 Ga0207676_10010597 3300026095 Bacteria 6570
469 Ga0207676_10018370 3300026095 Bacteria 5081
470 Ga0207676_10056775 3300026095 Bacteria 3080
471 Ga0207676_10059646 3300026095 Bacteria 3014
472 Ga0207676_10060281 3300026095 Bacteria 3001
473 Ga0207676_10232181 3300026095 Bacteria 1650
474 Ga0207676_10238625 3300026095 Bacteria 1629
475 Ga0207674_10007003 3300026116 Bacteria 13180
476 Ga0207674_10008990 3300026116 Bacteria 11479
477 Ga0207674_10105784 3300026116 Bacteria 2792
478 Ga0207674_10152917 3300026116 Bacteria 2264
479 Ga0207675_100006779 3300026118 Bacteria 10834
480 Ga0207675_100020409 3300026118 Bacteria 6175
481 Ga0207675_100025794 3300026118 Bacteria 5469
482 Ga0207675_100036569 3300026118 Bacteria 4580
483 Ga0207675_100047482 3300026118 Bacteria 4009
484 Ga0207683_10011451 3300026121 Bacteria 7570
485 Ga0207683_10013347 3300026121 Bacteria 7005
486 Ga0207683_10066053 3300026121 Bacteria 3189
487 Ga0207683_10075996 3300026121 Bacteria 2974
488 Ga0207698_10003523 3300026142 Bacteria 9437
489 Ga0207698_10018311 3300026142 Bacteria 4770
490 Ga0207698_10259582 3300026142 Bacteria 1595
491 Ga0207698_10276914 3300026142 Unclassified 1550
492 Ga0207698_10375708 3300026142 Bacteria 1351
493 Ga0207698_10381367 3300026142 Bacteria 1341
494 Ga0209981_1005051 3300027378 Bacteria 1747
495 Ga0209995_1007108 3300027471 Bacteria 1804
496 Ga0209983_1013378 3300027665 Bacteria 1687
497 Ga0209971_1002450 3300027682 Bacteria 4463
498 Ga0209966_1002437 3300027695 Bacteria 3105
499 Ga0209974_10012022 3300027876 Bacteria 2899
500 Ga0207428_10105652 3300027907 Bacteria 2171
501 Ga0268266_10026906 3300028379 Bacteria 4893
502 Ga0268266_10036819 3300028379 Bacteria 4168
503 Ga0268266_10172781 3300028379 Bacteria 1962
504 Ga0268265_10034870 3300028380 Bacteria 3671
505 Ga0268265_10252434 3300028380 Bacteria 1563
506 Ga0268264_10025582 3300028381 Bacteria 4822
507 Ga0268264_10037247 3300028381 Bacteria 4010
508 Ga0268264_10110432 3300028381 Bacteria 2407
509 Ga0265760_10050390 3300031090 Unclassified 1253
510 Ga0307509_10003701 3300031507 Bacteria 22882
511 Ga0307408_100005123 3300031548 Bacteria 8795
512 Ga0307405_10465124 3300031731 Bacteria 1006
513 Ga0307413_10021337 3300031824 Bacteria 3465
514 Ga0307410_10078601 3300031852 Bacteria 2309
515 Ga0307410_10279852 3300031852 Bacteria 1309
516 Ga0307410_10315806 3300031852 Bacteria 1238
517 Ga0307406_10007922 3300031901 Bacteria 5915
518 Ga0307409_100004885 3300031995 Bacteria 7623
519 Ga0307416_100002682 3300032002 Bacteria 10302
520 Ga0307414_10059343 3300032004 Bacteria 2701
521 Ga0307411_10000643 3300032005 Bacteria 12701
522 Ga0373938_0057530 3300034957 Unclassified 902
523 Ga0373926_0060742 3300035083 Bacteria 1378
524 Ga0373949_0008716 3300035090 Bacteria 2220
525 Ga0373952_0010868 3300035092 Bacteria 1766
526 Ga0373943_0049754 3300035170 Bacteria 2058
527 Ga0373943_0209079 3300035170 Bacteria 1083
528 Ga0373946_0075383 3300035171 Bacteria 1466
529 Ga0373955_0047036 3300035172 Unclassified 2335
530 Ga0373942_0051572 3300035207 Bacteria 1155
531 Ga0373931_0007853 3300035691 Bacteria 5044
532 Ga0373931_0023283 3300035691 Bacteria 3125
533 Ga0373931_0029410 3300035691 Bacteria 2820
534 Ga0373935_0111482 3300035692 Bacteria 1817
535 Ga0373927_0011313 3300035695 Bacteria 5939
536 Ga0373927_0028848 3300035695 Bacteria 3619
537 Ga0373927_0132642 3300035695 Bacteria 1628
538 Ga0373947_0138606 3300035725 Bacteria 1559
539 Ga0373937_0016040 3300036401 Bacteria 6644
540 Ga0373937_0036498 3300036401 Bacteria 4479
541 Ga0373937_0101114 3300036401 Bacteria 2676
542 Ga0373925_0045893 3300037068 Bacteria 3247
543 Ga0373925_0054220 3300037068 Bacteria 2998
544 Ga0373925_0126184 3300037068 Bacteria 1991
545 Ga0395899_0087645 3300037312 Bacteria 2259
546 Ga0395900_0033701 3300037418 Bacteria 5270
547 Ga0395898_0173137 3300037466 Bacteria 2063
548 Ga0395898_0252374 3300037466 Bacteria 1682
549 Ga0436364_0354836 3300037853 Bacteria 1633
550 Ga0436364_0565335 3300037853 Bacteria 2026
551 Ga0436364_0719886 3300037853 Bacteria 9346
552 Ga0395901_0059624 3300038443 Bacteria 3971
553 Ga0436365_0468913 3300039437 Bacteria 24014
554 Ga0436365_1362002 3300039437 Bacteria 934
555 Ga0436363_1280317 3300039450 Bacteria 6341
556 Ga0436363_1507929 3300039450 Bacteria 12431
557 Ga0439441_017963 3300042001 Bacteria 1275
558 Ga0439456_055605 3300042013 Bacteria 867
559 Ga0451577_0009071 3300042876 Bacteria 9601
560 Ga0451577_0038819 3300042876 Bacteria 4281
561 Ga0451577_0269664 3300042876 Bacteria 1541
562 Ga0453683_0092712 3300044673 Bacteria 1894
563 Ga0466966_0113848 3300044684 Bacteria 1666
564 Ga0453684_0298104 3300044712 Bacteria 1833
565 Ga0453684_0356382 3300044712 Bacteria 1648
566 Ga0466957_0174799 3300044842 Bacteria 1400
567 Ga0466959_0239911 3300045049 Bacteria 1252
568 Ga0451576_0007549 3300045051 Bacteria 12959
569 Ga0466958_0216826 3300045836 Bacteria 1220
570 Ga0466967_0287241 3300045976 Bacteria 1579
571 Ga0466967_0615116 3300045976 Bacteria 1073
572 Ga0495629_0045437 3300046459 Bacteria 3081
573 Ga0495640_0041845 3300046533 Bacteria 3200
574 Ga0495621_0067759 3300046539 Bacteria 1308
575 Ga0495645_0096255 3300046543 Bacteria 2110
576 Ga0495658_0197104 3300046683 Bacteria 1254
577 Ga0495674_0349609 3300047319 Bacteria 1200
578 Ga0496100_0008957 3300048903 Bacteria 5599
579 Ga0496100_0367759 3300048903 Bacteria 1090
580 Ga0496101_0000682 3300048904 Bacteria 20469
581 Ga0496101_0026408 3300048904 Bacteria 4038
582 Ga0496102_0005496 3300048905 Bacteria 10755
583 Ga0496102_0069785 3300048905 Bacteria 3226
584 Ga0496102_0140141 3300048905 Bacteria 2267
585 Ga0496102_0140914 3300048905 Bacteria 2261
586 Ga0496103_0063635 3300048906 Bacteria 2298
587 Ga0496103_0111781 3300048906 Bacteria 1736
588 Ga0496104_0007302 3300048907 Bacteria 9751
589 Ga0496104_0015910 3300048907 Bacteria 6827
590 Ga0496105_0007698 3300048908 Bacteria 8355
591 Ga0496105_0092664 3300048908 Bacteria 2495
592 Ga0496106_0002831 3300048909 Bacteria 12867
593 Ga0496106_0008609 3300048909 Bacteria 7551
594 Ga0496107_0006777 3300048910 Bacteria 7884
595 Ga0496107_0130313 3300048910 Bacteria 1856
596 Ga0496107_0192177 3300048910 Bacteria 1517
597 Ga0496107_0295349 3300048910 Bacteria 1206
598 Ga0496108_0003054 3300048911 Bacteria 13457
599 Ga0496108_0004093 3300048911 Bacteria 11705
600 Ga0496108_0012983 3300048911 Bacteria 6785
601 Ga0496108_0158253 3300048911 Bacteria 1957
602 Ga0496108_0237876 3300048911 Bacteria 1584
603 Ga0496109_0009837 3300048912 Bacteria 8161
604 Ga0496109_0010204 3300048912 Bacteria 8017
605 Ga0496109_0021506 3300048912 Bacteria 5704
606 Ga0496110_0010236 3300048913 Bacteria 7619
607 Ga0496110_0012401 3300048913 Bacteria 7007
608 Ga0496111_0006473 3300048914 Bacteria 7608
609 Ga0496111_0046704 3300048914 Bacteria 3118
610 Ga0496112_0015791 3300048915 Bacteria 7055
611 Ga0496112_0019766 3300048915 Bacteria 6367
612 Ga0496112_0063485 3300048915 Bacteria 3643
613 Ga0496112_0070830 3300048915 Bacteria 3446
614 Ga0496112_0383763 3300048915 Bacteria 1346
615 Ga0496113_0004703 3300048916 Bacteria 8421
616 Ga0496113_0010130 3300048916 Bacteria 6220
617 Ga0496113_0031581 3300048916 Bacteria 3844
618 Ga0496114_0026105 3300048917 Bacteria 4780
619 Ga0496114_0134159 3300048917 Bacteria 2140
620 Ga0496115_0011805 3300048918 Bacteria 6561
621 Ga0496115_0377492 3300048918 Bacteria 1153
622 Ga0496123_0130878 3300048926 Bacteria 1390
623 Ga0496125_0000482 3300048928 Bacteria 70413
624 Ga0501034_0068299 3300049571 Bacteria 3565
625 Ga0501040_0151351 3300049576 Bacteria 1637
626 Ga0501069_0038738 3300049585 Bacteria 2632
627 Ga0501070_0066805 3300049586 Bacteria 2978
628 Ga0501072_0007021 3300049588 Bacteria 8551
629 Ga0501073_0327163 3300049589 Bacteria 1058
630 Ga0501074_0153581 3300049590 Bacteria 1645
631 Ga0501079_0606007 3300049741 Bacteria 862
632 Ga0501080_0010726 3300049742 Bacteria 8381
633 Ga0501080_0111384 3300049742 Bacteria 2537
634 Ga0501080_0151017 3300049742 Bacteria 2147
635 Ga0501083_0023550 3300049744 Bacteria 4269
636 Ga0501044_0218513 3300049823 Bacteria 1857
637 nmdc:mga05p37_128918_c1 3300050507 Bacteria 3105
638 nmdc:mga05p37_197106_c1 3300050507 Unclassified 2441
639 nmdc:mga05p37_487359_c1 3300050507 Bacteria 1418
640 nmdc:mga09592_38440_c1 3300050508 Bacteria 4018
641 nmdc:mga09592_8319_c1 3300050508 Bacteria 8437
642 nmdc:mga0qj67_852_c1 3300050509 Bacteria 20929
643 nmdc:mga06r32_18272_c1 3300050510 Bacteria 6417
644 nmdc:mga08y16_43193_c1 3300050511 Bacteria 4722
645 nmdc:mga0n895_254677_c1 3300050512 Bacteria 1781
646 nmdc:mga0n895_263112_c1 3300050512 Bacteria 1750
647 nmdc:mga0n895_42177_c1 3300050512 Bacteria 4439
648 nmdc:mga0n895_66495_c1 3300050512 Bacteria 3570
649 nmdc:mga0n895_914_c1 3300050512 Bacteria 21245
650 nmdc:mga0rr50_153950_c1 3300050513 Bacteria 1861
651 nmdc:mga0rr50_194910_c1 3300050513 Bacteria 1662
652 nmdc:mga0rr50_211651_c1 3300050513 Bacteria 1597
653 nmdc:mga08x19_138250_c1 3300050514 Bacteria 1644
654 nmdc:mga08x19_16920_c1 3300050514 Bacteria 4455
655 nmdc:mga08x19_198051_c1 3300050514 Bacteria 1376
656 nmdc:mga0a205_291371_c1 3300050515 Bacteria 1506
657 nmdc:mga0a205_42597_c1 3300050515 Unclassified 4375
658 nmdc:mga0a205_82488_c1 3300050515 Bacteria 3105
659 Ga0495601_0068156 3300053077 Bacteria 2267
660 Ga0495619_0105288 3300053085 Bacteria 1923
661 Ga0501084_0568699 3300054114 Bacteria 958
662 2644122002 2643221621 Bacteria 6212786
663 2644301468 2643221654 Bacteria 5273570
664 2644742722 2643221736 Bacteria 6608466
665 2828309924 2828305725 Bacteria 4916900
666 2857542096 2857537821 Bacteria 5248181
667 2858950995 2858950400 Bacteria 6783797
668 2889307408 2889306138 Bacteria 6358934
669 Ga0451577_0560452
670 JGI24743J22301_10020482
671 Ga0065715_10106868
672 Ga0065715_10131617
673 Ga0070658_10023848
674 Ga0070658_10068631
675 Ga0070658_10072910
676 Ga0070658_10159393
677 Ga0070676_10011579
678 Ga0070676_10056312
679 Ga0070676_10199984
680 Ga0070676_10399702
681 Ga0070683_100050405
682 Ga0070683_100091068
683 Ga0070683_100309004
684 Ga0070690_100018659
685 Ga0070670_100020479
686 Ga0070670_100022230
687 Ga0070670_100049927
688 Ga0070670_100070650
689 Ga0070677_10012316
690 Ga0070677_10012932
691 Ga0070666_10222378
692 Ga0070682_100200815
693 Ga0070660_100000853
694 Ga0070660_100140866
695 Ga0070660_100157443
696 Ga0070660_100537675
697 Ga0070689_100004722
698 Ga0070689_100537778
699 Ga0070691_10021522
700 Ga0070691_10074654
701 Ga0070687_100197207
702 Ga0070661_100007062
703 Ga0070661_100031526
704 Ga0070661_100060276
705 Ga0070661_100068845
706 Ga0070692_10045900
707 Ga0070668_100015208
708 Ga0070668_100441293
709 Ga0070669_100031702
710 Ga0070669_100058322
711 Ga0070669_100073222
712 Ga0070669_100160796
713 Ga0070669_100434977
714 Ga0070669_100439308
715 Ga0070675_100004083
716 Ga0070675_100052817
717 Ga0070671_100004994
718 Ga0070671_100008932
719 Ga0070671_100042662
720 Ga0070671_100151006
721 Ga0070671_100240457
722 Ga0070671_100432747
723 Ga0070674_100033146
724 Ga0070674_100044938
725 Ga0070673_100014895
726 Ga0070673_100027607
727 Ga0070673_100144177
728 Ga0070673_100186393
729 Ga0070673_100456661
730 Ga0070688_100025660
731 Ga0070688_100496764
732 Ga0070659_100001250
733 Ga0070659_100012718
734 Ga0070659_100050567
735 Ga0070659_100208054
736 Ga0070667_100044748
737 Ga0070667_100067463
738 Ga0070709_10005497
739 Ga0070709_10026832
740 Ga0070709_10101550
741 Ga0070714_100056608
742 Ga0070714_100408353
743 Ga0070713_100003263
744 Ga0070713_100092191
745 Ga0070713_100366154
746 Ga0070713_100562569
747 Ga0070710_10006882
748 Ga0070710_10060954
749 Ga0070710_10347664
750 Ga0070701_10026604
751 Ga0070711_100092988
752 Ga0070705_100115265
753 Ga0070705_100309869
754 Ga0070705_100357418
755 Ga0070700_100011554
756 Ga0070700_100037403
757 Ga0070694_100030510
758 Ga0070694_100104986
759 Ga0070663_100006817
760 Ga0070663_100190434
761 Ga0070678_100012411
762 Ga0070678_100018143
763 Ga0070678_100142449
764 Ga0070678_100179364
765 Ga0070662_100000743
766 Ga0070662_100162255
767 Ga0070662_100270232
768 Ga0070681_10011907
769 Ga0070681_10063601
770 Ga0070681_10076132
771 Ga0070681_10126700
772 Ga0068867_100008012
773 Ga0068867_100063116
774 Ga0068867_100716413
775 Ga0070685_10015648
776 Ga0070685_10178681
777 Ga0070706_100124298
778 Ga0070707_100250322
779 Ga0070707_100411474
780 Ga0070707_100432358
781 Ga0070699_100641237
782 Ga0070679_100013769
783 Ga0070679_100134189
784 Ga0070684_100048923
785 Ga0070684_100077649
786 Ga0070697_100007393
787 Ga0070697_100172637
788 Ga0068853_100020799
789 Ga0068853_100049011
790 Ga0068853_100092624
791 Ga0068853_100214636
792 Ga0070672_100006185
793 Ga0070672_100082219
794 Ga0070672_100183373
795 Ga0070686_100024132
796 Ga0070695_100016886
797 Ga0070695_100050971
798 Ga0070695_100297042
799 Ga0070696_100001787
800 Ga0070696_100058331
801 Ga0070696_100060819
802 Ga0070665_100258647
803 Ga0070665_100830485
804 Ga0070704_100363785
805 Ga0068855_100000596
806 Ga0068855_100011783
807 Ga0068855_100026429
808 Ga0068855_100034322
809 Ga0068855_100048108
810 Ga0070664_100005713
811 Ga0070664_100007799
812 Ga0070664_100020855
813 Ga0070664_100049635
814 Ga0070664_100074462
815 Ga0070664_100238189
816 Ga0070664_100296740
817 Ga0070664_100314863
818 Ga0068857_100003353
819 Ga0068857_100210414
820 Ga0068857_100418601
821 Ga0068854_100011456
822 Ga0068854_100047715
823 Ga0068854_100160170
824 Ga0068856_100000656
825 Ga0068856_100006376
826 Ga0068856_100011933
827 Ga0068856_100030251
828 Ga0068856_100081934
829 Ga0068856_100171761
830 Ga0068852_100080563
831 Ga0068852_100128538
832 Ga0068852_100186056
833 Ga0068852_100316226
834 Ga0068852_100320074
835 Ga0068852_100437272
836 Ga0068859_100022726
837 Ga0068859_100030419
838 Ga0068859_100052111
839 Ga0068859_100102823
840 Ga0068859_100224128
841 Ga0068859_100228199
842 Ga0068864_100001742
843 Ga0068864_100028082
844 Ga0068864_100399409
845 Ga0068864_100690252
846 Ga0068866_10002436
847 Ga0068866_10075067
848 Ga0068861_100011444
849 Ga0068861_100014823
850 Ga0068861_100019436
851 Ga0068861_100285351
852 Ga0068861_100353711
853 Ga0068851_10009318
854 Ga0068851_10088834
855 Ga0068870_10007545
856 Ga0068863_100003719
857 Ga0068863_100039996
858 Ga0068863_100159307
859 Ga0068858_100004438
860 Ga0068858_100035782
861 Ga0068858_100327906
862 Ga0068858_100625293
863 Ga0068860_100064516
864 Ga0068860_100122530
865 Ga0068860_100171730
866 Ga0068862_100149778
867 Ga0068862_100156174
868 Ga0068862_100167066
869 Ga0070717_10394216
870 Ga0070712_100000426
871 Ga0097621_100194750
872 Ga0097621_100471327
873 Ga0068871_100047381
874 Ga0068871_100432887
875 Ga0075428_100009931
876 Ga0075428_100039732
877 Ga0075430_100012656
878 Ga0075431_100006357
879 Ga0075433_10145512
880 Ga0075434_100007102
881 Ga0075434_100008439
882 Ga0075434_100280467
883 Ga0075434_100674682
884 Ga0075429_100023291
885 Ga0068865_100147793
886 Ga0075436_100031349
887 Ga0075436_100137534
888 Ga0097620_100022724
889 Ga0097620_100030419
890 Ga0097620_100052110
891 Ga0097620_100102819
892 Ga0097620_100224120
893 Ga0097620_100228198
894 Ga0075435_100170689
895 Ga0105240_10015537
896 Ga0105240_10040698
897 Ga0105240_10055303
898 Ga0111539_10056368
899 Ga0105245_10527149
900 Ga0114129_10063996
901 Ga0114129_10094386
902 Ga0114129_10890861
903 Ga0105242_10004690
904 Ga0105242_10035629
905 Ga0105242_10049972
906 Ga0105248_10045830
907 Ga0105248_10060386
908 Ga0105248_10095492
909 Ga0105248_10581671
910 Ga0105248_10796356
911 Ga0105237_10041585
912 Ga0105237_10297269
913 Ga0105238_10011338
914 Ga0105238_10014121
915 Ga0105238_10025842
916 Ga0105238_10123751
917 Ga0105238_10164927
918 Ga0105249_10076189
919 Ga0105239_10006811
920 Ga0105239_10768347
921 Ga0105246_10135008
922 Ga0157373_10001644
923 Ga0157373_10003612
924 Ga0157371_10001047
925 Ga0157370_10010656
926 Ga0157370_10028554
927 Ga0157370_10070574
928 Ga0157370_10075385
929 Ga0157370_10083450
930 Ga0157369_10002279
931 Ga0157369_10048263
932 Ga0157369_10117954
933 Ga0157369_10380433
934 Ga0157369_10650067
935 Ga0157374_10023006
936 Ga0157374_10367653
937 Ga0157378_10029136
938 Ga0157378_10312938
939 Ga0157378_10520991
940 Ga0163162_10043324
941 Ga0163162_10139225
942 Ga0163162_10265302
943 Ga0163162_10359309
944 Ga0163162_10715546
945 Ga0157372_10003409
946 Ga0157372_10005089
947 Ga0157372_10006487
948 Ga0157372_10013966
949 Ga0157372_10021378
950 Ga0157372_10063844
951 Ga0157372_10076831
952 Ga0157372_10156523
953 Ga0157372_10274817
954 Ga0157372_10975603
955 Ga0157375_10016376
956 Ga0157375_10136239
957 Ga0157375_10222617
958 Ga0157375_10226495
959 Ga0163163_10001473
960 Ga0163163_10031491
961 Ga0163163_10060180
962 Ga0163163_10098462
963 Ga0157380_10026357
964 Ga0157380_10043606
965 Ga0157380_10046657
966 Ga0157380_10051507
967 Ga0157380_10530258
968 Ga0157380_10936198
969 Ga0157379_10017141
970 Ga0157379_10058814
971 Ga0157379_10247556
972 Ga0157376_10099327
973 Ga0157376_10156481
974 Ga0157376_10195680
975 Ga0163161_10048425
976 Ga0213876_10001158
977 Ga0213876_10003578
978 Ga0213875_10009363
979 Ga0207697_10002525
980 Ga0207656_10091947
981 Ga0207656_10113814
982 Ga0207682_10002139
983 Ga0207682_10004743
984 Ga0207692_10268591
985 Ga0207642_10054355
986 Ga0207642_10064340
987 Ga0207688_10011428
988 Ga0207688_10098043
989 Ga0207680_10225171
990 Ga0207680_10415221
991 Ga0207647_10043338
992 Ga0207699_10010380
993 Ga0207699_10021064
994 Ga0207699_10100806
995 Ga0207645_10004476
996 Ga0207645_10011574
997 Ga0207645_10017620
998 Ga0207643_10002190
999 Ga0207643_10036782
1000 Ga0207705_10075713
1001 Ga0207684_10455207
1002 Ga0207707_10010759
1003 Ga0207707_10027434
1004 Ga0207707_10176948
1005 Ga0207707_10487157
1006 Ga0207695_10030785
1007 Ga0207695_10050055
1008 Ga0207695_10073983
1009 Ga0207695_10088501
1010 Ga0207671_10014674
1011 Ga0207671_10047357
1012 Ga0207693_10008837
1013 Ga0207663_10065560
1014 Ga0207662_10029560
1015 Ga0207662_10221984
1016 Ga0207662_10297917
1017 Ga0207657_10001180
1018 Ga0207657_10078885
1019 Ga0207657_10124625
1020 Ga0207649_10013618
1021 Ga0207649_10029144
1022 Ga0207652_10194877
1023 Ga0207652_10219115
1024 Ga0207652_10362160
1025 Ga0207646_10003026
1026 Ga0207646_10072081
1027 Ga0207681_10005501
1028 Ga0207681_10023632
1029 Ga0207681_10174455
1030 Ga0207694_10008187
1031 Ga0207694_10049346
1032 Ga0207694_10138090
1033 Ga0207694_10165467
1034 Ga0207694_10220318
1035 Ga0207650_10000755
1036 Ga0207650_10003114
1037 Ga0207650_10004774
1038 Ga0207650_10007706
1039 Ga0207659_10005630
1040 Ga0207659_10017772
1041 Ga0207659_10019507
1042 Ga0207659_10273544
1043 Ga0207687_10011546
1044 Ga0207700_10041076
1045 Ga0207700_10109166
1046 Ga0207700_10157809
1047 Ga0207700_10505010
1048 Ga0207664_10000505
1049 Ga0207664_10045256
1050 Ga0207664_10075295
1051 Ga0207644_10006858
1052 Ga0207644_10015129
1053 Ga0207644_10212159
1054 Ga0207644_10230890
1055 Ga0207644_10280004
1056 Ga0207690_10000937
1057 Ga0207690_10043983
1058 Ga0207690_10081054
1059 Ga0207690_10092107
1060 Ga0207690_10229518
1061 Ga0207706_10000144
1062 Ga0207706_10075873
1063 Ga0207706_10293459
1064 Ga0207686_10067524
1065 Ga0207669_10009032
1066 Ga0207669_10010773
1067 Ga0207669_10070744
1068 Ga0207669_10170864
1069 Ga0207669_10414702
1070 Ga0207704_10072418
1071 Ga0207665_10046905
1072 Ga0207691_10006914
1073 Ga0207711_10001814
1074 Ga0207711_10031395
1075 Ga0207711_10073518
1076 Ga0207711_10211261
1077 Ga0207689_10002758
1078 Ga0207689_10006317
1079 Ga0207661_10160815
1080 Ga0207661_10320420
1081 Ga0207679_10003930
1082 Ga0207679_10020548
1083 Ga0207679_10028230
1084 Ga0207679_10028608
1085 Ga0207679_10034409
1086 Ga0207679_10314423
1087 Ga0207667_10007162
1088 Ga0207667_10013736
1089 Ga0207667_10014392
1090 Ga0207667_10288643
1091 Ga0207667_10567731
1092 Ga0207651_10016940
1093 Ga0207651_10022219
1094 Ga0207651_10112777
1095 Ga0207712_10117431
1096 Ga0207668_10020268
1097 Ga0207668_10344824
1098 Ga0207640_10021532
1099 Ga0207640_10100067
1100 Ga0207640_10158851
1101 Ga0207658_10084026
1102 Ga0207658_10186182
1103 Ga0207658_10536558
1104 Ga0207677_10130949
1105 Ga0207677_10265486
1106 Ga0207703_10009917
1107 Ga0207703_10080266
1108 Ga0207703_10201417
1109 Ga0207703_10277927
1110 Ga0207639_10007370
1111 Ga0207639_10037931
1112 Ga0207639_10215855
1113 Ga0207639_10252999
1114 Ga0207678_10006255
1115 Ga0207678_10014916
1116 Ga0207678_10083811
1117 Ga0207678_10703277
1118 Ga0207708_10012680
1119 Ga0207708_10030803
1120 Ga0207708_10081780
1121 Ga0207702_10000127
1122 Ga0207702_10009516
1123 Ga0207702_10113043
1124 Ga0207702_10247433
1125 Ga0207702_10337451
1126 Ga0207641_10006823
1127 Ga0207641_10080083
1128 Ga0207641_10115938
1129 Ga0207641_10144363
1130 Ga0207641_10145435
1131 Ga0207648_10020140
1132 Ga0207648_10022503
1133 Ga0207648_10061486
1134 Ga0207648_10303694
1135 Ga0207648_10478454
1136 Ga0207676_10010597
1137 Ga0207676_10018370
1138 Ga0207676_10056775
1139 Ga0207676_10059646
1140 Ga0207676_10060281
1141 Ga0207676_10232181
1142 Ga0207676_10238625
1143 Ga0207674_10007003
1144 Ga0207674_10008990
1145 Ga0207674_10105784
1146 Ga0207674_10152917
1147 Ga0207675_100006779
1148 Ga0207675_100020409
1149 Ga0207675_100025794
1150 Ga0207675_100036569
1151 Ga0207675_100047482
1152 Ga0207683_10011451
1153 Ga0207683_10013347
1154 Ga0207683_10066053
1155 Ga0207683_10075996
1156 Ga0207698_10003523
1157 Ga0207698_10018311
1158 Ga0207698_10259582
1159 Ga0207698_10276914
1160 Ga0207698_10375708
1161 Ga0207698_10381367
1162 Ga0209981_1005051
1163 Ga0209995_1007108
1164 Ga0209983_1013378
1165 Ga0209971_1002450
1166 Ga0209966_1002437
1167 Ga0209974_10012022
1168 Ga0207428_10105652
1169 Ga0268266_10026906
1170 Ga0268266_10036819
1171 Ga0268266_10172781
1172 Ga0268265_10034870
1173 Ga0268265_10252434
1174 Ga0268264_10025582
1175 Ga0268264_10037247
1176 Ga0268264_10110432
1177 Ga0265760_10050390
1178 Ga0307509_10003701
1179 Ga0307408_100005123
1180 Ga0307405_10465124
1181 Ga0307413_10021337
1182 Ga0307410_10078601
1183 Ga0307410_10279852
1184 Ga0307410_10315806
1185 Ga0307406_10007922
1186 Ga0307409_100004885
1187 Ga0307416_100002682
1188 Ga0307414_10059343
1189 Ga0307411_10000643
1190 Ga0373938_0057530
1191 Ga0373926_0060742
1192 Ga0373949_0008716
1193 Ga0373952_0010868
1194 Ga0373943_0049754
1195 Ga0373943_0209079
1196 Ga0373946_0075383
1197 Ga0373955_0047036
1198 Ga0373942_0051572
1199 Ga0373931_0007853
1200 Ga0373931_0023283
1201 Ga0373931_0029410
1202 Ga0373935_0111482
1203 Ga0373927_0011313
1204 Ga0373927_0028848
1205 Ga0373927_0132642
1206 Ga0373947_0138606
1207 Ga0373937_0016040
1208 Ga0373937_0036498
1209 Ga0373937_0101114
1210 Ga0373925_0045893
1211 Ga0373925_0054220
1212 Ga0373925_0126184
1213 Ga0395899_0087645
1214 Ga0395900_0033701
1215 Ga0395898_0173137
1216 Ga0395898_0252374
1217 Ga0436364_0354836
1218 Ga0436364_0565335
1219 Ga0436364_0719886
1220 Ga0395901_0059624
1221 Ga0436365_0468913
1222 Ga0436365_1362002
1223 Ga0436363_1280317
1224 Ga0436363_1507929
1225 Ga0439441_017963
1226 Ga0439456_055605
1227 Ga0451577_0009071
1228 Ga0451577_0038819
1229 Ga0451577_0269664
1230 Ga0453683_0092712
1231 Ga0466966_0113848
1232 Ga0453684_0298104
1233 Ga0453684_0356382
1234 Ga0466957_0174799
1235 Ga0466959_0239911
1236 Ga0451576_0007549
1237 Ga0466958_0216826
1238 Ga0466967_0287241
1239 Ga0466967_0615116
1240 Ga0495629_0045437
1241 Ga0495640_0041845
1242 Ga0495621_0067759
1243 Ga0495645_0096255
1244 Ga0495658_0197104
1245 Ga0495674_0349609
1246 Ga0496100_0008957
1247 Ga0496100_0367759
1248 Ga0496101_0000682
1249 Ga0496101_0026408
1250 Ga0496102_0005496
1251 Ga0496102_0069785
1252 Ga0496102_0140141
1253 Ga0496102_0140914
1254 Ga0496103_0063635
1255 Ga0496103_0111781
1256 Ga0496104_0007302
1257 Ga0496104_0015910
1258 Ga0496105_0007698
1259 Ga0496105_0092664
1260 Ga0496106_0002831
1261 Ga0496106_0008609
1262 Ga0496107_0006777
1263 Ga0496107_0130313
1264 Ga0496107_0192177
1265 Ga0496107_0295349
1266 Ga0496108_0003054
1267 Ga0496108_0004093
1268 Ga0496108_0012983
1269 Ga0496108_0158253
1270 Ga0496108_0237876
1271 Ga0496109_0009837
1272 Ga0496109_0010204
1273 Ga0496109_0021506
1274 Ga0496110_0010236
1275 Ga0496110_0012401
1276 Ga0496111_0006473
1277 Ga0496111_0046704
1278 Ga0496112_0015791
1279 Ga0496112_0019766
1280 Ga0496112_0063485
1281 Ga0496112_0070830
1282 Ga0496112_0383763
1283 Ga0496113_0004703
1284 Ga0496113_0010130
1285 Ga0496113_0031581
1286 Ga0496114_0026105
1287 Ga0496114_0134159
1288 Ga0496115_0011805
1289 Ga0496115_0377492
1290 Ga0496123_0130878
1291 Ga0496125_0000482
1292 Ga0501034_0068299
1293 Ga0501040_0151351
1294 Ga0501069_0038738
1295 Ga0501070_0066805
1296 Ga0501072_0007021
1297 Ga0501073_0327163
1298 Ga0501074_0153581
1299 Ga0501079_0606007
1300 Ga0501080_0010726
1301 Ga0501080_0111384
1302 Ga0501080_0151017
1303 Ga0501083_0023550
1304 Ga0501044_0218513
1305 nmdc:mga05p37_128918_c1
1306 nmdc:mga05p37_197106_c1
1307 nmdc:mga05p37_487359_c1
1308 nmdc:mga09592_38440_c1
1309 nmdc:mga09592_8319_c1
1310 nmdc:mga0qj67_852_c1
1311 nmdc:mga06r32_18272_c1
1312 nmdc:mga08y16_43193_c1
1313 nmdc:mga0n895_254677_c1
1314 nmdc:mga0n895_263112_c1
1315 nmdc:mga0n895_42177_c1
1316 nmdc:mga0n895_66495_c1
1317 nmdc:mga0n895_914_c1
1318 nmdc:mga0rr50_153950_c1
1319 nmdc:mga0rr50_194910_c1
1320 nmdc:mga0rr50_211651_c1
1321 nmdc:mga08x19_138250_c1
1322 nmdc:mga08x19_16920_c1
1323 nmdc:mga08x19_198051_c1
1324 nmdc:mga0a205_291371_c1
1325 nmdc:mga0a205_42597_c1
1326 nmdc:mga0a205_82488_c1
1327 Ga0495601_0068156
1328 Ga0495619_0105288
1329 Ga0501084_0568699
1330 2644122002
1331 2644301468
1332 2644742722
1333 2828309924
1334 2857542096
1335 2858950995
1336 2889307408

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

122

293

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tui-assembly2.cif.gz_E inward facing conformations of the metni methionine abc transporter: cy5 native crystal form 0.6618 69 262
3tuz-assembly2.cif.gz_F inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form 0.652 69 255
2r6g-assembly1.cif.gz_F the crystal structure of the e. coli maltose transporter 0.64 56 247
7mc0-assembly1.cif.gz_B inward facing conformation of the metni methionine abc transporter 0.6359 51 259
3dhw-assembly2.cif.gz_E crystal structure of methionine importer metni 0.6262 69 248
ID Description Score Start End Superfamily
af_P75851_53_247_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8485 69 257 1.10.3720.10
af_Q57856_64_258_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8448 76 258 1.10.3720.10
af_Q2G1I4_54_251_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8413 72 263 1.10.3720.10
af_Q47539_71_268_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8368 64 259 1.10.3720.10
af_Q47539_71_268_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8251 64 259 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A2N2SSP8-F1-model_v4 ABC transporter permease 0.9309 25 213 GO:0005886
GO:0055085
AF-A0A2N2SSP8-F1-model_v4 ABC transporter permease 0.9081 25 213 GO:0005886
GO:0055085
AF-A0A2N2UYD5-F1-model_v4 ABC transporter permease 0.8875 20 262 GO:0005886
GO:0055085
AF-A0A522JJL8-F1-model_v4 ABC transporter permease 0.8772 18 266 GO:0005886
GO:0055085
AF-A0A446C5E3-F1-model_v4 Aliphatic sulfonates transport permease protein SsuC 0.877 16 266 GO:0005886
GO:0055085

Map