F473716

General Info

Members Datasets Scaffolds Average Seq Length
665 322 1330 110

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0828111|Ga0395900_0828111_45_434
Length 129
Sequence VSSPRAFRTTYTDRNERTVMPKMTFIERDGTRKEVDAPLGLSVLEVAHKHGIDLEGACEGSLACSTCHVIVESDWFELLKDPTEDEEDMLDLAFGLTQTSRLGCQIIMTEELDGLTVSLPAGTRNMMNG

Samples

Sample ID Description Type Environment
1 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
57 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
58 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
59 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
60 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
64 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
65 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
75 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
76 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
88 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300013875 Rhizosphere microbial communities from switchgrass unharvested rhizosphere in Austin, TX, USA - RS_233 Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
106 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
108 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
109 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
110 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
111 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
112 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
113 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
114 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
118 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
176 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
177 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
181 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
182 3300030882 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
184 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
185 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
186 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
187 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
188 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
189 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
190 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
191 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
192 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
193 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
194 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
195 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
196 3300032120 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
197 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
198 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
199 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
200 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
201 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
202 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
203 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
204 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
205 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
206 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
207 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
208 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
209 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
210 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
211 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
212 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
213 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
214 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
215 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
216 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
217 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
218 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
219 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
220 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
221 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
222 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
223 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
224 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
225 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
226 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
227 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
228 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
229 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
230 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
231 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
232 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
233 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
234 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
235 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
236 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
237 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
238 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
239 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
240 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
241 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
242 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
243 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
244 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
245 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
246 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
247 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
248 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
249 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
250 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
251 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
252 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
253 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
254 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
255 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
256 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
257 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
258 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
259 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
260 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
261 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
262 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
263 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
264 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
265 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
266 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
267 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
268 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
269 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
270 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
271 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
272 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
273 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
274 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
275 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
276 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
277 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
278 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
279 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
280 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
282 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
285 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
287 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
292 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
293 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
294 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
295 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
296 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
297 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
299 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
300 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
301 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
302 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
303 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
304 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
305 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
306 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
307 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
308 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
309 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
310 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
311 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
312 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
313 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
314 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
315 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
316 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
317 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
318 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
319 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
320 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
321 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
322 8054002106 Azospirillum lipoferum 59b Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.8
Metatranscriptomes 1.05
Isolates 0.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.08
Nodule 0
Rhizoplane 0.75
Rhizosphere 84.21
Stem 0
Stem Tuber 0
Unclassified 0.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395900_0828111 3300037418 Bacteria 852
2 JGI25405J52794_10034116 3300003911 Bacteria 1063
3 Ga0065704_10283593 3300005289 Bacteria 917
4 Ga0070676_11003028 3300005328 Bacteria 627
5 Ga0070676_11432135 3300005328 Bacteria 531
6 Ga0070683_100200618 3300005329 Bacteria 1894
7 Ga0070670_101458998 3300005331 Bacteria 628
8 Ga0070680_100011146 3300005336 Bacteria 6952
9 Ga0070680_100241464 3300005336 Bacteria 1527
10 Ga0070682_100296944 3300005337 Bacteria 1184
11 Ga0070682_101123858 3300005337 Bacteria 659
12 Ga0070660_101458349 3300005339 Bacteria 582
13 Ga0070660_101785357 3300005339 Bacteria 524
14 Ga0070689_100386965 3300005340 Bacteria 1180
15 Ga0070691_10004768 3300005341 Bacteria 6172
16 Ga0070687_100832965 3300005343 Bacteria 656
17 Ga0070661_100076995 3300005344 Bacteria 2458
18 Ga0070669_100063124 3300005353 Bacteria 2726
19 Ga0070675_100114628 3300005354 Bacteria 2284
20 Ga0070675_102138301 3300005354 Bacteria 516
21 Ga0070671_101748467 3300005355 Bacteria 552
22 Ga0070671_102094380 3300005355 Bacteria 504
23 Ga0070674_100154692 3300005356 Bacteria 1734
24 Ga0070673_100763167 3300005364 Bacteria 891
25 Ga0070688_100928285 3300005365 Bacteria 688
26 Ga0070659_100037656 3300005366 Bacteria 3771
27 Ga0070667_100500314 3300005367 Bacteria 1114
28 Ga0070667_100899325 3300005367 Bacteria 824
29 Ga0070714_100072203 3300005435 Bacteria 2987
30 Ga0070714_100353744 3300005435 Bacteria 1380
31 Ga0070714_101282697 3300005435 Bacteria 715
32 Ga0070714_102287746 3300005435 Bacteria 526
33 Ga0070713_100011746 3300005436 Bacteria 6394
34 Ga0070713_100110926 3300005436 Bacteria 2391
35 Ga0070713_100220449 3300005436 Bacteria 1720
36 Ga0070713_100309336 3300005436 Bacteria 1457
37 Ga0070710_10030737 3300005437 Bacteria 2892
38 Ga0070710_10059981 3300005437 Bacteria 2162
39 Ga0070710_10457879 3300005437 Bacteria 866
40 Ga0070711_100139384 3300005439 Bacteria 1816
41 Ga0070711_100675859 3300005439 Bacteria 868
42 Ga0070711_101554820 3300005439 Bacteria 578
43 Ga0070678_100031445 3300005456 Bacteria 3662
44 Ga0070678_100090914 3300005456 Bacteria 2341
45 Ga0070662_100397411 3300005457 Bacteria 1137
46 Ga0070681_10007259 3300005458 Bacteria 10812
47 Ga0070681_10099714 3300005458 Bacteria 2850
48 Ga0070681_10142506 3300005458 Bacteria 2326
49 Ga0070681_10197634 3300005458 Bacteria 1929
50 Ga0070681_10371479 3300005458 Bacteria 1340
51 Ga0070681_11610831 3300005458 Bacteria 575
52 Ga0070706_100663818 3300005467 Bacteria 967
53 Ga0070706_101370366 3300005467 Bacteria 648
54 Ga0070707_100072176 3300005468 Bacteria 3327
55 Ga0070698_100000641 3300005471 Bacteria 37565
56 Ga0070698_100474372 3300005471 Bacteria 1188
57 Ga0070698_100972051 3300005471 Bacteria 796
58 Ga0070699_100179098 3300005518 Bacteria 1880
59 Ga0070679_100001462 3300005530 Bacteria 20930
60 Ga0070679_100004471 3300005530 Bacteria 12911
61 Ga0070679_100340059 3300005530 Bacteria 1449
62 Ga0070679_100786514 3300005530 Bacteria 895
63 Ga0070679_101418393 3300005530 Bacteria 641
64 Ga0070679_102164825 3300005530 Bacteria 506
65 Ga0070684_100129754 3300005535 Bacteria 2273
66 Ga0070684_100867420 3300005535 Bacteria 845
67 Ga0070697_100278070 3300005536 Bacteria 1436
68 Ga0068853_100330810 3300005539 Bacteria 1414
69 Ga0068853_101127355 3300005539 Bacteria 757
70 Ga0070672_100048117 3300005543 Bacteria 3312
71 Ga0070672_101534197 3300005543 Bacteria 597
72 Ga0070665_100139250 3300005548 Bacteria 2430
73 Ga0070665_100398548 3300005548 Bacteria 1384
74 Ga0070665_100498618 3300005548 Bacteria 1229
75 Ga0070665_100503145 3300005548 Bacteria 1223
76 Ga0068855_100016016 3300005563 Bacteria 9018
77 Ga0068855_100260762 3300005563 Bacteria 1931
78 Ga0068855_100592469 3300005563 Bacteria 1196
79 Ga0068855_102325954 3300005563 Bacteria 536
80 Ga0070664_100347455 3300005564 Bacteria 1348
81 Ga0068857_100343133 3300005577 Bacteria 1382
82 Ga0068857_101341839 3300005577 Bacteria 695
83 Ga0068854_100137911 3300005578 Bacteria 1869
84 Ga0068854_101147126 3300005578 Bacteria 694
85 Ga0068856_100014010 3300005614 Bacteria 7753
86 Ga0068856_100145975 3300005614 Bacteria 2374
87 Ga0068856_100641202 3300005614 Bacteria 1083
88 Ga0068856_100952846 3300005614 Bacteria 877
89 Ga0070702_101244607 3300005615 Bacteria 602
90 Ga0068852_100087687 3300005616 Bacteria 2777
91 Ga0068859_100087454 3300005617 Bacteria 3164
92 Ga0068859_103068405 3300005617 Bacteria 510
93 Ga0068864_100869617 3300005618 Bacteria 889
94 Ga0068864_101958916 3300005618 Bacteria 592
95 Ga0068851_10264176 3300005834 Bacteria 980
96 Ga0068851_11087968 3300005834 Bacteria 507
97 Ga0068858_100393281 3300005842 Bacteria 1331
98 Ga0068860_102440677 3300005843 Bacteria 543
99 Ga0068862_100291437 3300005844 Bacteria 1499
100 Ga0081455_10000688 3300005937 Bacteria 43874
101 Ga0081455_10009381 3300005937 Bacteria 10066
102 Ga0081455_10365018 3300005937 Bacteria 1014
103 Ga0081540_1030277 3300005983 Bacteria 3000
104 Ga0081540_1067783 3300005983 Bacteria 1665
105 Ga0081539_10007016 3300005985 Bacteria 10450
106 Ga0081539_10010675 3300005985 Bacteria 7408
107 Ga0070717_10024887 3300006028 Bacteria 4756
108 Ga0070717_10144933 3300006028 Bacteria 2051
109 Ga0070717_10546151 3300006028 Bacteria 1049
110 Ga0070717_10792442 3300006028 Bacteria 862
111 Ga0070717_11632208 3300006028 Bacteria 584
112 Ga0070717_11961999 3300006028 Bacteria 528
113 Ga0075365_10026742 3300006038 Bacteria 3666
114 Ga0075365_10242485 3300006038 Bacteria 1266
115 Ga0075365_10468008 3300006038 Bacteria 890
116 Ga0075365_11064830 3300006038 Bacteria 569
117 Ga0075368_10029075 3300006042 Bacteria 2137
118 Ga0075364_10219070 3300006051 Bacteria 1291
119 Ga0075364_10317627 3300006051 Bacteria 1060
120 Ga0075432_10180476 3300006058 Bacteria 826
121 Ga0070715_10790982 3300006163 Bacteria 575
122 Ga0070716_100193903 3300006173 Bacteria 1345
123 Ga0070716_101176149 3300006173 Bacteria 615
124 Ga0070712_100049785 3300006175 Bacteria 2911
125 Ga0070712_100174596 3300006175 Bacteria 1670
126 Ga0070712_100435971 3300006175 Bacteria 1089
127 Ga0075362_10006964 3300006177 Bacteria 4244
128 Ga0075362_10020910 3300006177 Bacteria 2738
129 Ga0075362_10123776 3300006177 Bacteria 1226
130 Ga0075362_10140285 3300006177 Bacteria 1155
131 Ga0075362_10174824 3300006177 Bacteria 1039
132 Ga0075362_10616114 3300006177 Bacteria 562
133 Ga0075367_10009522 3300006178 Bacteria 5082
134 Ga0075367_10029988 3300006178 Bacteria 3115
135 Ga0075367_10331436 3300006178 Bacteria 960
136 Ga0075369_10015552 3300006186 Bacteria 3056
137 Ga0075369_10018239 3300006186 Bacteria 2856
138 Ga0075369_10231094 3300006186 Bacteria 857
139 Ga0075366_10036962 3300006195 Bacteria 2880
140 Ga0075366_10359758 3300006195 Bacteria 894
141 Ga0075366_10870653 3300006195 Bacteria 561
142 Ga0097621_100485764 3300006237 Bacteria 1117
143 Ga0075370_10016237 3300006353 Bacteria 4003
144 Ga0075370_10049140 3300006353 Bacteria 2391
145 Ga0075370_10251888 3300006353 Bacteria 1047
146 Ga0068871_100776988 3300006358 Bacteria 882
147 Ga0075428_100903433 3300006844 Bacteria 937
148 Ga0068865_102033514 3300006881 Bacteria 522
149 Ga0097620_100087451 3300006931 Bacteria 3164
150 Ga0097620_103068391 3300006931 Bacteria 510
151 Ga0075435_100063828 3300007076 Bacteria 2991
152 Ga0075435_101152611 3300007076 Bacteria 678
153 Ga0099794_10204513 3300007265 Bacteria 1012
154 Ga0099795_10004091 3300007788 Bacteria 3717
155 Ga0099795_10520025 3300007788 Bacteria 557
156 Ga0105250_10383631 3300009092 Bacteria 620
157 Ga0105240_10041196 3300009093 Bacteria 5897
158 Ga0105240_10226885 3300009093 Bacteria 2173
159 Ga0105240_10330513 3300009093 Bacteria 1735
160 Ga0105240_10350020 3300009093 Bacteria 1676
161 Ga0105240_10669165 3300009093 Bacteria 1136
162 Ga0105240_10887408 3300009093 Bacteria 960
163 Ga0105240_11323701 3300009093 Bacteria 759
164 Ga0111539_10434078 3300009094 Bacteria 1529
165 Ga0111539_12823958 3300009094 Bacteria 562
166 Ga0105245_10203960 3300009098 Bacteria 1900
167 Ga0105245_11456449 3300009098 Bacteria 735
168 Ga0105247_10549629 3300009101 Bacteria 849
169 Ga0105247_11676759 3300009101 Bacteria 525
170 Ga0105243_11013740 3300009148 Bacteria 834
171 Ga0105241_10916449 3300009174 Bacteria 815
172 Ga0105242_10464400 3300009176 Bacteria 1196
173 Ga0105248_10250080 3300009177 Bacteria 1995
174 Ga0105237_10167177 3300009545 Bacteria 2198
175 Ga0105237_11035124 3300009545 Bacteria 828
176 Ga0105237_11222290 3300009545 Bacteria 758
177 Ga0105238_10057501 3300009551 Bacteria 3899
178 Ga0105238_10196387 3300009551 Bacteria 1994
179 Ga0105238_10219118 3300009551 Bacteria 1879
180 Ga0105238_11605360 3300009551 Bacteria 680
181 Ga0105238_12974812 3300009551 Bacteria 509
182 Ga0105035_101266 3300009988 Bacteria 1721
183 Ga0099796_10003440 3300010159 Bacteria 3673
184 Ga0105239_10853651 3300010375 Bacteria 1044
185 Ga0105239_11038259 3300010375 Bacteria 943
186 Ga0105239_11050471 3300010375 Bacteria 937
187 Ga0105239_11437621 3300010375 Unclassified 796
188 Ga0105239_11602060 3300010375 Bacteria 753
189 Ga0105239_13249760 3300010375 Bacteria 529
190 Ga0157373_10066839 3300013100 Bacteria 2542
191 Ga0157373_10102685 3300013100 Bacteria 2012
192 Ga0157373_10573386 3300013100 Bacteria 820
193 Ga0157371_10117854 3300013102 Bacteria 1887
194 Ga0157371_10415541 3300013102 Bacteria 986
195 Ga0157370_10019744 3300013104 Bacteria 6746
196 Ga0157370_10410267 3300013104 Bacteria 1246
197 Ga0157370_10625503 3300013104 Bacteria 985
198 Ga0157369_10020086 3300013105 Bacteria 7471
199 Ga0157369_10350166 3300013105 Bacteria 1534
200 Ga0157369_10459304 3300013105 Bacteria 1318
201 Ga0157374_10151595 3300013296 Bacteria 2254
202 Ga0157374_10395854 3300013296 Bacteria 1377
203 Ga0157374_10624215 3300013296 Bacteria 1089
204 Ga0157374_11286931 3300013296 Bacteria 753
205 Ga0157374_11443990 3300013296 Bacteria 711
206 Ga0157378_10092332 3300013297 Bacteria 2754
207 Ga0157378_10323498 3300013297 Bacteria 1499
208 Ga0157378_11545918 3300013297 Bacteria 709
209 Ga0157378_12295875 3300013297 Bacteria 591
210 Ga0157372_10137200 3300013307 Bacteria 2817
211 Ga0157372_12696930 3300013307 Bacteria 570
212 Ga0157375_12163476 3300013308 Bacteria 662
213 Ga0157375_12797947 3300013308 Bacteria 583
214 Ga0157515_116762 3300013875 Bacteria 940
215 Ga0163163_10083133 3300014325 Bacteria 3206
216 Ga0163163_10840000 3300014325 Bacteria 982
217 Ga0163163_11891514 3300014325 Bacteria 657
218 Ga0157380_11837932 3300014326 Bacteria 665
219 Ga0182008_10395070 3300014497 Bacteria 742
220 Ga0182008_10550526 3300014497 Bacteria 641
221 Ga0157379_10884466 3300014968 Bacteria 847
222 Ga0157379_11393208 3300014968 Bacteria 679
223 Ga0157379_12532557 3300014968 Bacteria 513
224 Ga0157379_12563752 3300014968 Bacteria 510
225 Ga0163161_10594122 3300017792 Bacteria 912
226 Ga0197907_11228939 3300020069 Bacteria 741
227 Ga0206355_1585110 3300020076 Bacteria 603
228 Ga0206353_11950597 3300020082 Bacteria 804
229 Ga0154015_1267117 3300020610 Bacteria 535
230 Ga0213873_10056701 3300021358 Bacteria 1051
231 Ga0213872_10056033 3300021361 Bacteria 1786
232 Ga0213872_10242688 3300021361 Bacteria 761
233 Ga0213874_10018944 3300021377 Bacteria 1867
234 Ga0213876_10226281 3300021384 Bacteria 994
235 Ga0213875_10000253 3300021388 Bacteria 53621
236 Ga0213875_10001582 3300021388 Bacteria 14506
237 Ga0213875_10056169 3300021388 Bacteria 1844
238 Ga0213875_10123940 3300021388 Bacteria 1207
239 Ga0213871_10003685 3300021441 Bacteria 2987
240 Ga0213871_10010990 3300021441 Bacteria 2068
241 Ga0213871_10131587 3300021441 Bacteria 751
242 Ga0213871_10172580 3300021441 Bacteria 666
243 Ga0213871_10205762 3300021441 Bacteria 615
244 Ga0224712_10050002 3300022467 Bacteria 1622
245 Ga0209676_1000256 3300025292 Bacteria 112819
246 Ga0209050_1011492 3300025298 Bacteria 4188
247 Ga0207426_1026821 3300025302 Bacteria 1925
248 Ga0207426_1049303 3300025302 Bacteria 1261
249 Ga0207697_10195581 3300025315 Bacteria 888
250 Ga0207697_10319707 3300025315 Bacteria 689
251 Ga0207656_10102313 3300025321 Bacteria 1315
252 Ga0207653_10034017 3300025885 Bacteria 1654
253 Ga0207692_10262871 3300025898 Bacteria 1038
254 Ga0207692_10704860 3300025898 Bacteria 655
255 Ga0207642_11054872 3300025899 Bacteria 524
256 Ga0207710_10621855 3300025900 Bacteria 565
257 Ga0207688_10078557 3300025901 Bacteria 1881
258 Ga0207680_10515880 3300025903 Bacteria 852
259 Ga0207647_10134893 3300025904 Bacteria 1449
260 Ga0207647_10374812 3300025904 Bacteria 804
261 Ga0207699_10089415 3300025906 Bacteria 1930
262 Ga0207699_10105476 3300025906 Bacteria 1797
263 Ga0207699_10272901 3300025906 Bacteria 1172
264 Ga0207645_10817055 3300025907 Bacteria 634
265 Ga0207643_10450241 3300025908 Bacteria 819
266 Ga0207705_10099719 3300025909 Bacteria 2136
267 Ga0207705_10150357 3300025909 Bacteria 1745
268 Ga0207684_10271395 3300025910 Bacteria 1463
269 Ga0207684_10572679 3300025910 Bacteria 965
270 Ga0207684_11177093 3300025910 Bacteria 635
271 Ga0207707_10015024 3300025912 Bacteria 6742
272 Ga0207707_10183121 3300025912 Bacteria 1828
273 Ga0207707_10253734 3300025912 Bacteria 1527
274 Ga0207707_10261457 3300025912 Bacteria 1502
275 Ga0207707_10375367 3300025912 Bacteria 1223
276 Ga0207695_10234562 3300025913 Bacteria 1738
277 Ga0207695_10243724 3300025913 Bacteria 1698
278 Ga0207695_10270929 3300025913 Bacteria 1593
279 Ga0207695_10442983 3300025913 Bacteria 1182
280 Ga0207671_10244839 3300025914 Bacteria 1409
281 Ga0207671_11538467 3300025914 Bacteria 513
282 Ga0207693_10001602 3300025915 Bacteria 20022
283 Ga0207693_10005635 3300025915 Bacteria 10413
284 Ga0207693_10033797 3300025915 Bacteria 4034
285 Ga0207693_10067257 3300025915 Bacteria 2805
286 Ga0207693_10305738 3300025915 Bacteria 1245
287 Ga0207693_10828333 3300025915 Bacteria 712
288 Ga0207663_10036453 3300025916 Bacteria 2959
289 Ga0207663_10252127 3300025916 Bacteria 1299
290 Ga0207663_10433005 3300025916 Bacteria 1011
291 Ga0207663_10518933 3300025916 Bacteria 928
292 Ga0207660_10090086 3300025917 Bacteria 2272
293 Ga0207660_10153117 3300025917 Bacteria 1773
294 Ga0207660_10281049 3300025917 Bacteria 1321
295 Ga0207660_10514987 3300025917 Bacteria 971
296 Ga0207660_10784176 3300025917 Bacteria 778
297 Ga0207662_10675507 3300025918 Bacteria 723
298 Ga0207657_10310018 3300025919 Bacteria 1249
299 Ga0207657_11514352 3300025919 Bacteria 501
300 Ga0207649_10069979 3300025920 Bacteria 2236
301 Ga0207652_10036904 3300025921 Bacteria 4133
302 Ga0207652_10111086 3300025921 Bacteria 2431
303 Ga0207652_10152348 3300025921 Bacteria 2071
304 Ga0207652_10202211 3300025921 Bacteria 1788
305 Ga0207652_10995018 3300025921 Bacteria 737
306 Ga0207652_11020728 3300025921 Bacteria 726
307 Ga0207652_11616747 3300025921 Bacteria 552
308 Ga0207646_11071323 3300025922 Bacteria 710
309 Ga0207681_10645849 3300025923 Bacteria 877
310 Ga0207694_10262322 3300025924 Bacteria 1415
311 Ga0207694_10584148 3300025924 Bacteria 939
312 Ga0207694_10932248 3300025924 Bacteria 734
313 Ga0207659_10096793 3300025926 Bacteria 2216
314 Ga0207687_10379221 3300025927 Bacteria 1158
315 Ga0207700_10073917 3300025928 Bacteria 2634
316 Ga0207700_10123102 3300025928 Bacteria 2106
317 Ga0207700_10294079 3300025928 Bacteria 1400
318 Ga0207700_10622409 3300025928 Bacteria 961
319 Ga0207700_11322383 3300025928 Bacteria 642
320 Ga0207700_11704458 3300025928 Bacteria 556
321 Ga0207664_10014469 3300025929 Bacteria 5698
322 Ga0207664_10971621 3300025929 Bacteria 761
323 Ga0207664_11382384 3300025929 Bacteria 624
324 Ga0207664_11760750 3300025929 Bacteria 542
325 Ga0207664_11879993 3300025929 Bacteria 521
326 Ga0207644_10433186 3300025931 Bacteria 1079
327 Ga0207644_11107021 3300025931 Bacteria 666
328 Ga0207644_11756465 3300025931 Bacteria 519
329 Ga0207690_10087281 3300025932 Bacteria 2195
330 Ga0207690_11767929 3300025932 Bacteria 516
331 Ga0207706_11450020 3300025933 Bacteria 562
332 Ga0207686_10907029 3300025934 Bacteria 711
333 Ga0207670_10330746 3300025936 Bacteria 1201
334 Ga0207670_10439093 3300025936 Bacteria 1050
335 Ga0207669_10223824 3300025937 Bacteria 1383
336 Ga0207669_11591070 3300025937 Bacteria 558
337 Ga0207704_11907057 3300025938 Bacteria 511
338 Ga0207665_10272026 3300025939 Bacteria 1258
339 Ga0207665_10445632 3300025939 Bacteria 993
340 Ga0207691_10568881 3300025940 Bacteria 960
341 Ga0207691_10618568 3300025940 Bacteria 916
342 Ga0207661_12140621 3300025944 Bacteria 505
343 Ga0207679_10094505 3300025945 Bacteria 2321
344 Ga0207679_10630758 3300025945 Bacteria 968
345 Ga0207679_10893511 3300025945 Bacteria 812
346 Ga0207667_10021411 3300025949 Bacteria 7165
347 Ga0207667_10330034 3300025949 Bacteria 1557
348 Ga0207667_10858444 3300025949 Bacteria 902
349 Ga0207651_10668400 3300025960 Bacteria 913
350 Ga0207651_11490695 3300025960 Bacteria 609
351 Ga0207640_10112810 3300025981 Bacteria 1931
352 Ga0207640_10173737 3300025981 Bacteria 1608
353 Ga0207640_10713513 3300025981 Bacteria 861
354 Ga0207640_11066982 3300025981 Bacteria 713
355 Ga0207677_10423435 3300026023 Bacteria 1135
356 Ga0207677_10888627 3300026023 Bacteria 803
357 Ga0207703_10444773 3300026035 Bacteria 1210
358 Ga0207639_11933471 3300026041 Bacteria 551
359 Ga0207708_10626029 3300026075 Bacteria 914
360 Ga0207708_12036747 3300026075 Bacteria 502
361 Ga0207702_10119240 3300026078 Bacteria 2359
362 Ga0207702_10143221 3300026078 Bacteria 2166
363 Ga0207702_10213966 3300026078 Bacteria 1793
364 Ga0207702_11381849 3300026078 Bacteria 698
365 Ga0207702_11539940 3300026078 Bacteria 658
366 Ga0207702_11651298 3300026078 Bacteria 634
367 Ga0207641_11177140 3300026088 Bacteria 766
368 Ga0207648_10527645 3300026089 Bacteria 1082
369 Ga0207648_10701061 3300026089 Bacteria 938
370 Ga0207676_10607945 3300026095 Bacteria 1051
371 Ga0207676_10999404 3300026095 Bacteria 824
372 Ga0207674_10177351 3300026116 Bacteria 2083
373 Ga0207674_11213394 3300026116 Bacteria 724
374 Ga0207674_11495557 3300026116 Bacteria 644
375 Ga0207675_100916825 3300026118 Bacteria 893
376 Ga0207683_10116426 3300026121 Bacteria 2396
377 Ga0207683_10374681 3300026121 Bacteria 1308
378 Ga0207698_11233143 3300026142 Bacteria 762
379 Ga0209813_10031933 3300027866 Bacteria 1557
380 Ga0207428_10665262 3300027907 Bacteria 747
381 Ga0268266_10011062 3300028379 Bacteria 7857
382 Ga0268266_10883551 3300028379 Bacteria 864
383 Ga0268265_11067695 3300028380 Bacteria 800
384 Ga0268264_12689801 3300028381 Bacteria 501
385 Ga0307517_10008012 3300028786 Bacteria 15244
386 Ga0265338_10110497 3300028800 Bacteria 2215
387 Ga0265764_114217 3300030882 Bacteria 537
388 Ga0265332_10080306 3300031238 Bacteria 1384
389 Ga0265340_10331267 3300031247 Bacteria 673
390 Ga0265340_10428710 3300031247 Bacteria 583
391 Ga0265339_10244811 3300031249 Bacteria 870
392 Ga0265339_10306235 3300031249 Bacteria 757
393 Ga0265327_10016206 3300031251 Bacteria 4752
394 Ga0265327_10077979 3300031251 Bacteria 1642
395 Ga0265316_10155618 3300031344 Bacteria 1711
396 Ga0307513_10453174 3300031456 Bacteria 1007
397 Ga0265313_10068075 3300031595 Bacteria 1646
398 Ga0265314_10224550 3300031711 Bacteria 1094
399 Ga0265342_10131690 3300031712 Bacteria 1401
400 Ga0307406_11266050 3300031901 Bacteria 643
401 Ga0307412_10780127 3300031911 Bacteria 828
402 Ga0307409_101551262 3300031995 Bacteria 690
403 Ga0307416_100434725 3300032002 Bacteria 1361
404 Ga0316053_108997 3300032120 Bacteria 681
405 Ga0373926_0138843 3300035083 Bacteria 923
406 Ga0373940_0354956 3300035088 Bacteria 515
407 Ga0373944_0248171 3300035089 Bacteria 656
408 Ga0373952_0224197 3300035092 Bacteria 560
409 Ga0373932_0272048 3300035112 Bacteria 624
410 Ga0373936_0046845 3300035113 Bacteria 1743
411 Ga0373936_0400881 3300035113 Bacteria 630
412 Ga0373941_0163214 3300035115 Bacteria 825
413 Ga0373945_0165035 3300035116 Bacteria 905
414 Ga0373945_0343941 3300035116 Bacteria 646
415 Ga0373945_0471102 3300035116 Bacteria 557
416 Ga0373953_0023627 3300035117 Bacteria 2328
417 Ga0373954_0063587 3300035118 Bacteria 1744
418 Ga0373956_0119709 3300035119 Bacteria 1229
419 Ga0373957_0255623 3300035120 Bacteria 738
420 Ga0373957_0490840 3300035120 Bacteria 534
421 Ga0373957_0504062 3300035120 Bacteria 527
422 Ga0373943_0066903 3300035170 Bacteria 1811
423 Ga0373943_0526444 3300035170 Bacteria 692
424 Ga0373946_0343762 3300035171 Bacteria 745
425 Ga0373946_0515281 3300035171 Bacteria 614
426 Ga0373955_0029777 3300035172 Bacteria 2843
427 Ga0373955_0042579 3300035172 Bacteria 2439
428 Ga0373955_0144379 3300035172 Bacteria 1397
429 Ga0373955_0306388 3300035172 Bacteria 958
430 Ga0373955_0578731 3300035172 Bacteria 687
431 Ga0373955_0675506 3300035172 Bacteria 634
432 Ga0373942_0112719 3300035207 Bacteria 842
433 Ga0373924_0026438 3300035410 Bacteria 2302
434 Ga0373924_0142703 3300035410 Bacteria 1045
435 Ga0373931_0574963 3300035691 Bacteria 734
436 Ga0373931_0810819 3300035691 Bacteria 625
437 Ga0373935_0279179 3300035692 Bacteria 1176
438 Ga0373935_0331225 3300035692 Bacteria 1082
439 Ga0373927_0051388 3300035695 Bacteria 2665
440 Ga0373927_0136058 3300035695 Bacteria 1606
441 Ga0373927_0235275 3300035695 Bacteria 1204
442 Ga0373927_0949559 3300035695 Bacteria 567
443 Ga0373927_1087803 3300035695 Bacteria 527
444 Ga0373927_1177878 3300035695 Bacteria 505
445 Ga0373933_0023266 3300035724 Bacteria 3538
446 Ga0373933_0025398 3300035724 Bacteria 3397
447 Ga0373933_0036405 3300035724 Bacteria 2880
448 Ga0373933_0352553 3300035724 Bacteria 956
449 Ga0373947_0063328 3300035725 Bacteria 2253
450 Ga0373947_0113888 3300035725 Bacteria 1712
451 Ga0373947_0380510 3300035725 Bacteria 950
452 Ga0373947_0723966 3300035725 Bacteria 679
453 Ga0373937_0002848 3300036401 Bacteria 14448
454 Ga0373937_0013547 3300036401 Bacteria 7182
455 Ga0373937_0033495 3300036401 Bacteria 4666
456 Ga0373937_0039758 3300036401 Bacteria 4286
457 Ga0373937_0067697 3300036401 Bacteria 3291
458 Ga0373937_0227153 3300036401 Bacteria 1757
459 Ga0373937_0307786 3300036401 Bacteria 1498
460 Ga0373937_0625329 3300036401 Bacteria 1022
461 Ga0373925_0094048 3300037068 Bacteria 2295
462 Ga0373925_0257352 3300037068 Bacteria 1401
463 Ga0373925_0418843 3300037068 Bacteria 1094
464 Ga0395899_0012914 3300037312 Bacteria 6392
465 Ga0395899_0018107 3300037312 Bacteria 5360
466 Ga0395900_0041556 3300037418 Bacteria 4740
467 Ga0395900_0063433 3300037418 Bacteria 3798
468 Ga0395900_0183837 3300037418 Bacteria 2122
469 Ga0395900_0785651 3300037418 Bacteria 881
470 Ga0395900_1000555 3300037418 Bacteria 756
471 Ga0395898_0007528 3300037466 Bacteria 11573
472 Ga0395898_0009732 3300037466 Bacteria 10080
473 Ga0395905_0125747 3300037471 Bacteria 2411
474 Ga0395905_0387326 3300037471 Bacteria 1292
475 Ga0395905_0526040 3300037471 Bacteria 1083
476 Ga0436364_0266271 3300037853 Bacteria 210347
477 Ga0436364_0278369 3300037853 Bacteria 585
478 Ga0436364_0503141 3300037853 Bacteria 962
479 Ga0436364_0574986 3300037853 Bacteria 2579
480 Ga0436364_0694410 3300037853 Bacteria 38233
481 Ga0436364_0921350 3300037853 Bacteria 1284
482 Ga0436364_1344478 3300037853 Bacteria 3078
483 Ga0395901_0010972 3300038443 Bacteria 9178
484 Ga0395901_0029475 3300038443 Bacteria 5651
485 Ga0395901_0909090 3300038443 Bacteria 861
486 Ga0395901_1771223 3300038443 Bacteria 567
487 Ga0436365_0349736 3300039437 Bacteria 598
488 Ga0436365_0472578 3300039437 Bacteria 627
489 Ga0436365_0762128 3300039437 Bacteria 1687
490 Ga0436365_1270328 3300039437 Bacteria 771
491 Ga0436365_1498663 3300039437 Bacteria 1107
492 Ga0436365_1607597 3300039437 Bacteria 938
493 Ga0436365_1691575 3300039437 Bacteria 2097
494 Ga0436365_1717840 3300039437 Bacteria 1782
495 Ga0436360_0107958 3300039438 Bacteria 2399
496 Ga0436360_0185552 3300039438 Bacteria 992
497 Ga0436360_0213506 3300039438 Bacteria 3259
498 Ga0436360_0220240 3300039438 Bacteria 1763
499 Ga0436360_0362032 3300039438 Bacteria 15021
500 Ga0436360_0523890 3300039438 Bacteria 604
501 Ga0436360_0532696 3300039438 Bacteria 1681
502 Ga0436360_0544531 3300039438 Bacteria 1599
503 Ga0436360_0722676 3300039438 Bacteria 1222
504 Ga0436360_0811977 3300039438 Bacteria 3564
505 Ga0436360_0846745 3300039438 Bacteria 926
506 Ga0436360_0890298 3300039438 Bacteria 1199
507 Ga0436360_1217323 3300039438 Bacteria 640
508 Ga0436361_0160412 3300039447 Bacteria 1902
509 Ga0436361_0349372 3300039447 Bacteria 4018
510 Ga0436361_0459654 3300039447 Bacteria 893
511 Ga0436361_0548464 3300039447 Bacteria 2385
512 Ga0436361_1087383 3300039447 Bacteria 1358
513 Ga0436363_0206965 3300039450 Bacteria 653
514 Ga0436363_0724362 3300039450 Bacteria 1110
515 Ga0436363_1670359 3300039450 Bacteria 553
516 Ga0436363_1712732 3300039450 Bacteria 617
517 Ga0436362_0310010 3300039453 Bacteria 633
518 Ga0436362_0552323 3300039453 Bacteria 1185
519 Ga0436362_0619579 3300039453 Bacteria 1158
520 Ga0436362_1230386 3300039453 Bacteria 709
521 Ga0436362_1243951 3300039453 Bacteria 1260
522 Ga0439447_000506 3300041407 Bacteria 14503
523 Ga0439461_0144147 3300041410 Bacteria 611
524 Ga0439466_0003497 3300041411 Bacteria 6084
525 Ga0451789_0587692 3300041443 Bacteria 669
526 Ga0451845_0099901 3300041501 Bacteria 642
527 Ga0439448_0038023 3300042005 Bacteria 1548
528 Ga0439432_201494 3300042006 Bacteria 577
529 Ga0439452_000097 3300042010 Bacteria 74034
530 Ga0450902_012822 3300042137 Bacteria 1345
531 Ga0450905_039778 3300042142 Bacteria 745
532 Ga0466972_0455923 3300044658 Bacteria 601
533 Ga0466966_0968959 3300044684 Bacteria 513
534 Ga0466963_0475424 3300044694 Bacteria 882
535 Ga0466963_0680755 3300044694 Bacteria 726
536 Ga0466963_0843482 3300044694 Bacteria 646
537 Ga0466970_0496133 3300044765 Bacteria 703
538 Ga0466957_0164205 3300044842 Bacteria 1444
539 Ga0451576_0002195 3300045051 Bacteria 30092
540 Ga0466958_0447755 3300045836 Bacteria 836
541 Ga0466967_0394288 3300045976 Bacteria 1346
542 Ga0466967_1395781 3300045976 Bacteria 698
543 Ga0466967_2313715 3300045976 Bacteria 533
544 Ga0495592_0566504 3300046454 Bacteria 697
545 Ga0495651_0135202 3300046462 Bacteria 1795
546 Ga0495651_0283741 3300046462 Bacteria 1117
547 Ga0495650_0068027 3300046471 Bacteria 1406
548 Ga0495580_0529932 3300046472 Bacteria 784
549 Ga0495608_0004971 3300046511 Bacteria 9513
550 Ga0495608_0035177 3300046511 Bacteria 3380
551 Ga0495618_0159236 3300046514 Bacteria 1440
552 Ga0495628_0128019 3300046516 Bacteria 1944
553 Ga0495628_0144741 3300046516 Bacteria 1812
554 Ga0495652_0112773 3300046529 Bacteria 2183
555 Ga0495652_0210142 3300046529 Bacteria 1470
556 Ga0495640_0899280 3300046533 Bacteria 525
557 Ga0495587_0044169 3300046536 Bacteria 2651
558 Ga0495587_0047441 3300046536 Bacteria 2547
559 Ga0495667_0018054 3300046559 Bacteria 4766
560 Ga0495667_0019733 3300046559 Bacteria 4549
561 Ga0495625_0818647 3300046660 Bacteria 540
562 Ga0495635_0228593 3300046663 Bacteria 1257
563 Ga0495635_0758946 3300046663 Bacteria 627
564 Ga0495657_0383813 3300046675 Bacteria 828
565 Ga0495599_0010184 3300046678 Bacteria 5755
566 Ga0495599_0078299 3300046678 Bacteria 2064
567 Ga0495599_0447527 3300046678 Bacteria 765
568 Ga0495623_0139254 3300046679 Bacteria 1445
569 Ga0495646_0064683 3300046680 Bacteria 2167
570 Ga0495647_0288331 3300046681 Bacteria 738
571 Ga0495658_1098178 3300046683 Bacteria 507
572 Ga0495600_0137659 3300046809 Bacteria 1585
573 Ga0495600_0236438 3300046809 Bacteria 1165
574 Ga0495674_0162896 3300047319 Bacteria 1865
575 Ga0495674_0211242 3300047319 Bacteria 1607
576 Ga0495674_0898905 3300047319 Bacteria 684
577 Ga0495680_0051468 3300047322 Bacteria 3215
578 Ga0495680_0355063 3300047322 Bacteria 1020
579 Ga0495675_0043815 3300047444 Bacteria 2850
580 Ga0495684_0838773 3300047471 Bacteria 597
581 Ga0495602_0000143 3300048088 Bacteria 66782
582 Ga0495602_0302086 3300048088 Bacteria 1171
583 Ga0496109_0897786 3300048912 Bacteria 824
584 Ga0496112_0422058 3300048915 Bacteria 1273
585 Ga0496115_0160603 3300048918 Bacteria 1857
586 Ga0496115_1070106 3300048918 Bacteria 613
587 Ga0496121_0856313 3300048924 Bacteria 528
588 Ga0496122_0194255 3300048925 Bacteria 1194
589 Ga0496126_0070540 3300048929 Bacteria 3113
590 Ga0496126_0747768 3300048929 Bacteria 755
591 Ga0501034_0008484 3300049571 Bacteria 10852
592 Ga0501034_0009970 3300049571 Bacteria 9928
593 Ga0501034_0089449 3300049571 Bacteria 3077
594 Ga0501034_0224902 3300049571 Bacteria 1828
595 Ga0501036_1633522 3300049572 Bacteria 520
596 Ga0501037_0463754 3300049573 Bacteria 863
597 Ga0501038_1104453 3300049574 Bacteria 579
598 Ga0501038_1105179 3300049574 Bacteria 579
599 Ga0501039_1095738 3300049575 Bacteria 617
600 Ga0501041_0485695 3300049577 Bacteria 785
601 Ga0501042_0052983 3300049578 Bacteria 2895
602 Ga0501043_0875651 3300049579 Bacteria 645
603 Ga0501046_0054053 3300049580 Bacteria 3161
604 Ga0501047_0077209 3300049581 Bacteria 3205
605 Ga0501047_0079998 3300049581 Bacteria 3142
606 Ga0501047_0397267 3300049581 Bacteria 1212
607 Ga0501048_0554301 3300049582 Bacteria 825
608 Ga0501048_0873220 3300049582 Bacteria 647
609 Ga0501069_0821800 3300049585 Bacteria 564
610 Ga0501070_0137899 3300049586 Bacteria 2014
611 Ga0501070_0226824 3300049586 Bacteria 1531
612 Ga0501072_0246561 3300049588 Bacteria 1423
613 Ga0501073_0438393 3300049589 Bacteria 903
614 Ga0501075_1320437 3300049591 Bacteria 547
615 Ga0501080_0403010 3300049742 Bacteria 1230
616 Ga0501080_1082269 3300049742 Bacteria 693
617 Ga0501035_0664061 3300049822 Bacteria 844
618 Ga0501035_0872133 3300049822 Bacteria 715
619 Ga0501044_0078024 3300049823 Bacteria 3357
620 Ga0501044_0366907 3300049823 Bacteria 1357
621 Ga0501044_0490192 3300049823 Bacteria 1131
622 Ga0501044_0896576 3300049823 Bacteria 762
623 nmdc:mga03683_19223_c1 3300050489 Bacteria 2606
624 nmdc:mga03683_19340_c1 3300050489 Bacteria 2599
625 nmdc:mga03683_4033_c1 3300050489 Bacteria 4817
626 nmdc:mga03683_73121_c1 3300050489 Bacteria 1469
627 nmdc:mga03n38_168735_c1 3300050490 Bacteria 1113
628 nmdc:mga03n38_474206_c1 3300050490 Bacteria 699
629 nmdc:mga00v17_234283_c1 3300050491 Bacteria 1190
630 nmdc:mga00v17_569299_c1 3300050491 Bacteria 732
631 nmdc:mga00v17_609855_c1 3300050491 Bacteria 703
632 nmdc:mga0yw44_168443_c1 3300050492 Bacteria 1437
633 nmdc:mga0yw44_334275_c1 3300050492 Bacteria 1018
634 nmdc:mga0yw44_4681_c1 3300050492 Bacteria 6323
635 nmdc:mga0yw44_529186_c1 3300050492 Bacteria 800
636 nmdc:mga0k408_24954_c1 3300050493 Bacteria 3382
637 nmdc:mga0k408_259169_c1 3300050493 Bacteria 1038
638 nmdc:mga0k408_342567_c1 3300050493 Bacteria 891
639 nmdc:mga0k408_81371_c1 3300050493 Bacteria 1896
640 nmdc:mga06z11_36298_c1 3300050494 Bacteria 2433
641 nmdc:mga04h51_104065_c1 3300050495 Bacteria 1038
642 nmdc:mga07m45_17798_c1 3300050496 Bacteria 3823
643 nmdc:mga07m45_248769_c1 3300050496 Bacteria 1034
644 nmdc:mga07m45_73212_c1 3300050496 Bacteria 1950
645 nmdc:mga0sz30_201706_c1 3300050516 Bacteria 883
646 nmdc:mga0sz30_29924_c1 3300050516 Bacteria 1822
647 nmdc:mga0sz30_3630_c2 3300050516 Bacteria 3328
648 nmdc:mga0sz30_418493_c1 3300050516 Bacteria 601
649 Ga0495601_0013940 3300053077 Bacteria 4841
650 Ga0495601_0457071 3300053077 Bacteria 826
651 Ga0495601_0738730 3300053077 Bacteria 627
652 Ga0495595_0012504 3300053084 Bacteria 3570
653 Ga0495619_0016874 3300053085 Bacteria 4624
654 Ga0500646_0187259 3300053090 Bacteria 704
655 Ga0500647_0041290 3300053091 Bacteria 2213
656 Ga0500641_0000183 3300053096 Bacteria 23609
657 Ga0500650_0197948 3300053098 Bacteria 916
658 Ga0500642_0012558 3300053130 Bacteria 3078
659 Ga0500559_0059996 3300053136 Bacteria 1694
660 Ga0500573_0367916 3300053140 Unclassified 692
661 Ga0500588_0000178 3300053146 Bacteria 8711
662 Ga0500616_0013458 3300053153 Bacteria 4748
663 Ga0500620_028811 3300053155 Bacteria 1740
664 Ga0500552_000449 3300053733 Bacteria 3788
665 8054004624 8054002106 Bacteria 7987183
666 Ga0395900_0828111
667 JGI25405J52794_10034116
668 Ga0065704_10283593
669 Ga0070676_11003028
670 Ga0070676_11432135
671 Ga0070683_100200618
672 Ga0070670_101458998
673 Ga0070680_100011146
674 Ga0070680_100241464
675 Ga0070682_100296944
676 Ga0070682_101123858
677 Ga0070660_101458349
678 Ga0070660_101785357
679 Ga0070689_100386965
680 Ga0070691_10004768
681 Ga0070687_100832965
682 Ga0070661_100076995
683 Ga0070669_100063124
684 Ga0070675_100114628
685 Ga0070675_102138301
686 Ga0070671_101748467
687 Ga0070671_102094380
688 Ga0070674_100154692
689 Ga0070673_100763167
690 Ga0070688_100928285
691 Ga0070659_100037656
692 Ga0070667_100500314
693 Ga0070667_100899325
694 Ga0070714_100072203
695 Ga0070714_100353744
696 Ga0070714_101282697
697 Ga0070714_102287746
698 Ga0070713_100011746
699 Ga0070713_100110926
700 Ga0070713_100220449
701 Ga0070713_100309336
702 Ga0070710_10030737
703 Ga0070710_10059981
704 Ga0070710_10457879
705 Ga0070711_100139384
706 Ga0070711_100675859
707 Ga0070711_101554820
708 Ga0070678_100031445
709 Ga0070678_100090914
710 Ga0070662_100397411
711 Ga0070681_10007259
712 Ga0070681_10099714
713 Ga0070681_10142506
714 Ga0070681_10197634
715 Ga0070681_10371479
716 Ga0070681_11610831
717 Ga0070706_100663818
718 Ga0070706_101370366
719 Ga0070707_100072176
720 Ga0070698_100000641
721 Ga0070698_100474372
722 Ga0070698_100972051
723 Ga0070699_100179098
724 Ga0070679_100001462
725 Ga0070679_100004471
726 Ga0070679_100340059
727 Ga0070679_100786514
728 Ga0070679_101418393
729 Ga0070679_102164825
730 Ga0070684_100129754
731 Ga0070684_100867420
732 Ga0070697_100278070
733 Ga0068853_100330810
734 Ga0068853_101127355
735 Ga0070672_100048117
736 Ga0070672_101534197
737 Ga0070665_100139250
738 Ga0070665_100398548
739 Ga0070665_100498618
740 Ga0070665_100503145
741 Ga0068855_100016016
742 Ga0068855_100260762
743 Ga0068855_100592469
744 Ga0068855_102325954
745 Ga0070664_100347455
746 Ga0068857_100343133
747 Ga0068857_101341839
748 Ga0068854_100137911
749 Ga0068854_101147126
750 Ga0068856_100014010
751 Ga0068856_100145975
752 Ga0068856_100641202
753 Ga0068856_100952846
754 Ga0070702_101244607
755 Ga0068852_100087687
756 Ga0068859_100087454
757 Ga0068859_103068405
758 Ga0068864_100869617
759 Ga0068864_101958916
760 Ga0068851_10264176
761 Ga0068851_11087968
762 Ga0068858_100393281
763 Ga0068860_102440677
764 Ga0068862_100291437
765 Ga0081455_10000688
766 Ga0081455_10009381
767 Ga0081455_10365018
768 Ga0081540_1030277
769 Ga0081540_1067783
770 Ga0081539_10007016
771 Ga0081539_10010675
772 Ga0070717_10024887
773 Ga0070717_10144933
774 Ga0070717_10546151
775 Ga0070717_10792442
776 Ga0070717_11632208
777 Ga0070717_11961999
778 Ga0075365_10026742
779 Ga0075365_10242485
780 Ga0075365_10468008
781 Ga0075365_11064830
782 Ga0075368_10029075
783 Ga0075364_10219070
784 Ga0075364_10317627
785 Ga0075432_10180476
786 Ga0070715_10790982
787 Ga0070716_100193903
788 Ga0070716_101176149
789 Ga0070712_100049785
790 Ga0070712_100174596
791 Ga0070712_100435971
792 Ga0075362_10006964
793 Ga0075362_10020910
794 Ga0075362_10123776
795 Ga0075362_10140285
796 Ga0075362_10174824
797 Ga0075362_10616114
798 Ga0075367_10009522
799 Ga0075367_10029988
800 Ga0075367_10331436
801 Ga0075369_10015552
802 Ga0075369_10018239
803 Ga0075369_10231094
804 Ga0075366_10036962
805 Ga0075366_10359758
806 Ga0075366_10870653
807 Ga0097621_100485764
808 Ga0075370_10016237
809 Ga0075370_10049140
810 Ga0075370_10251888
811 Ga0068871_100776988
812 Ga0075428_100903433
813 Ga0068865_102033514
814 Ga0097620_100087451
815 Ga0097620_103068391
816 Ga0075435_100063828
817 Ga0075435_101152611
818 Ga0099794_10204513
819 Ga0099795_10004091
820 Ga0099795_10520025
821 Ga0105250_10383631
822 Ga0105240_10041196
823 Ga0105240_10226885
824 Ga0105240_10330513
825 Ga0105240_10350020
826 Ga0105240_10669165
827 Ga0105240_10887408
828 Ga0105240_11323701
829 Ga0111539_10434078
830 Ga0111539_12823958
831 Ga0105245_10203960
832 Ga0105245_11456449
833 Ga0105247_10549629
834 Ga0105247_11676759
835 Ga0105243_11013740
836 Ga0105241_10916449
837 Ga0105242_10464400
838 Ga0105248_10250080
839 Ga0105237_10167177
840 Ga0105237_11035124
841 Ga0105237_11222290
842 Ga0105238_10057501
843 Ga0105238_10196387
844 Ga0105238_10219118
845 Ga0105238_11605360
846 Ga0105238_12974812
847 Ga0105035_101266
848 Ga0099796_10003440
849 Ga0105239_10853651
850 Ga0105239_11038259
851 Ga0105239_11050471
852 Ga0105239_11437621
853 Ga0105239_11602060
854 Ga0105239_13249760
855 Ga0157373_10066839
856 Ga0157373_10102685
857 Ga0157373_10573386
858 Ga0157371_10117854
859 Ga0157371_10415541
860 Ga0157370_10019744
861 Ga0157370_10410267
862 Ga0157370_10625503
863 Ga0157369_10020086
864 Ga0157369_10350166
865 Ga0157369_10459304
866 Ga0157374_10151595
867 Ga0157374_10395854
868 Ga0157374_10624215
869 Ga0157374_11286931
870 Ga0157374_11443990
871 Ga0157378_10092332
872 Ga0157378_10323498
873 Ga0157378_11545918
874 Ga0157378_12295875
875 Ga0157372_10137200
876 Ga0157372_12696930
877 Ga0157375_12163476
878 Ga0157375_12797947
879 Ga0157515_116762
880 Ga0163163_10083133
881 Ga0163163_10840000
882 Ga0163163_11891514
883 Ga0157380_11837932
884 Ga0182008_10395070
885 Ga0182008_10550526
886 Ga0157379_10884466
887 Ga0157379_11393208
888 Ga0157379_12532557
889 Ga0157379_12563752
890 Ga0163161_10594122
891 Ga0197907_11228939
892 Ga0206355_1585110
893 Ga0206353_11950597
894 Ga0154015_1267117
895 Ga0213873_10056701
896 Ga0213872_10056033
897 Ga0213872_10242688
898 Ga0213874_10018944
899 Ga0213876_10226281
900 Ga0213875_10000253
901 Ga0213875_10001582
902 Ga0213875_10056169
903 Ga0213875_10123940
904 Ga0213871_10003685
905 Ga0213871_10010990
906 Ga0213871_10131587
907 Ga0213871_10172580
908 Ga0213871_10205762
909 Ga0224712_10050002
910 Ga0209676_1000256
911 Ga0209050_1011492
912 Ga0207426_1026821
913 Ga0207426_1049303
914 Ga0207697_10195581
915 Ga0207697_10319707
916 Ga0207656_10102313
917 Ga0207653_10034017
918 Ga0207692_10262871
919 Ga0207692_10704860
920 Ga0207642_11054872
921 Ga0207710_10621855
922 Ga0207688_10078557
923 Ga0207680_10515880
924 Ga0207647_10134893
925 Ga0207647_10374812
926 Ga0207699_10089415
927 Ga0207699_10105476
928 Ga0207699_10272901
929 Ga0207645_10817055
930 Ga0207643_10450241
931 Ga0207705_10099719
932 Ga0207705_10150357
933 Ga0207684_10271395
934 Ga0207684_10572679
935 Ga0207684_11177093
936 Ga0207707_10015024
937 Ga0207707_10183121
938 Ga0207707_10253734
939 Ga0207707_10261457
940 Ga0207707_10375367
941 Ga0207695_10234562
942 Ga0207695_10243724
943 Ga0207695_10270929
944 Ga0207695_10442983
945 Ga0207671_10244839
946 Ga0207671_11538467
947 Ga0207693_10001602
948 Ga0207693_10005635
949 Ga0207693_10033797
950 Ga0207693_10067257
951 Ga0207693_10305738
952 Ga0207693_10828333
953 Ga0207663_10036453
954 Ga0207663_10252127
955 Ga0207663_10433005
956 Ga0207663_10518933
957 Ga0207660_10090086
958 Ga0207660_10153117
959 Ga0207660_10281049
960 Ga0207660_10514987
961 Ga0207660_10784176
962 Ga0207662_10675507
963 Ga0207657_10310018
964 Ga0207657_11514352
965 Ga0207649_10069979
966 Ga0207652_10036904
967 Ga0207652_10111086
968 Ga0207652_10152348
969 Ga0207652_10202211
970 Ga0207652_10995018
971 Ga0207652_11020728
972 Ga0207652_11616747
973 Ga0207646_11071323
974 Ga0207681_10645849
975 Ga0207694_10262322
976 Ga0207694_10584148
977 Ga0207694_10932248
978 Ga0207659_10096793
979 Ga0207687_10379221
980 Ga0207700_10073917
981 Ga0207700_10123102
982 Ga0207700_10294079
983 Ga0207700_10622409
984 Ga0207700_11322383
985 Ga0207700_11704458
986 Ga0207664_10014469
987 Ga0207664_10971621
988 Ga0207664_11382384
989 Ga0207664_11760750
990 Ga0207664_11879993
991 Ga0207644_10433186
992 Ga0207644_11107021
993 Ga0207644_11756465
994 Ga0207690_10087281
995 Ga0207690_11767929
996 Ga0207706_11450020
997 Ga0207686_10907029
998 Ga0207670_10330746
999 Ga0207670_10439093
1000 Ga0207669_10223824
1001 Ga0207669_11591070
1002 Ga0207704_11907057
1003 Ga0207665_10272026
1004 Ga0207665_10445632
1005 Ga0207691_10568881
1006 Ga0207691_10618568
1007 Ga0207661_12140621
1008 Ga0207679_10094505
1009 Ga0207679_10630758
1010 Ga0207679_10893511
1011 Ga0207667_10021411
1012 Ga0207667_10330034
1013 Ga0207667_10858444
1014 Ga0207651_10668400
1015 Ga0207651_11490695
1016 Ga0207640_10112810
1017 Ga0207640_10173737
1018 Ga0207640_10713513
1019 Ga0207640_11066982
1020 Ga0207677_10423435
1021 Ga0207677_10888627
1022 Ga0207703_10444773
1023 Ga0207639_11933471
1024 Ga0207708_10626029
1025 Ga0207708_12036747
1026 Ga0207702_10119240
1027 Ga0207702_10143221
1028 Ga0207702_10213966
1029 Ga0207702_11381849
1030 Ga0207702_11539940
1031 Ga0207702_11651298
1032 Ga0207641_11177140
1033 Ga0207648_10527645
1034 Ga0207648_10701061
1035 Ga0207676_10607945
1036 Ga0207676_10999404
1037 Ga0207674_10177351
1038 Ga0207674_11213394
1039 Ga0207674_11495557
1040 Ga0207675_100916825
1041 Ga0207683_10116426
1042 Ga0207683_10374681
1043 Ga0207698_11233143
1044 Ga0209813_10031933
1045 Ga0207428_10665262
1046 Ga0268266_10011062
1047 Ga0268266_10883551
1048 Ga0268265_11067695
1049 Ga0268264_12689801
1050 Ga0307517_10008012
1051 Ga0265338_10110497
1052 Ga0265764_114217
1053 Ga0265332_10080306
1054 Ga0265340_10331267
1055 Ga0265340_10428710
1056 Ga0265339_10244811
1057 Ga0265339_10306235
1058 Ga0265327_10016206
1059 Ga0265327_10077979
1060 Ga0265316_10155618
1061 Ga0307513_10453174
1062 Ga0265313_10068075
1063 Ga0265314_10224550
1064 Ga0265342_10131690
1065 Ga0307406_11266050
1066 Ga0307412_10780127
1067 Ga0307409_101551262
1068 Ga0307416_100434725
1069 Ga0316053_108997
1070 Ga0373926_0138843
1071 Ga0373940_0354956
1072 Ga0373944_0248171
1073 Ga0373952_0224197
1074 Ga0373932_0272048
1075 Ga0373936_0046845
1076 Ga0373936_0400881
1077 Ga0373941_0163214
1078 Ga0373945_0165035
1079 Ga0373945_0343941
1080 Ga0373945_0471102
1081 Ga0373953_0023627
1082 Ga0373954_0063587
1083 Ga0373956_0119709
1084 Ga0373957_0255623
1085 Ga0373957_0490840
1086 Ga0373957_0504062
1087 Ga0373943_0066903
1088 Ga0373943_0526444
1089 Ga0373946_0343762
1090 Ga0373946_0515281
1091 Ga0373955_0029777
1092 Ga0373955_0042579
1093 Ga0373955_0144379
1094 Ga0373955_0306388
1095 Ga0373955_0578731
1096 Ga0373955_0675506
1097 Ga0373942_0112719
1098 Ga0373924_0026438
1099 Ga0373924_0142703
1100 Ga0373931_0574963
1101 Ga0373931_0810819
1102 Ga0373935_0279179
1103 Ga0373935_0331225
1104 Ga0373927_0051388
1105 Ga0373927_0136058
1106 Ga0373927_0235275
1107 Ga0373927_0949559
1108 Ga0373927_1087803
1109 Ga0373927_1177878
1110 Ga0373933_0023266
1111 Ga0373933_0025398
1112 Ga0373933_0036405
1113 Ga0373933_0352553
1114 Ga0373947_0063328
1115 Ga0373947_0113888
1116 Ga0373947_0380510
1117 Ga0373947_0723966
1118 Ga0373937_0002848
1119 Ga0373937_0013547
1120 Ga0373937_0033495
1121 Ga0373937_0039758
1122 Ga0373937_0067697
1123 Ga0373937_0227153
1124 Ga0373937_0307786
1125 Ga0373937_0625329
1126 Ga0373925_0094048
1127 Ga0373925_0257352
1128 Ga0373925_0418843
1129 Ga0395899_0012914
1130 Ga0395899_0018107
1131 Ga0395900_0041556
1132 Ga0395900_0063433
1133 Ga0395900_0183837
1134 Ga0395900_0785651
1135 Ga0395900_1000555
1136 Ga0395898_0007528
1137 Ga0395898_0009732
1138 Ga0395905_0125747
1139 Ga0395905_0387326
1140 Ga0395905_0526040
1141 Ga0436364_0266271
1142 Ga0436364_0278369
1143 Ga0436364_0503141
1144 Ga0436364_0574986
1145 Ga0436364_0694410
1146 Ga0436364_0921350
1147 Ga0436364_1344478
1148 Ga0395901_0010972
1149 Ga0395901_0029475
1150 Ga0395901_0909090
1151 Ga0395901_1771223
1152 Ga0436365_0349736
1153 Ga0436365_0472578
1154 Ga0436365_0762128
1155 Ga0436365_1270328
1156 Ga0436365_1498663
1157 Ga0436365_1607597
1158 Ga0436365_1691575
1159 Ga0436365_1717840
1160 Ga0436360_0107958
1161 Ga0436360_0185552
1162 Ga0436360_0213506
1163 Ga0436360_0220240
1164 Ga0436360_0362032
1165 Ga0436360_0523890
1166 Ga0436360_0532696
1167 Ga0436360_0544531
1168 Ga0436360_0722676
1169 Ga0436360_0811977
1170 Ga0436360_0846745
1171 Ga0436360_0890298
1172 Ga0436360_1217323
1173 Ga0436361_0160412
1174 Ga0436361_0349372
1175 Ga0436361_0459654
1176 Ga0436361_0548464
1177 Ga0436361_1087383
1178 Ga0436363_0206965
1179 Ga0436363_0724362
1180 Ga0436363_1670359
1181 Ga0436363_1712732
1182 Ga0436362_0310010
1183 Ga0436362_0552323
1184 Ga0436362_0619579
1185 Ga0436362_1230386
1186 Ga0436362_1243951
1187 Ga0439447_000506
1188 Ga0439461_0144147
1189 Ga0439466_0003497
1190 Ga0451789_0587692
1191 Ga0451845_0099901
1192 Ga0439448_0038023
1193 Ga0439432_201494
1194 Ga0439452_000097
1195 Ga0450902_012822
1196 Ga0450905_039778
1197 Ga0466972_0455923
1198 Ga0466966_0968959
1199 Ga0466963_0475424
1200 Ga0466963_0680755
1201 Ga0466963_0843482
1202 Ga0466970_0496133
1203 Ga0466957_0164205
1204 Ga0451576_0002195
1205 Ga0466958_0447755
1206 Ga0466967_0394288
1207 Ga0466967_1395781
1208 Ga0466967_2313715
1209 Ga0495592_0566504
1210 Ga0495651_0135202
1211 Ga0495651_0283741
1212 Ga0495650_0068027
1213 Ga0495580_0529932
1214 Ga0495608_0004971
1215 Ga0495608_0035177
1216 Ga0495618_0159236
1217 Ga0495628_0128019
1218 Ga0495628_0144741
1219 Ga0495652_0112773
1220 Ga0495652_0210142
1221 Ga0495640_0899280
1222 Ga0495587_0044169
1223 Ga0495587_0047441
1224 Ga0495667_0018054
1225 Ga0495667_0019733
1226 Ga0495625_0818647
1227 Ga0495635_0228593
1228 Ga0495635_0758946
1229 Ga0495657_0383813
1230 Ga0495599_0010184
1231 Ga0495599_0078299
1232 Ga0495599_0447527
1233 Ga0495623_0139254
1234 Ga0495646_0064683
1235 Ga0495647_0288331
1236 Ga0495658_1098178
1237 Ga0495600_0137659
1238 Ga0495600_0236438
1239 Ga0495674_0162896
1240 Ga0495674_0211242
1241 Ga0495674_0898905
1242 Ga0495680_0051468
1243 Ga0495680_0355063
1244 Ga0495675_0043815
1245 Ga0495684_0838773
1246 Ga0495602_0000143
1247 Ga0495602_0302086
1248 Ga0496109_0897786
1249 Ga0496112_0422058
1250 Ga0496115_0160603
1251 Ga0496115_1070106
1252 Ga0496121_0856313
1253 Ga0496122_0194255
1254 Ga0496126_0070540
1255 Ga0496126_0747768
1256 Ga0501034_0008484
1257 Ga0501034_0009970
1258 Ga0501034_0089449
1259 Ga0501034_0224902
1260 Ga0501036_1633522
1261 Ga0501037_0463754
1262 Ga0501038_1104453
1263 Ga0501038_1105179
1264 Ga0501039_1095738
1265 Ga0501041_0485695
1266 Ga0501042_0052983
1267 Ga0501043_0875651
1268 Ga0501046_0054053
1269 Ga0501047_0077209
1270 Ga0501047_0079998
1271 Ga0501047_0397267
1272 Ga0501048_0554301
1273 Ga0501048_0873220
1274 Ga0501069_0821800
1275 Ga0501070_0137899
1276 Ga0501070_0226824
1277 Ga0501072_0246561
1278 Ga0501073_0438393
1279 Ga0501075_1320437
1280 Ga0501080_0403010
1281 Ga0501080_1082269
1282 Ga0501035_0664061
1283 Ga0501035_0872133
1284 Ga0501044_0078024
1285 Ga0501044_0366907
1286 Ga0501044_0490192
1287 Ga0501044_0896576
1288 nmdc:mga03683_19223_c1
1289 nmdc:mga03683_19340_c1
1290 nmdc:mga03683_4033_c1
1291 nmdc:mga03683_73121_c1
1292 nmdc:mga03n38_168735_c1
1293 nmdc:mga03n38_474206_c1
1294 nmdc:mga00v17_234283_c1
1295 nmdc:mga00v17_569299_c1
1296 nmdc:mga00v17_609855_c1
1297 nmdc:mga0yw44_168443_c1
1298 nmdc:mga0yw44_334275_c1
1299 nmdc:mga0yw44_4681_c1
1300 nmdc:mga0yw44_529186_c1
1301 nmdc:mga0k408_24954_c1
1302 nmdc:mga0k408_259169_c1
1303 nmdc:mga0k408_342567_c1
1304 nmdc:mga0k408_81371_c1
1305 nmdc:mga06z11_36298_c1
1306 nmdc:mga04h51_104065_c1
1307 nmdc:mga07m45_17798_c1
1308 nmdc:mga07m45_248769_c1
1309 nmdc:mga07m45_73212_c1
1310 nmdc:mga0sz30_201706_c1
1311 nmdc:mga0sz30_29924_c1
1312 nmdc:mga0sz30_3630_c2
1313 nmdc:mga0sz30_418493_c1
1314 Ga0495601_0013940
1315 Ga0495601_0457071
1316 Ga0495601_0738730
1317 Ga0495595_0012504
1318 Ga0495619_0016874
1319 Ga0500646_0187259
1320 Ga0500647_0041290
1321 Ga0500641_0000183
1322 Ga0500650_0197948
1323 Ga0500642_0012558
1324 Ga0500559_0059996
1325 Ga0500573_0367916
1326 Ga0500588_0000178
1327 Ga0500616_0013458
1328 Ga0500620_028811
1329 Ga0500552_000449
1330 8054004624

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00111

Fer2

2Fe-2S iron-sulfur cluster binding domain

26

109

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2y5c-assembly2.cif.gz_B structure of human ferredoxin 2 (fdx2)in complex with 2fe2s cluster 0.9781 2 105
2wlb-assembly2.cif.gz_B adrenodoxin-like ferredoxin etp1fd(516-618) of schizosaccharomyces pombe mitochondria 0.9701 1 101
6nbl-assembly2.cif.gz_D cytochrome p450cam-putidaredoxin complex bound to camphor and cyanide 0.9648 1 105
1r7s-assembly3.cif.gz_C putidaredoxin (fe2s2 ferredoxin), c73g mutant 0.9648 3 105
1xlq-assembly4.cif.gz_A crystal structure of reduced c73s putidaredoxin from pseudomonas putida 0.9648 3 105
ID Description Score Start End Superfamily
af_A4I756_34_144_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9741 2 104 3.10.20.30
2wlbB00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9701 1 101 3.10.20.30
af_A4I234_54_172_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9683 2 110 3.10.20.30
af_Q9CPW2_55_168_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9641 2 111 3.10.20.30
1uwmA00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9626 3 105 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A522VJV4-F1-model_v4 2Fe-2S iron-sulfur cluster binding domain-containing protein 0.9998 1 86 GO:0009055
GO:0051537
GO:0140647
AF-A0A2V1AYS2-F1-model_v4 2Fe-2S ferredoxin-type domain-containing protein 0.9984 2 106 GO:0005739
GO:0009055
GO:0051537
GO:0140647
AF-A0A4P7WBU6-F1-model_v4 2Fe-2S ferredoxin 0.9981 1 101 GO:0009055
GO:0051537
GO:0140647
AF-K5ZL87-F1-model_v4 (2Fe-2S) ferredoxin 0.9974 1 108 GO:0009055
GO:0051537
GO:0140647
AF-A0A0F3MDW9-F1-model_v4 2Fe-2S ferredoxin (Adrenodoxin-like protein) 0.9974 16 109 GO:0009055
GO:0051537
GO:0140647

Map