F473630

General Info

Members Datasets Scaffolds Average Seq Length
664 287 1328 108

Family's Representative Sequence

Representative Sequence 3300025927|Ga0207687_11720748|Ga0207687_117207481
Length 135
Sequence VELRSIPRAEECLREPGLTPHSTLGQPVSLYQLQKFLFDINRDPSVQAEYRKDAAALVQRYDLTGEERDAIVGGDVGLIYVLGANGQLLMHFAAFLGMPWPAYIQSMRDGITKHGPVRAGIYAMTTTVDERVAGV

Samples

Sample ID Description Type Environment
1 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
111 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
112 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
113 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
172 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
176 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
177 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
178 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
179 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
180 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
181 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
182 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
183 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
184 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
185 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
186 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
187 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
188 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
189 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
190 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
191 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
192 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
193 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
194 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
195 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
196 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
197 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
198 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
199 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
200 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
201 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
202 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
203 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
204 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
205 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
206 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
207 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
208 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
209 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
210 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
211 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
212 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
213 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
214 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
215 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
216 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
217 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
218 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
219 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
220 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
221 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
222 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
223 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
224 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
225 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
226 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
227 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
228 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
229 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
230 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
231 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
232 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
233 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
234 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
235 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
236 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
237 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
238 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
239 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
240 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
241 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
242 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
243 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
244 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
245 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
246 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
247 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
248 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
249 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
250 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
251 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
252 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
253 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
254 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
255 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
256 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
257 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
258 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
259 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
260 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
261 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
262 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
263 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
264 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
265 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
266 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
267 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
268 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
269 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
270 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
271 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
272 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
273 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
274 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
275 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
276 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
277 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
278 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
279 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
280 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
281 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
282 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
283 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
284 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
285 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
286 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
287 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.05
Nodule 0
Rhizoplane 4.97
Rhizosphere 87.2
Stem 0
Stem Tuber 0
Unclassified 1.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207687_11720748 3300025927 Unclassified 537
2 rootH1_10087932 3300003316 Bacteria 3040
3 rootH1_10223287 3300003323 Bacteria 1615
4 Ga0065715_10868782 3300005293 Bacteria 583
5 Ga0070658_10058245 3300005327 Bacteria 3143
6 Ga0070676_10001193 3300005328 Bacteria 13017
7 Ga0070676_10061318 3300005328 Bacteria 2235
8 Ga0070690_100023785 3300005330 Bacteria 3761
9 Ga0070670_100088009 3300005331 Bacteria 2669
10 Ga0070670_100364841 3300005331 Bacteria 1270
11 Ga0068869_100008881 3300005334 Bacteria 6502
12 Ga0068869_100180035 3300005334 Bacteria 1657
13 Ga0068869_100260480 3300005334 Bacteria 1388
14 Ga0068869_101544150 3300005334 Bacteria 590
15 Ga0070666_10016357 3300005335 Bacteria 4745
16 Ga0070666_10250550 3300005335 Bacteria 1254
17 Ga0070666_10480412 3300005335 Bacteria 900
18 Ga0070666_10725556 3300005335 Bacteria 729
19 Ga0068868_100033358 3300005338 Bacteria 3968
20 Ga0068868_100037419 3300005338 Bacteria 3761
21 Ga0068868_100057205 3300005338 Bacteria 3080
22 Ga0068868_100508057 3300005338 Bacteria 1057
23 Ga0068868_100600942 3300005338 Bacteria 975
24 Ga0070660_100272505 3300005339 Bacteria 1384
25 Ga0070660_101571650 3300005339 Unclassified 560
26 Ga0070687_100007934 3300005343 Bacteria 4467
27 Ga0070687_100019914 3300005343 Bacteria 3130
28 Ga0070661_100193281 3300005344 Bacteria 1552
29 Ga0070668_100011629 3300005347 Bacteria 6550
30 Ga0070668_100249883 3300005347 Bacteria 1472
31 Ga0070668_100340534 3300005347 Bacteria 1267
32 Ga0070669_100002367 3300005353 Bacteria 13623
33 Ga0070675_100011312 3300005354 Bacteria 6985
34 Ga0070675_100099523 3300005354 Bacteria 2448
35 Ga0070675_100164626 3300005354 Bacteria 1909
36 Ga0070671_100040861 3300005355 Bacteria 3853
37 Ga0070671_100177872 3300005355 Bacteria 1801
38 Ga0070671_100227502 3300005355 Bacteria 1582
39 Ga0070674_100011846 3300005356 Bacteria 5327
40 Ga0070673_100065535 3300005364 Bacteria 2898
41 Ga0070673_100111068 3300005364 Bacteria 2273
42 Ga0070673_101853580 3300005364 Bacteria 572
43 Ga0070688_101292433 3300005365 Bacteria 589
44 Ga0070667_100006347 3300005367 Bacteria 9828
45 Ga0070667_100021852 3300005367 Bacteria 5309
46 Ga0070667_100062297 3300005367 Bacteria 3159
47 Ga0070703_10091578 3300005406 Bacteria 1055
48 Ga0070709_10008951 3300005434 Bacteria 5512
49 Ga0070709_10009829 3300005434 Bacteria 5284
50 Ga0070709_10097474 3300005434 Bacteria 1952
51 Ga0070714_101968348 3300005435 Bacteria 570
52 Ga0070713_100020089 3300005436 Bacteria 5113
53 Ga0070713_100236442 3300005436 Bacteria 1662
54 Ga0070713_102479022 3300005436 Bacteria 501
55 Ga0070710_10009597 3300005437 Bacteria 4738
56 Ga0070710_10158890 3300005437 Bacteria 1400
57 Ga0070710_11180771 3300005437 Bacteria 565
58 Ga0070701_10191357 3300005438 Bacteria 1204
59 Ga0070701_10343058 3300005438 Bacteria 931
60 Ga0070711_100010261 3300005439 Bacteria 5794
61 Ga0070711_100031956 3300005439 Bacteria 3497
62 Ga0070711_100454595 3300005439 Bacteria 1049
63 Ga0070705_100052220 3300005440 Bacteria 2387
64 Ga0070700_100022638 3300005441 Bacteria 3668
65 Ga0070663_100363466 3300005455 Bacteria 1175
66 Ga0070678_100062679 3300005456 Bacteria 2747
67 Ga0070678_101037050 3300005456 Bacteria 755
68 Ga0070678_101061737 3300005456 Bacteria 746
69 Ga0070678_101474082 3300005456 Bacteria 637
70 Ga0070662_100006522 3300005457 Bacteria 7527
71 Ga0070662_100039098 3300005457 Bacteria 3373
72 Ga0070662_100596654 3300005457 Bacteria 929
73 Ga0070662_100685358 3300005457 Bacteria 866
74 Ga0070681_10000724 3300005458 Bacteria 27343
75 Ga0070681_10089383 3300005458 Bacteria 3032
76 Ga0070681_10493968 3300005458 Bacteria 1137
77 Ga0068867_100016369 3300005459 Bacteria 5263
78 Ga0068867_100020809 3300005459 Bacteria 4677
79 Ga0068867_100414153 3300005459 Bacteria 1140
80 Ga0070685_11053051 3300005466 Bacteria 613
81 Ga0070699_100311680 3300005518 Bacteria 1413
82 Ga0070679_100216994 3300005530 Bacteria 1875
83 Ga0070697_101460286 3300005536 Bacteria 611
84 Ga0068853_100080478 3300005539 Bacteria 2850
85 Ga0068853_100117399 3300005539 Bacteria 2370
86 Ga0068853_100484817 3300005539 Bacteria 1166
87 Ga0068853_100552496 3300005539 Bacteria 1091
88 Ga0068853_100949346 3300005539 Bacteria 827
89 Ga0068853_101110452 3300005539 Bacteria 763
90 Ga0070672_100031384 3300005543 Bacteria 3998
91 Ga0070672_100098796 3300005543 Bacteria 2364
92 Ga0070672_100457068 3300005543 Bacteria 1100
93 Ga0070672_100481208 3300005543 Bacteria 1072
94 Ga0070672_100618382 3300005543 Bacteria 944
95 Ga0070695_100017023 3300005545 Bacteria 4408
96 Ga0070696_100499998 3300005546 Bacteria 967
97 Ga0070696_100811411 3300005546 Bacteria 771
98 Ga0070693_100081656 3300005547 Bacteria 1929
99 Ga0070665_100062004 3300005548 Bacteria 3749
100 Ga0070665_100083921 3300005548 Bacteria 3190
101 Ga0070665_100125399 3300005548 Bacteria 2570
102 Ga0070665_100197658 3300005548 Bacteria 2012
103 Ga0070665_100216021 3300005548 Bacteria 1918
104 Ga0070704_101295385 3300005549 Bacteria 666
105 Ga0068855_100003440 3300005563 Bacteria 19371
106 Ga0068855_100150790 3300005563 Bacteria 2644
107 Ga0068855_100325112 3300005563 Bacteria 1699
108 Ga0068855_100410968 3300005563 Bacteria 1481
109 Ga0068855_100438607 3300005563 Bacteria 1427
110 Ga0070664_100199409 3300005564 Bacteria 1785
111 Ga0070664_100227755 3300005564 Bacteria 1670
112 Ga0070664_100291015 3300005564 Bacteria 1475
113 Ga0070664_101567598 3300005564 Bacteria 624
114 Ga0068857_100256939 3300005577 Bacteria 1603
115 Ga0068857_100737104 3300005577 Bacteria 938
116 Ga0068854_100093841 3300005578 Bacteria 2237
117 Ga0068854_100144663 3300005578 Bacteria 1828
118 Ga0068854_100211815 3300005578 Bacteria 1529
119 Ga0068856_100032302 3300005614 Bacteria 5124
120 Ga0068856_100444026 3300005614 Bacteria 1318
121 Ga0068856_100565288 3300005614 Bacteria 1158
122 Ga0068856_100752886 3300005614 Bacteria 994
123 Ga0068856_100881598 3300005614 Bacteria 914
124 Ga0070702_100200532 3300005615 Bacteria 1320
125 Ga0068852_100006288 3300005616 Bacteria 8574
126 Ga0068852_100050291 3300005616 Bacteria 3570
127 Ga0068852_100365416 3300005616 Bacteria 1412
128 Ga0068852_100776073 3300005616 Bacteria 971
129 Ga0068859_100013199 3300005617 Bacteria 8294
130 Ga0068864_100009739 3300005618 Bacteria 7925
131 Ga0068864_100365955 3300005618 Bacteria 1363
132 Ga0068866_10005225 3300005718 Bacteria 5348
133 Ga0068866_10062555 3300005718 Bacteria 1937
134 Ga0068866_10779404 3300005718 Bacteria 663
135 Ga0068861_100021259 3300005719 Bacteria 4663
136 Ga0068861_101380430 3300005719 Bacteria 687
137 Ga0068851_10054556 3300005834 Bacteria 2036
138 Ga0068870_10273170 3300005840 Bacteria 1057
139 Ga0068863_100005528 3300005841 Bacteria 12426
140 Ga0068863_100050229 3300005841 Bacteria 3954
141 Ga0068863_100098807 3300005841 Bacteria 2772
142 Ga0068863_100143563 3300005841 Bacteria 2283
143 Ga0068863_101491807 3300005841 Bacteria 685
144 Ga0068863_101999546 3300005841 Bacteria 590
145 Ga0068863_102083188 3300005841 Bacteria 577
146 Ga0068858_100003274 3300005842 Bacteria 16136
147 Ga0068858_100003858 3300005842 Bacteria 14819
148 Ga0068858_100005753 3300005842 Bacteria 12113
149 Ga0068858_100032405 3300005842 Bacteria 4853
150 Ga0068860_100000371 3300005843 Bacteria 59118
151 Ga0068860_100009677 3300005843 Bacteria 9574
152 Ga0068860_100037950 3300005843 Bacteria 4610
153 Ga0068860_100121111 3300005843 Bacteria 2505
154 Ga0068862_100007872 3300005844 Bacteria 8816
155 Ga0070717_10082097 3300006028 Bacteria 2707
156 Ga0070717_11137262 3300006028 Bacteria 711
157 Ga0070715_10002944 3300006163 Bacteria 5319
158 Ga0070716_100010004 3300006173 Bacteria 4742
159 Ga0070716_100019797 3300006173 Bacteria 3523
160 Ga0070716_100365379 3300006173 Bacteria 1026
161 Ga0070716_101496035 3300006173 Bacteria 552
162 Ga0070712_100051430 3300006175 Bacteria 2870
163 Ga0070712_100149499 3300006175 Bacteria 1792
164 Ga0075366_10166849 3300006195 Bacteria 1335
165 Ga0097621_101059977 3300006237 Bacteria 760
166 Ga0097621_101583592 3300006237 Bacteria 623
167 Ga0075370_10010367 3300006353 Bacteria 4871
168 Ga0068871_100075407 3300006358 Bacteria 2784
169 Ga0068871_100197283 3300006358 Bacteria 1736
170 Ga0068871_100641656 3300006358 Bacteria 969
171 Ga0068871_100660621 3300006358 Bacteria 955
172 Ga0068871_101506572 3300006358 Bacteria 636
173 Ga0075431_100075610 3300006847 Bacteria 3475
174 Ga0075434_100142501 3300006871 Bacteria 2417
175 Ga0075429_100192334 3300006880 Bacteria 1787
176 Ga0068865_100005470 3300006881 Bacteria 7706
177 Ga0068865_100016694 3300006881 Bacteria 4704
178 Ga0068865_101652744 3300006881 Bacteria 577
179 Ga0075436_100228980 3300006914 Bacteria 1320
180 Ga0097620_100013199 3300006931 Bacteria 8294
181 Ga0075435_100004686 3300007076 Bacteria 9430
182 Ga0075435_101630634 3300007076 Bacteria 566
183 Ga0099795_10005529 3300007788 Bacteria 3370
184 Ga0105240_10000712 3300009093 Bacteria 60926
185 Ga0105240_10008152 3300009093 Bacteria 15024
186 Ga0105240_11039011 3300009093 Bacteria 874
187 Ga0105240_11100164 3300009093 Bacteria 846
188 Ga0105240_11282320 3300009093 Bacteria 773
189 Ga0105240_11474454 3300009093 Bacteria 714
190 Ga0105240_11876366 3300009093 Unclassified 624
191 Ga0105245_10032762 3300009098 Bacteria 4601
192 Ga0105245_10101785 3300009098 Bacteria 2660
193 Ga0105245_11466322 3300009098 Bacteria 733
194 Ga0105247_10008264 3300009101 Bacteria 6352
195 Ga0105247_11545011 3300009101 Bacteria 543
196 Ga0114129_10094594 3300009147 Bacteria 4138
197 Ga0105243_10023422 3300009148 Bacteria 4702
198 Ga0105241_10053146 3300009174 Bacteria 3096
199 Ga0105241_10272515 3300009174 Bacteria 1442
200 Ga0105241_10351118 3300009174 Bacteria 1280
201 Ga0105241_10673492 3300009174 Bacteria 942
202 Ga0105241_10835171 3300009174 Bacteria 851
203 Ga0105241_11190029 3300009174 Bacteria 721
204 Ga0105241_11261352 3300009174 Bacteria 702
205 Ga0105242_10019647 3300009176 Bacteria 5295
206 Ga0105242_10243538 3300009176 Bacteria 1617
207 Ga0105242_11302484 3300009176 Bacteria 750
208 Ga0105248_10210110 3300009177 Bacteria 2193
209 Ga0105248_10275255 3300009177 Bacteria 1895
210 Ga0105248_10329373 3300009177 Bacteria 1720
211 Ga0105248_13315166 3300009177 Unclassified 512
212 Ga0105237_10019287 3300009545 Bacteria 7046
213 Ga0105237_10085100 3300009545 Bacteria 3152
214 Ga0105237_10210844 3300009545 Bacteria 1943
215 Ga0105237_10327042 3300009545 Bacteria 1537
216 Ga0105237_10628704 3300009545 Bacteria 1080
217 Ga0105237_10687914 3300009545 Bacteria 1029
218 Ga0105237_11535123 3300009545 Bacteria 673
219 Ga0105238_10002359 3300009551 Bacteria 18986
220 Ga0105238_10006292 3300009551 Bacteria 11800
221 Ga0105238_10426961 3300009551 Bacteria 1321
222 Ga0105238_10476500 3300009551 Bacteria 1247
223 Ga0105238_10526023 3300009551 Bacteria 1185
224 Ga0105238_10717426 3300009551 Bacteria 1012
225 Ga0105238_10822901 3300009551 Unclassified 945
226 Ga0105238_10936337 3300009551 Bacteria 886
227 Ga0105238_11300767 3300009551 Bacteria 753
228 Ga0105249_10008114 3300009553 Bacteria 9154
229 Ga0105249_10022034 3300009553 Bacteria 5706
230 Ga0105249_10121918 3300009553 Bacteria 2479
231 Ga0099796_10002453 3300010159 Bacteria 4067
232 Ga0105239_10015567 3300010375 Bacteria 8422
233 Ga0105239_10189406 3300010375 Bacteria 2303
234 Ga0105239_10276094 3300010375 Bacteria 1891
235 Ga0105239_11728951 3300010375 Bacteria 724
236 Ga0105239_12533504 3300010375 Bacteria 598
237 Ga0105246_10622157 3300011119 Bacteria 936
238 Ga0157326_1037914 3300012513 Bacteria 665
239 Ga0157373_11027660 3300013100 Bacteria 616
240 Ga0157370_10094345 3300013104 Bacteria 2807
241 Ga0157370_10413836 3300013104 Bacteria 1241
242 Ga0157369_10194777 3300013105 Bacteria 2129
243 Ga0157369_10213505 3300013105 Bacteria 2022
244 Ga0157369_11248909 3300013105 Bacteria 758
245 Ga0157369_11862287 3300013105 Bacteria 611
246 Ga0157374_10076872 3300013296 Bacteria 3157
247 Ga0157374_10107643 3300013296 Bacteria 2679
248 Ga0157374_11831096 3300013296 Unclassified 632
249 Ga0157378_10049543 3300013297 Bacteria 3737
250 Ga0157378_10429405 3300013297 Bacteria 1307
251 Ga0157378_10490653 3300013297 Bacteria 1225
252 Ga0157378_12356846 3300013297 Bacteria 584
253 Ga0157378_12365691 3300013297 Bacteria 583
254 Ga0163162_10047167 3300013306 Bacteria 4318
255 Ga0163162_10248607 3300013306 Bacteria 1910
256 Ga0163162_10593213 3300013306 Bacteria 1234
257 Ga0163162_10633380 3300013306 Bacteria 1194
258 Ga0163162_10790674 3300013306 Bacteria 1067
259 Ga0157372_13031163 3300013307 Bacteria 537
260 Ga0157372_13039375 3300013307 Bacteria 536
261 Ga0157375_10007068 3300013308 Bacteria 9800
262 Ga0157375_10081353 3300013308 Bacteria 3279
263 Ga0157375_10185298 3300013308 Bacteria 2234
264 Ga0157375_10466772 3300013308 Bacteria 1428
265 Ga0157375_10674207 3300013308 Bacteria 1189
266 Ga0157375_10842278 3300013308 Bacteria 1064
267 Ga0163163_10100384 3300014325 Bacteria 2916
268 Ga0163163_10229512 3300014325 Bacteria 1905
269 Ga0163163_10577324 3300014325 Bacteria 1187
270 Ga0163163_10745617 3300014325 Bacteria 1043
271 Ga0163163_11008138 3300014325 Bacteria 896
272 Ga0157380_10004143 3300014326 Bacteria 10022
273 Ga0157380_10048859 3300014326 Bacteria 3334
274 Ga0157377_11021937 3300014745 Bacteria 628
275 Ga0157379_10003267 3300014968 Bacteria 13732
276 Ga0157379_10023282 3300014968 Bacteria 5495
277 Ga0157379_10133553 3300014968 Bacteria 2235
278 Ga0157379_10335195 3300014968 Bacteria 1383
279 Ga0157379_12437521 3300014968 Bacteria 522
280 Ga0157376_10005942 3300014969 Bacteria 8575
281 Ga0157376_10264782 3300014969 Bacteria 1612
282 Ga0157376_11038468 3300014969 Bacteria 843
283 Ga0157376_11099422 3300014969 Bacteria 821
284 Ga0157376_11133485 3300014969 Bacteria 809
285 Ga0163161_10054732 3300017792 Bacteria 2896
286 Ga0163161_10534943 3300017792 Bacteria 958
287 Ga0213874_10038642 3300021377 Bacteria 1418
288 Ga0213874_10044809 3300021377 Bacteria 1337
289 Ga0213874_10392371 3300021377 Bacteria 539
290 Ga0213876_10150932 3300021384 Bacteria 1236
291 Ga0213871_10010477 3300021441 Bacteria 2104
292 Ga0213871_10106902 3300021441 Bacteria 824
293 Ga0207656_10550428 3300025321 Bacteria 588
294 Ga0207682_10017573 3300025893 Bacteria 2793
295 Ga0207682_10038836 3300025893 Bacteria 1933
296 Ga0207642_10063543 3300025899 Bacteria 1727
297 Ga0207642_10091721 3300025899 Bacteria 1502
298 Ga0207710_10367452 3300025900 Bacteria 735
299 Ga0207688_10044938 3300025901 Bacteria 2462
300 Ga0207688_10070513 3300025901 Bacteria 1982
301 Ga0207680_10105514 3300025903 Bacteria 1818
302 Ga0207680_10130935 3300025903 Bacteria 1653
303 Ga0207680_10280548 3300025903 Bacteria 1157
304 Ga0207647_10276090 3300025904 Bacteria 960
305 Ga0207699_10014463 3300025906 Bacteria 4069
306 Ga0207699_10446165 3300025906 Bacteria 927
307 Ga0207645_10004840 3300025907 Bacteria 9886
308 Ga0207645_10045650 3300025907 Bacteria 2800
309 Ga0207645_10136314 3300025907 Bacteria 1598
310 Ga0207643_10247617 3300025908 Bacteria 1097
311 Ga0207705_10387910 3300025909 Bacteria 1079
312 Ga0207705_10472904 3300025909 Bacteria 973
313 Ga0207705_11122376 3300025909 Bacteria 605
314 Ga0207654_10453371 3300025911 Bacteria 900
315 Ga0207707_10023912 3300025912 Bacteria 5341
316 Ga0207707_10033892 3300025912 Bacteria 4468
317 Ga0207695_10003510 3300025913 Bacteria 21983
318 Ga0207695_10045135 3300025913 Bacteria 4681
319 Ga0207695_10181290 3300025913 Bacteria 2027
320 Ga0207695_11104947 3300025913 Bacteria 673
321 Ga0207695_11263408 3300025913 Bacteria 619
322 Ga0207671_10049021 3300025914 Bacteria 3126
323 Ga0207671_10438791 3300025914 Bacteria 1039
324 Ga0207671_11366505 3300025914 Bacteria 550
325 Ga0207671_11432351 3300025914 Bacteria 535
326 Ga0207693_10002847 3300025915 Bacteria 14981
327 Ga0207693_10072981 3300025915 Bacteria 2686
328 Ga0207663_10047338 3300025916 Bacteria 2654
329 Ga0207663_10049809 3300025916 Bacteria 2600
330 Ga0207663_10163359 3300025916 Bacteria 1575
331 Ga0207663_11225554 3300025916 Bacteria 604
332 Ga0207660_11074369 3300025917 Bacteria 656
333 Ga0207662_10040134 3300025918 Bacteria 2749
334 Ga0207652_10045855 3300025921 Bacteria 3727
335 Ga0207652_10156052 3300025921 Bacteria 2045
336 Ga0207681_10000593 3300025923 Bacteria 24630
337 Ga0207694_10009622 3300025924 Bacteria 7287
338 Ga0207694_10033797 3300025924 Bacteria 3918
339 Ga0207694_10374650 3300025924 Bacteria 1181
340 Ga0207694_10521447 3300025924 Bacteria 996
341 Ga0207694_11411833 3300025924 Unclassified 588
342 Ga0207650_10019591 3300025925 Bacteria 4757
343 Ga0207650_10072631 3300025925 Bacteria 2589
344 Ga0207650_10092020 3300025925 Bacteria 2319
345 Ga0207650_11364160 3300025925 Bacteria 603
346 Ga0207659_10058295 3300025926 Bacteria 2772
347 Ga0207687_10117106 3300025927 Bacteria 1987
348 Ga0207700_10153248 3300025928 Bacteria 1906
349 Ga0207664_10209618 3300025929 Bacteria 1685
350 Ga0207644_10035682 3300025931 Bacteria 3486
351 Ga0207644_10191569 3300025931 Bacteria 1608
352 Ga0207644_10305530 3300025931 Bacteria 1283
353 Ga0207644_10458130 3300025931 Bacteria 1048
354 Ga0207644_10706182 3300025931 Bacteria 841
355 Ga0207644_10729570 3300025931 Bacteria 827
356 Ga0207644_10733104 3300025931 Bacteria 825
357 Ga0207690_10458652 3300025932 Bacteria 1025
358 Ga0207690_10514176 3300025932 Bacteria 970
359 Ga0207706_10026499 3300025933 Bacteria 5188
360 Ga0207706_10687525 3300025933 Bacteria 875
361 Ga0207706_10847457 3300025933 Bacteria 774
362 Ga0207686_10014296 3300025934 Bacteria 4414
363 Ga0207686_10063229 3300025934 Bacteria 2353
364 Ga0207686_10110023 3300025934 Bacteria 1856
365 Ga0207709_10012613 3300025935 Bacteria 4657
366 Ga0207670_10891934 3300025936 Bacteria 744
367 Ga0207669_10302869 3300025937 Bacteria 1215
368 Ga0207704_10030080 3300025938 Bacteria 3040
369 Ga0207704_10349505 3300025938 Bacteria 1151
370 Ga0207704_10634431 3300025938 Bacteria 878
371 Ga0207665_10003495 3300025939 Bacteria 10494
372 Ga0207665_10009747 3300025939 Bacteria 6306
373 Ga0207665_10113364 3300025939 Bacteria 1907
374 Ga0207665_10154505 3300025939 Bacteria 1646
375 Ga0207691_10005535 3300025940 Bacteria 12198
376 Ga0207691_10059932 3300025940 Bacteria 3460
377 Ga0207691_10097558 3300025940 Bacteria 2627
378 Ga0207691_10496839 3300025940 Bacteria 1036
379 Ga0207711_10017271 3300025941 Bacteria 5997
380 Ga0207689_10005387 3300025942 Bacteria 11450
381 Ga0207689_10288272 3300025942 Bacteria 1360
382 Ga0207689_10949270 3300025942 Bacteria 726
383 Ga0207679_10187419 3300025945 Bacteria 1717
384 Ga0207679_10595869 3300025945 Bacteria 995
385 Ga0207679_10877365 3300025945 Bacteria 820
386 Ga0207667_10151679 3300025949 Bacteria 2385
387 Ga0207667_10332201 3300025949 Bacteria 1552
388 Ga0207667_10858810 3300025949 Bacteria 901
389 Ga0207667_10913512 3300025949 Bacteria 869
390 Ga0207667_11177465 3300025949 Unclassified 747
391 Ga0207667_11959477 3300025949 Bacteria 547
392 Ga0207651_10063619 3300025960 Bacteria 2577
393 Ga0207651_10630711 3300025960 Bacteria 939
394 Ga0207651_11297514 3300025960 Bacteria 654
395 Ga0207651_11318293 3300025960 Bacteria 649
396 Ga0207712_10003299 3300025961 Bacteria 10236
397 Ga0207712_10206384 3300025961 Bacteria 1562
398 Ga0207668_10007352 3300025972 Bacteria 6546
399 Ga0207668_10992291 3300025972 Bacteria 750
400 Ga0207640_10174571 3300025981 Bacteria 1605
401 Ga0207640_10567342 3300025981 Bacteria 956
402 Ga0207640_10952605 3300025981 Bacteria 752
403 Ga0207658_10001534 3300025986 Bacteria 17947
404 Ga0207658_10010742 3300025986 Bacteria 6226
405 Ga0207658_10602446 3300025986 Bacteria 987
406 Ga0207658_10736452 3300025986 Bacteria 892
407 Ga0207658_11620993 3300025986 Bacteria 591
408 Ga0207677_10122867 3300026023 Bacteria 1956
409 Ga0207677_10132016 3300026023 Bacteria 1898
410 Ga0207677_10308957 3300026023 Bacteria 1309
411 Ga0207677_10523965 3300026023 Unclassified 1028
412 Ga0207703_10001680 3300026035 Bacteria 19905
413 Ga0207703_10001859 3300026035 Bacteria 18774
414 Ga0207639_10043448 3300026041 Bacteria 3374
415 Ga0207639_10141293 3300026041 Bacteria 2006
416 Ga0207639_10250760 3300026041 Bacteria 1543
417 Ga0207639_10340176 3300026041 Bacteria 1337
418 Ga0207639_10889454 3300026041 Bacteria 832
419 Ga0207708_10010678 3300026075 Bacteria 6823
420 Ga0207702_10034475 3300026078 Bacteria 4232
421 Ga0207702_10082182 3300026078 Bacteria 2800
422 Ga0207702_10151660 3300026078 Bacteria 2109
423 Ga0207702_10358136 3300026078 Bacteria 1398
424 Ga0207641_10000273 3300026088 Bacteria 65757
425 Ga0207641_10002724 3300026088 Bacteria 16119
426 Ga0207641_10119803 3300026088 Bacteria 2346
427 Ga0207641_10908489 3300026088 Bacteria 874
428 Ga0207641_11982338 3300026088 Bacteria 583
429 Ga0207648_10019207 3300026089 Bacteria 6168
430 Ga0207648_10021778 3300026089 Bacteria 5758
431 Ga0207648_10586070 3300026089 Bacteria 1027
432 Ga0207648_11292500 3300026089 Bacteria 685
433 Ga0207676_10015273 3300026095 Bacteria 5538
434 Ga0207676_10157742 3300026095 Bacteria 1962
435 Ga0207676_10489963 3300026095 Bacteria 1166
436 Ga0207674_10152477 3300026116 Bacteria 2268
437 Ga0207674_10878490 3300026116 Bacteria 864
438 Ga0207675_100001372 3300026118 Bacteria 24404
439 Ga0207683_10093587 3300026121 Bacteria 2678
440 Ga0207683_10104139 3300026121 Bacteria 2535
441 Ga0207683_10972973 3300026121 Bacteria 788
442 Ga0207683_11437873 3300026121 Bacteria 637
443 Ga0207698_10045415 3300026142 Bacteria 3309
444 Ga0207698_10125864 3300026142 Bacteria 2179
445 Ga0207698_10290548 3300026142 Bacteria 1517
446 Ga0207698_10982651 3300026142 Bacteria 854
447 Ga0209974_10210224 3300027876 Unclassified 721
448 Ga0265356_1036457 3300028017 Bacteria 539
449 Ga0268266_10031211 3300028379 Bacteria 4523
450 Ga0268266_10076742 3300028379 Bacteria 2904
451 Ga0268266_10199070 3300028379 Bacteria 1832
452 Ga0268266_10202884 3300028379 Bacteria 1815
453 Ga0268266_10299026 3300028379 Bacteria 1501
454 Ga0268266_10388175 3300028379 Bacteria 1318
455 Ga0268266_11049788 3300028379 Bacteria 788
456 Ga0268265_10073918 3300028380 Bacteria 2664
457 Ga0268265_10463350 3300028380 Bacteria 1186
458 Ga0268264_10000151 3300028381 Bacteria 158241
459 Ga0268264_10012729 3300028381 Bacteria 6923
460 Ga0268264_10024035 3300028381 Bacteria 4972
461 Ga0268264_10237281 3300028381 Bacteria 1687
462 Ga0307517_10159364 3300028786 Bacteria 1520
463 Ga0307517_10164992 3300028786 Bacteria 1474
464 Ga0307517_10182412 3300028786 Bacteria 1352
465 Ga0307513_10574603 3300031456 Bacteria 838
466 Ga0307509_10839707 3300031507 Bacteria 583
467 Ga0307408_100295714 3300031548 Bacteria 1354
468 Ga0307408_100719262 3300031548 Bacteria 899
469 Ga0307516_10000543 3300031730 Bacteria 50487
470 Ga0307405_10058931 3300031731 Bacteria 2418
471 Ga0307405_10095408 3300031731 Bacteria 1980
472 Ga0307405_10170003 3300031731 Bacteria 1554
473 Ga0307413_10283917 3300031824 Bacteria 1246
474 Ga0307410_10071625 3300031852 Bacteria 2404
475 Ga0307410_10132498 3300031852 Bacteria 1833
476 Ga0307407_10065288 3300031903 Bacteria 2142
477 Ga0307412_10183239 3300031911 Bacteria 1577
478 Ga0307409_100016690 3300031995 Bacteria 4868
479 Ga0307409_100034761 3300031995 Bacteria 3686
480 Ga0307416_100006086 3300032002 Bacteria 7513
481 Ga0307416_100515883 3300032002 Bacteria 1262
482 Ga0307414_10137948 3300032004 Bacteria 1905
483 Ga0307411_10010676 3300032005 Bacteria 4910
484 Ga0307415_100224854 3300032126 Bacteria 1507
485 Ga0307507_10426894 3300033179 Bacteria 742
486 Ga0307510_10000003 3300033180 Bacteria 756654
487 Ga0307510_10002062 3300033180 Bacteria 22705
488 Ga0373950_0051559 3300034818 Bacteria 809
489 Ga0373934_0174467 3300035086 Bacteria 883
490 Ga0373923_0106933 3300035111 Bacteria 1239
491 Ga0373923_0273809 3300035111 Bacteria 794
492 Ga0373923_0532109 3300035111 Bacteria 575
493 Ga0373953_0335255 3300035117 Bacteria 662
494 Ga0373954_0380671 3300035118 Bacteria 697
495 Ga0373954_0529483 3300035118 Bacteria 584
496 Ga0373956_0098058 3300035119 Bacteria 1357
497 Ga0373956_0171110 3300035119 Bacteria 1025
498 Ga0373956_0642573 3300035119 Bacteria 507
499 Ga0373957_0063937 3300035120 Bacteria 1430
500 Ga0373957_0101645 3300035120 Bacteria 1152
501 Ga0373943_0093275 3300035170 Bacteria 1563
502 Ga0373943_0196157 3300035170 Bacteria 1116
503 Ga0373943_0524059 3300035170 Bacteria 694
504 Ga0373955_0065315 3300035172 Bacteria 2020
505 Ga0373955_0140436 3300035172 Bacteria 1416
506 Ga0373955_0209548 3300035172 Bacteria 1162
507 Ga0373955_0696923 3300035172 Bacteria 623
508 Ga0373924_0066812 3300035410 Bacteria 1512
509 Ga0373924_0559584 3300035410 Bacteria 515
510 Ga0373935_0046664 3300035692 Bacteria 2737
511 Ga0373935_0190970 3300035692 Bacteria 1411
512 Ga0373935_0444521 3300035692 Bacteria 936
513 Ga0373935_1077515 3300035692 Bacteria 598
514 Ga0373927_0114834 3300035695 Bacteria 1755
515 Ga0373927_0442055 3300035695 Bacteria 859
516 Ga0373933_0133200 3300035724 Bacteria 1564
517 Ga0373933_0687504 3300035724 Bacteria 673
518 Ga0373933_0703976 3300035724 Bacteria 664
519 Ga0373947_0278853 3300035725 Bacteria 1111
520 Ga0373947_0561165 3300035725 Bacteria 777
521 Ga0373947_0892475 3300035725 Bacteria 607
522 Ga0373937_0126748 3300036401 Bacteria 2382
523 Ga0373937_0411004 3300036401 Bacteria 1284
524 Ga0373937_0975535 3300036401 Bacteria 796
525 Ga0373937_1207702 3300036401 Bacteria 705
526 Ga0373925_0023830 3300037068 Bacteria 4465
527 Ga0373925_0089877 3300037068 Bacteria 2347
528 Ga0373925_0864536 3300037068 Bacteria 745
529 Ga0395899_0087271 3300037312 Bacteria 2265
530 Ga0395900_0104832 3300037418 Bacteria 2905
531 Ga0395898_1894587 3300037466 Unclassified 516
532 Ga0436365_1297614 3300039437 Bacteria 1395
533 Ga0436360_0505175 3300039438 Bacteria 2718
534 Ga0436360_0868674 3300039438 Bacteria 602
535 Ga0436360_0920761 3300039438 Bacteria 1351
536 Ga0436361_0556070 3300039447 Bacteria 745
537 Ga0436363_1102460 3300039450 Bacteria 1763
538 Ga0436363_1258724 3300039450 Bacteria 987
539 Ga0436363_1408244 3300039450 Bacteria 1210
540 Ga0436363_1689440 3300039450 Bacteria 11337
541 Ga0436362_0078560 3300039453 Bacteria 2479
542 Ga0436362_0710878 3300039453 Bacteria 1200
543 Ga0451789_0102910 3300041443 Bacteria 713
544 Ga0451845_0296370 3300041501 Bacteria 602
545 Ga0451853_3141089 3300041512 Bacteria 530
546 Ga0451853_3695029 3300041512 Bacteria 956
547 Ga0439459_0078174 3300042438 Bacteria 777
548 Ga0451576_0171801 3300045051 Bacteria 2262
549 Ga0495592_0626886 3300046454 Bacteria 653
550 Ga0495629_0062777 3300046459 Bacteria 2594
551 Ga0495629_0529041 3300046459 Bacteria 793
552 Ga0495651_0410367 3300046462 Bacteria 882
553 Ga0495580_0000595 3300046472 Bacteria 30578
554 Ga0495580_0277222 3300046472 Bacteria 1144
555 Ga0495580_0308114 3300046472 Bacteria 1077
556 Ga0495580_0437324 3300046472 Bacteria 879
557 Ga0495582_0155168 3300046473 Bacteria 1301
558 Ga0495582_0240418 3300046473 Bacteria 1038
559 Ga0495582_0752323 3300046473 Bacteria 564
560 Ga0495618_0054297 3300046514 Bacteria 2535
561 Ga0495628_0794591 3300046516 Bacteria 662
562 Ga0495630_0182750 3300046517 Bacteria 1599
563 Ga0495632_0028708 3300046519 Bacteria 2902
564 Ga0495648_0128880 3300046524 Bacteria 1348
565 Ga0495665_0242422 3300046531 Bacteria 929
566 Ga0495586_0193027 3300046535 Bacteria 1153
567 Ga0495587_0173352 3300046536 Bacteria 1225
568 Ga0495621_0088997 3300046539 Bacteria 1162
569 Ga0495621_0093988 3300046539 Bacteria 1133
570 Ga0495645_0055497 3300046543 Bacteria 2877
571 Ga0495645_0063703 3300046543 Bacteria 2669
572 Ga0495645_0411607 3300046543 Bacteria 860
573 Ga0495668_0046471 3300046616 Bacteria 2412
574 Ga0495634_0073622 3300046642 Bacteria 2246
575 Ga0495634_0244290 3300046642 Bacteria 1100
576 Ga0495625_0459735 3300046660 Bacteria 785
577 Ga0495657_0151982 3300046675 Bacteria 1437
578 Ga0495646_0053703 3300046680 Bacteria 2428
579 Ga0495647_0024446 3300046681 Bacteria 2199
580 Ga0495647_0079464 3300046681 Bacteria 1328
581 Ga0495647_0246568 3300046681 Bacteria 794
582 Ga0495658_0073364 3300046683 Bacteria 1992
583 Ga0495658_0259926 3300046683 Bacteria 1093
584 Ga0495613_0037510 3300046689 Bacteria 3593
585 Ga0495613_0734176 3300046689 Bacteria 648
586 Ga0495649_0221781 3300046694 Bacteria 978
587 Ga0495674_0163596 3300047319 Bacteria 1861
588 Ga0495674_0303598 3300047319 Bacteria 1303
589 Ga0495687_056089 3300047443 Bacteria 1645
590 Ga0495684_0087955 3300047471 Bacteria 2355
591 Ga0495684_0271694 3300047471 Bacteria 1226
592 Ga0495684_0891202 3300047471 Bacteria 574
593 Ga0496100_0048928 3300048903 Bacteria 2731
594 Ga0496100_0058139 3300048903 Bacteria 2536
595 Ga0496100_0426943 3300048903 Bacteria 1013
596 Ga0496100_0537661 3300048903 Bacteria 903
597 Ga0496101_0196832 3300048904 Bacteria 1557
598 Ga0496101_0352554 3300048904 Bacteria 1157
599 Ga0496101_0680767 3300048904 Bacteria 812
600 Ga0496102_0036739 3300048905 Bacteria 4415
601 Ga0496102_0172169 3300048905 Bacteria 2038
602 Ga0496104_0073473 3300048907 Bacteria 3253
603 Ga0496104_0105626 3300048907 Bacteria 2698
604 Ga0496104_0236150 3300048907 Bacteria 1740
605 Ga0496105_0213675 3300048908 Bacteria 1571
606 Ga0496105_0273492 3300048908 Bacteria 1363
607 Ga0496106_0055470 3300048909 Bacteria 2995
608 Ga0496106_0331696 3300048909 Bacteria 1221
609 Ga0496106_1270822 3300048909 Bacteria 572
610 Ga0496107_0378429 3300048910 Bacteria 1053
611 Ga0496108_0010819 3300048911 Bacteria 7409
612 Ga0496109_0545879 3300048912 Bacteria 1093
613 Ga0496110_0088393 3300048913 Bacteria 2767
614 Ga0496111_0025690 3300048914 Bacteria 4156
615 Ga0496112_0371763 3300048915 Bacteria 1371
616 Ga0496112_0542335 3300048915 Bacteria 1097
617 Ga0496113_0858582 3300048916 Bacteria 719
618 Ga0496114_0046200 3300048917 Bacteria 3618
619 Ga0496114_0166295 3300048917 Bacteria 1920
620 Ga0496115_0046609 3300048918 Bacteria 3465
621 Ga0496115_0090151 3300048918 Bacteria 2504
622 Ga0496115_1251384 3300048918 Bacteria 555
623 Ga0496115_1252516 3300048918 Bacteria 555
624 Ga0496115_1440124 3300048918 Unclassified 507
625 Ga0496116_0023452 3300048919 Bacteria 4594
626 Ga0496117_0000186 3300048920 Bacteria 127231
627 Ga0496118_0000003 3300048921 Bacteria 773148
628 Ga0496119_0001832 3300048922 Bacteria 24618
629 Ga0496119_0008384 3300048922 Bacteria 9088
630 Ga0496119_0070632 3300048922 Bacteria 2047
631 Ga0496119_0149886 3300048922 Bacteria 1251
632 Ga0496120_0000232 3300048923 Bacteria 95655
633 Ga0496120_0108610 3300048923 Bacteria 1453
634 Ga0496120_0174086 3300048923 Bacteria 1062
635 Ga0496120_0190164 3300048923 Bacteria 1001
636 Ga0496121_0035691 3300048924 Bacteria 4448
637 Ga0496121_0037913 3300048924 Bacteria 4276
638 Ga0496121_0089651 3300048924 Bacteria 2407
639 Ga0496122_0494080 3300048925 Bacteria 596
640 Ga0496124_0000098 3300048927 Bacteria 183057
641 Ga0496124_0060950 3300048927 Bacteria 3163
642 Ga0496125_0001701 3300048928 Bacteria 30700
643 Ga0496125_0002867 3300048928 Bacteria 21703
644 Ga0496126_0150266 3300048929 Bacteria 1997
645 Ga0496126_0305118 3300048929 Bacteria 1312
646 Ga0496126_0393492 3300048929 Bacteria 1125
647 nmdc:mga06z11_136902_c1 3300050494 Bacteria 1380
648 nmdc:mga05p37_28106_c1 3300050507 Bacteria 6855
649 nmdc:mga09592_5702_c1 3300050508 Bacteria 10158
650 nmdc:mga0qj67_218878_c1 3300050509 Bacteria 1546
651 nmdc:mga0qj67_403028_c1 3300050509 Bacteria 1104
652 nmdc:mga06r32_203964_c1 3300050510 Bacteria 1965
653 nmdc:mga0n895_212252_c1 3300050512 Bacteria 1966
654 nmdc:mga0rr50_3114_c1 3300050513 Bacteria 9477
655 Ga0495601_0023256 3300053077 Bacteria 3808
656 Ga0495601_0442080 3300053077 Bacteria 841
657 Ga0495612_0035344 3300053078 Bacteria 2026
658 Ga0495595_0454523 3300053084 Bacteria 651
659 Ga0495619_0041244 3300053085 Bacteria 3019
660 Ga0495619_0146136 3300053085 Bacteria 1630
661 Ga0500583_0542016 3300053092 Bacteria 542
662 Ga0500562_008394 3300053108 Bacteria 2610
663 Ga0500593_171916 3300053117 Bacteria 815
664 Ga0500590_264134 3300053148 Unclassified 674
665 Ga0207687_11720748
666 rootH1_10087932
667 rootH1_10223287
668 Ga0065715_10868782
669 Ga0070658_10058245
670 Ga0070676_10001193
671 Ga0070676_10061318
672 Ga0070690_100023785
673 Ga0070670_100088009
674 Ga0070670_100364841
675 Ga0068869_100008881
676 Ga0068869_100180035
677 Ga0068869_100260480
678 Ga0068869_101544150
679 Ga0070666_10016357
680 Ga0070666_10250550
681 Ga0070666_10480412
682 Ga0070666_10725556
683 Ga0068868_100033358
684 Ga0068868_100037419
685 Ga0068868_100057205
686 Ga0068868_100508057
687 Ga0068868_100600942
688 Ga0070660_100272505
689 Ga0070660_101571650
690 Ga0070687_100007934
691 Ga0070687_100019914
692 Ga0070661_100193281
693 Ga0070668_100011629
694 Ga0070668_100249883
695 Ga0070668_100340534
696 Ga0070669_100002367
697 Ga0070675_100011312
698 Ga0070675_100099523
699 Ga0070675_100164626
700 Ga0070671_100040861
701 Ga0070671_100177872
702 Ga0070671_100227502
703 Ga0070674_100011846
704 Ga0070673_100065535
705 Ga0070673_100111068
706 Ga0070673_101853580
707 Ga0070688_101292433
708 Ga0070667_100006347
709 Ga0070667_100021852
710 Ga0070667_100062297
711 Ga0070703_10091578
712 Ga0070709_10008951
713 Ga0070709_10009829
714 Ga0070709_10097474
715 Ga0070714_101968348
716 Ga0070713_100020089
717 Ga0070713_100236442
718 Ga0070713_102479022
719 Ga0070710_10009597
720 Ga0070710_10158890
721 Ga0070710_11180771
722 Ga0070701_10191357
723 Ga0070701_10343058
724 Ga0070711_100010261
725 Ga0070711_100031956
726 Ga0070711_100454595
727 Ga0070705_100052220
728 Ga0070700_100022638
729 Ga0070663_100363466
730 Ga0070678_100062679
731 Ga0070678_101037050
732 Ga0070678_101061737
733 Ga0070678_101474082
734 Ga0070662_100006522
735 Ga0070662_100039098
736 Ga0070662_100596654
737 Ga0070662_100685358
738 Ga0070681_10000724
739 Ga0070681_10089383
740 Ga0070681_10493968
741 Ga0068867_100016369
742 Ga0068867_100020809
743 Ga0068867_100414153
744 Ga0070685_11053051
745 Ga0070699_100311680
746 Ga0070679_100216994
747 Ga0070697_101460286
748 Ga0068853_100080478
749 Ga0068853_100117399
750 Ga0068853_100484817
751 Ga0068853_100552496
752 Ga0068853_100949346
753 Ga0068853_101110452
754 Ga0070672_100031384
755 Ga0070672_100098796
756 Ga0070672_100457068
757 Ga0070672_100481208
758 Ga0070672_100618382
759 Ga0070695_100017023
760 Ga0070696_100499998
761 Ga0070696_100811411
762 Ga0070693_100081656
763 Ga0070665_100062004
764 Ga0070665_100083921
765 Ga0070665_100125399
766 Ga0070665_100197658
767 Ga0070665_100216021
768 Ga0070704_101295385
769 Ga0068855_100003440
770 Ga0068855_100150790
771 Ga0068855_100325112
772 Ga0068855_100410968
773 Ga0068855_100438607
774 Ga0070664_100199409
775 Ga0070664_100227755
776 Ga0070664_100291015
777 Ga0070664_101567598
778 Ga0068857_100256939
779 Ga0068857_100737104
780 Ga0068854_100093841
781 Ga0068854_100144663
782 Ga0068854_100211815
783 Ga0068856_100032302
784 Ga0068856_100444026
785 Ga0068856_100565288
786 Ga0068856_100752886
787 Ga0068856_100881598
788 Ga0070702_100200532
789 Ga0068852_100006288
790 Ga0068852_100050291
791 Ga0068852_100365416
792 Ga0068852_100776073
793 Ga0068859_100013199
794 Ga0068864_100009739
795 Ga0068864_100365955
796 Ga0068866_10005225
797 Ga0068866_10062555
798 Ga0068866_10779404
799 Ga0068861_100021259
800 Ga0068861_101380430
801 Ga0068851_10054556
802 Ga0068870_10273170
803 Ga0068863_100005528
804 Ga0068863_100050229
805 Ga0068863_100098807
806 Ga0068863_100143563
807 Ga0068863_101491807
808 Ga0068863_101999546
809 Ga0068863_102083188
810 Ga0068858_100003274
811 Ga0068858_100003858
812 Ga0068858_100005753
813 Ga0068858_100032405
814 Ga0068860_100000371
815 Ga0068860_100009677
816 Ga0068860_100037950
817 Ga0068860_100121111
818 Ga0068862_100007872
819 Ga0070717_10082097
820 Ga0070717_11137262
821 Ga0070715_10002944
822 Ga0070716_100010004
823 Ga0070716_100019797
824 Ga0070716_100365379
825 Ga0070716_101496035
826 Ga0070712_100051430
827 Ga0070712_100149499
828 Ga0075366_10166849
829 Ga0097621_101059977
830 Ga0097621_101583592
831 Ga0075370_10010367
832 Ga0068871_100075407
833 Ga0068871_100197283
834 Ga0068871_100641656
835 Ga0068871_100660621
836 Ga0068871_101506572
837 Ga0075431_100075610
838 Ga0075434_100142501
839 Ga0075429_100192334
840 Ga0068865_100005470
841 Ga0068865_100016694
842 Ga0068865_101652744
843 Ga0075436_100228980
844 Ga0097620_100013199
845 Ga0075435_100004686
846 Ga0075435_101630634
847 Ga0099795_10005529
848 Ga0105240_10000712
849 Ga0105240_10008152
850 Ga0105240_11039011
851 Ga0105240_11100164
852 Ga0105240_11282320
853 Ga0105240_11474454
854 Ga0105240_11876366
855 Ga0105245_10032762
856 Ga0105245_10101785
857 Ga0105245_11466322
858 Ga0105247_10008264
859 Ga0105247_11545011
860 Ga0114129_10094594
861 Ga0105243_10023422
862 Ga0105241_10053146
863 Ga0105241_10272515
864 Ga0105241_10351118
865 Ga0105241_10673492
866 Ga0105241_10835171
867 Ga0105241_11190029
868 Ga0105241_11261352
869 Ga0105242_10019647
870 Ga0105242_10243538
871 Ga0105242_11302484
872 Ga0105248_10210110
873 Ga0105248_10275255
874 Ga0105248_10329373
875 Ga0105248_13315166
876 Ga0105237_10019287
877 Ga0105237_10085100
878 Ga0105237_10210844
879 Ga0105237_10327042
880 Ga0105237_10628704
881 Ga0105237_10687914
882 Ga0105237_11535123
883 Ga0105238_10002359
884 Ga0105238_10006292
885 Ga0105238_10426961
886 Ga0105238_10476500
887 Ga0105238_10526023
888 Ga0105238_10717426
889 Ga0105238_10822901
890 Ga0105238_10936337
891 Ga0105238_11300767
892 Ga0105249_10008114
893 Ga0105249_10022034
894 Ga0105249_10121918
895 Ga0099796_10002453
896 Ga0105239_10015567
897 Ga0105239_10189406
898 Ga0105239_10276094
899 Ga0105239_11728951
900 Ga0105239_12533504
901 Ga0105246_10622157
902 Ga0157326_1037914
903 Ga0157373_11027660
904 Ga0157370_10094345
905 Ga0157370_10413836
906 Ga0157369_10194777
907 Ga0157369_10213505
908 Ga0157369_11248909
909 Ga0157369_11862287
910 Ga0157374_10076872
911 Ga0157374_10107643
912 Ga0157374_11831096
913 Ga0157378_10049543
914 Ga0157378_10429405
915 Ga0157378_10490653
916 Ga0157378_12356846
917 Ga0157378_12365691
918 Ga0163162_10047167
919 Ga0163162_10248607
920 Ga0163162_10593213
921 Ga0163162_10633380
922 Ga0163162_10790674
923 Ga0157372_13031163
924 Ga0157372_13039375
925 Ga0157375_10007068
926 Ga0157375_10081353
927 Ga0157375_10185298
928 Ga0157375_10466772
929 Ga0157375_10674207
930 Ga0157375_10842278
931 Ga0163163_10100384
932 Ga0163163_10229512
933 Ga0163163_10577324
934 Ga0163163_10745617
935 Ga0163163_11008138
936 Ga0157380_10004143
937 Ga0157380_10048859
938 Ga0157377_11021937
939 Ga0157379_10003267
940 Ga0157379_10023282
941 Ga0157379_10133553
942 Ga0157379_10335195
943 Ga0157379_12437521
944 Ga0157376_10005942
945 Ga0157376_10264782
946 Ga0157376_11038468
947 Ga0157376_11099422
948 Ga0157376_11133485
949 Ga0163161_10054732
950 Ga0163161_10534943
951 Ga0213874_10038642
952 Ga0213874_10044809
953 Ga0213874_10392371
954 Ga0213876_10150932
955 Ga0213871_10010477
956 Ga0213871_10106902
957 Ga0207656_10550428
958 Ga0207682_10017573
959 Ga0207682_10038836
960 Ga0207642_10063543
961 Ga0207642_10091721
962 Ga0207710_10367452
963 Ga0207688_10044938
964 Ga0207688_10070513
965 Ga0207680_10105514
966 Ga0207680_10130935
967 Ga0207680_10280548
968 Ga0207647_10276090
969 Ga0207699_10014463
970 Ga0207699_10446165
971 Ga0207645_10004840
972 Ga0207645_10045650
973 Ga0207645_10136314
974 Ga0207643_10247617
975 Ga0207705_10387910
976 Ga0207705_10472904
977 Ga0207705_11122376
978 Ga0207654_10453371
979 Ga0207707_10023912
980 Ga0207707_10033892
981 Ga0207695_10003510
982 Ga0207695_10045135
983 Ga0207695_10181290
984 Ga0207695_11104947
985 Ga0207695_11263408
986 Ga0207671_10049021
987 Ga0207671_10438791
988 Ga0207671_11366505
989 Ga0207671_11432351
990 Ga0207693_10002847
991 Ga0207693_10072981
992 Ga0207663_10047338
993 Ga0207663_10049809
994 Ga0207663_10163359
995 Ga0207663_11225554
996 Ga0207660_11074369
997 Ga0207662_10040134
998 Ga0207652_10045855
999 Ga0207652_10156052
1000 Ga0207681_10000593
1001 Ga0207694_10009622
1002 Ga0207694_10033797
1003 Ga0207694_10374650
1004 Ga0207694_10521447
1005 Ga0207694_11411833
1006 Ga0207650_10019591
1007 Ga0207650_10072631
1008 Ga0207650_10092020
1009 Ga0207650_11364160
1010 Ga0207659_10058295
1011 Ga0207687_10117106
1012 Ga0207700_10153248
1013 Ga0207664_10209618
1014 Ga0207644_10035682
1015 Ga0207644_10191569
1016 Ga0207644_10305530
1017 Ga0207644_10458130
1018 Ga0207644_10706182
1019 Ga0207644_10729570
1020 Ga0207644_10733104
1021 Ga0207690_10458652
1022 Ga0207690_10514176
1023 Ga0207706_10026499
1024 Ga0207706_10687525
1025 Ga0207706_10847457
1026 Ga0207686_10014296
1027 Ga0207686_10063229
1028 Ga0207686_10110023
1029 Ga0207709_10012613
1030 Ga0207670_10891934
1031 Ga0207669_10302869
1032 Ga0207704_10030080
1033 Ga0207704_10349505
1034 Ga0207704_10634431
1035 Ga0207665_10003495
1036 Ga0207665_10009747
1037 Ga0207665_10113364
1038 Ga0207665_10154505
1039 Ga0207691_10005535
1040 Ga0207691_10059932
1041 Ga0207691_10097558
1042 Ga0207691_10496839
1043 Ga0207711_10017271
1044 Ga0207689_10005387
1045 Ga0207689_10288272
1046 Ga0207689_10949270
1047 Ga0207679_10187419
1048 Ga0207679_10595869
1049 Ga0207679_10877365
1050 Ga0207667_10151679
1051 Ga0207667_10332201
1052 Ga0207667_10858810
1053 Ga0207667_10913512
1054 Ga0207667_11177465
1055 Ga0207667_11959477
1056 Ga0207651_10063619
1057 Ga0207651_10630711
1058 Ga0207651_11297514
1059 Ga0207651_11318293
1060 Ga0207712_10003299
1061 Ga0207712_10206384
1062 Ga0207668_10007352
1063 Ga0207668_10992291
1064 Ga0207640_10174571
1065 Ga0207640_10567342
1066 Ga0207640_10952605
1067 Ga0207658_10001534
1068 Ga0207658_10010742
1069 Ga0207658_10602446
1070 Ga0207658_10736452
1071 Ga0207658_11620993
1072 Ga0207677_10122867
1073 Ga0207677_10132016
1074 Ga0207677_10308957
1075 Ga0207677_10523965
1076 Ga0207703_10001680
1077 Ga0207703_10001859
1078 Ga0207639_10043448
1079 Ga0207639_10141293
1080 Ga0207639_10250760
1081 Ga0207639_10340176
1082 Ga0207639_10889454
1083 Ga0207708_10010678
1084 Ga0207702_10034475
1085 Ga0207702_10082182
1086 Ga0207702_10151660
1087 Ga0207702_10358136
1088 Ga0207641_10000273
1089 Ga0207641_10002724
1090 Ga0207641_10119803
1091 Ga0207641_10908489
1092 Ga0207641_11982338
1093 Ga0207648_10019207
1094 Ga0207648_10021778
1095 Ga0207648_10586070
1096 Ga0207648_11292500
1097 Ga0207676_10015273
1098 Ga0207676_10157742
1099 Ga0207676_10489963
1100 Ga0207674_10152477
1101 Ga0207674_10878490
1102 Ga0207675_100001372
1103 Ga0207683_10093587
1104 Ga0207683_10104139
1105 Ga0207683_10972973
1106 Ga0207683_11437873
1107 Ga0207698_10045415
1108 Ga0207698_10125864
1109 Ga0207698_10290548
1110 Ga0207698_10982651
1111 Ga0209974_10210224
1112 Ga0265356_1036457
1113 Ga0268266_10031211
1114 Ga0268266_10076742
1115 Ga0268266_10199070
1116 Ga0268266_10202884
1117 Ga0268266_10299026
1118 Ga0268266_10388175
1119 Ga0268266_11049788
1120 Ga0268265_10073918
1121 Ga0268265_10463350
1122 Ga0268264_10000151
1123 Ga0268264_10012729
1124 Ga0268264_10024035
1125 Ga0268264_10237281
1126 Ga0307517_10159364
1127 Ga0307517_10164992
1128 Ga0307517_10182412
1129 Ga0307513_10574603
1130 Ga0307509_10839707
1131 Ga0307408_100295714
1132 Ga0307408_100719262
1133 Ga0307516_10000543
1134 Ga0307405_10058931
1135 Ga0307405_10095408
1136 Ga0307405_10170003
1137 Ga0307413_10283917
1138 Ga0307410_10071625
1139 Ga0307410_10132498
1140 Ga0307407_10065288
1141 Ga0307412_10183239
1142 Ga0307409_100016690
1143 Ga0307409_100034761
1144 Ga0307416_100006086
1145 Ga0307416_100515883
1146 Ga0307414_10137948
1147 Ga0307411_10010676
1148 Ga0307415_100224854
1149 Ga0307507_10426894
1150 Ga0307510_10000003
1151 Ga0307510_10002062
1152 Ga0373950_0051559
1153 Ga0373934_0174467
1154 Ga0373923_0106933
1155 Ga0373923_0273809
1156 Ga0373923_0532109
1157 Ga0373953_0335255
1158 Ga0373954_0380671
1159 Ga0373954_0529483
1160 Ga0373956_0098058
1161 Ga0373956_0171110
1162 Ga0373956_0642573
1163 Ga0373957_0063937
1164 Ga0373957_0101645
1165 Ga0373943_0093275
1166 Ga0373943_0196157
1167 Ga0373943_0524059
1168 Ga0373955_0065315
1169 Ga0373955_0140436
1170 Ga0373955_0209548
1171 Ga0373955_0696923
1172 Ga0373924_0066812
1173 Ga0373924_0559584
1174 Ga0373935_0046664
1175 Ga0373935_0190970
1176 Ga0373935_0444521
1177 Ga0373935_1077515
1178 Ga0373927_0114834
1179 Ga0373927_0442055
1180 Ga0373933_0133200
1181 Ga0373933_0687504
1182 Ga0373933_0703976
1183 Ga0373947_0278853
1184 Ga0373947_0561165
1185 Ga0373947_0892475
1186 Ga0373937_0126748
1187 Ga0373937_0411004
1188 Ga0373937_0975535
1189 Ga0373937_1207702
1190 Ga0373925_0023830
1191 Ga0373925_0089877
1192 Ga0373925_0864536
1193 Ga0395899_0087271
1194 Ga0395900_0104832
1195 Ga0395898_1894587
1196 Ga0436365_1297614
1197 Ga0436360_0505175
1198 Ga0436360_0868674
1199 Ga0436360_0920761
1200 Ga0436361_0556070
1201 Ga0436363_1102460
1202 Ga0436363_1258724
1203 Ga0436363_1408244
1204 Ga0436363_1689440
1205 Ga0436362_0078560
1206 Ga0436362_0710878
1207 Ga0451789_0102910
1208 Ga0451845_0296370
1209 Ga0451853_3141089
1210 Ga0451853_3695029
1211 Ga0439459_0078174
1212 Ga0451576_0171801
1213 Ga0495592_0626886
1214 Ga0495629_0062777
1215 Ga0495629_0529041
1216 Ga0495651_0410367
1217 Ga0495580_0000595
1218 Ga0495580_0277222
1219 Ga0495580_0308114
1220 Ga0495580_0437324
1221 Ga0495582_0155168
1222 Ga0495582_0240418
1223 Ga0495582_0752323
1224 Ga0495618_0054297
1225 Ga0495628_0794591
1226 Ga0495630_0182750
1227 Ga0495632_0028708
1228 Ga0495648_0128880
1229 Ga0495665_0242422
1230 Ga0495586_0193027
1231 Ga0495587_0173352
1232 Ga0495621_0088997
1233 Ga0495621_0093988
1234 Ga0495645_0055497
1235 Ga0495645_0063703
1236 Ga0495645_0411607
1237 Ga0495668_0046471
1238 Ga0495634_0073622
1239 Ga0495634_0244290
1240 Ga0495625_0459735
1241 Ga0495657_0151982
1242 Ga0495646_0053703
1243 Ga0495647_0024446
1244 Ga0495647_0079464
1245 Ga0495647_0246568
1246 Ga0495658_0073364
1247 Ga0495658_0259926
1248 Ga0495613_0037510
1249 Ga0495613_0734176
1250 Ga0495649_0221781
1251 Ga0495674_0163596
1252 Ga0495674_0303598
1253 Ga0495687_056089
1254 Ga0495684_0087955
1255 Ga0495684_0271694
1256 Ga0495684_0891202
1257 Ga0496100_0048928
1258 Ga0496100_0058139
1259 Ga0496100_0426943
1260 Ga0496100_0537661
1261 Ga0496101_0196832
1262 Ga0496101_0352554
1263 Ga0496101_0680767
1264 Ga0496102_0036739
1265 Ga0496102_0172169
1266 Ga0496104_0073473
1267 Ga0496104_0105626
1268 Ga0496104_0236150
1269 Ga0496105_0213675
1270 Ga0496105_0273492
1271 Ga0496106_0055470
1272 Ga0496106_0331696
1273 Ga0496106_1270822
1274 Ga0496107_0378429
1275 Ga0496108_0010819
1276 Ga0496109_0545879
1277 Ga0496110_0088393
1278 Ga0496111_0025690
1279 Ga0496112_0371763
1280 Ga0496112_0542335
1281 Ga0496113_0858582
1282 Ga0496114_0046200
1283 Ga0496114_0166295
1284 Ga0496115_0046609
1285 Ga0496115_0090151
1286 Ga0496115_1251384
1287 Ga0496115_1252516
1288 Ga0496115_1440124
1289 Ga0496116_0023452
1290 Ga0496117_0000186
1291 Ga0496118_0000003
1292 Ga0496119_0001832
1293 Ga0496119_0008384
1294 Ga0496119_0070632
1295 Ga0496119_0149886
1296 Ga0496120_0000232
1297 Ga0496120_0108610
1298 Ga0496120_0174086
1299 Ga0496120_0190164
1300 Ga0496121_0035691
1301 Ga0496121_0037913
1302 Ga0496121_0089651
1303 Ga0496122_0494080
1304 Ga0496124_0000098
1305 Ga0496124_0060950
1306 Ga0496125_0001701
1307 Ga0496125_0002867
1308 Ga0496126_0150266
1309 Ga0496126_0305118
1310 Ga0496126_0393492
1311 nmdc:mga06z11_136902_c1
1312 nmdc:mga05p37_28106_c1
1313 nmdc:mga09592_5702_c1
1314 nmdc:mga0qj67_218878_c1
1315 nmdc:mga0qj67_403028_c1
1316 nmdc:mga06r32_203964_c1
1317 nmdc:mga0n895_212252_c1
1318 nmdc:mga0rr50_3114_c1
1319 Ga0495601_0023256
1320 Ga0495601_0442080
1321 Ga0495612_0035344
1322 Ga0495595_0454523
1323 Ga0495619_0041244
1324 Ga0495619_0146136
1325 Ga0500583_0542016
1326 Ga0500562_008394
1327 Ga0500593_171916
1328 Ga0500590_264134

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07746

LigA

Aromatic-ring-opening dioxygenase LigAB, LigA subunit

33

114

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5n0x-assembly1.cif.gz_B crystal structure of opha-deltac6 in complex with sam 0.8987 6 48
5n0t-assembly1.cif.gz_A crystal structure of opha-deltac6 mutant y76f in complex with sam 0.8942 5 48
5n0r-assembly1.cif.gz_A-2 crystal structure of opha-deltac6 mutant y66f in complex with sam 0.8883 5 48
5n0q-assembly1.cif.gz_A crystal structure of opha-deltac6 in complex with sah 0.8848 5 48
3wrb-assembly1.cif.gz_A crystal structure of the anaerobic h124f desb-gallate complex 0.8791 4 82
ID Description Score Start End Superfamily
3wpmB02 Mainly Alpha;Orthogonal Bundle;Protocatechuate 4,5-dioxygenase; Chain A;Dioxygenase LigAB, LigA subunit 0.88 4 81 1.10.700.10
3wraB02 Mainly Alpha;Orthogonal Bundle;Protocatechuate 4,5-dioxygenase; Chain A;Dioxygenase LigAB, LigA subunit 0.8303 4 82 1.10.700.10
3wkuA02 Mainly Alpha;Orthogonal Bundle;Protocatechuate 4,5-dioxygenase; Chain A;Dioxygenase LigAB, LigA subunit 0.7906 4 90 1.10.700.10
3wr8A02 Mainly Alpha;Orthogonal Bundle;Protocatechuate 4,5-dioxygenase; Chain A;Dioxygenase LigAB, LigA subunit 0.7686 4 93 1.10.700.10
3wpmB02 Mainly Alpha;Orthogonal Bundle;Protocatechuate 4,5-dioxygenase; Chain A;Dioxygenase LigAB, LigA subunit 0.6827 4 81 1.10.700.10
ID Description Score Start End GO Terms
AF-A0A6L8BBN5-F1-model_v4 Extradiol ring-cleavage dioxygenase LigAB LigA subunit domain-containing protein 0.9824 1 81
AF-A0A6L5FKC9-F1-model_v4 Extradiol ring-cleavage dioxygenase LigAB LigA subunit domain-containing protein 0.9664 1 81
AF-A0A1H4N7G2-F1-model_v4 Aromatic-ring-opening dioxygenase LigAB, LigA subunit 0.9656 1 81 GO:0051213
AF-A0A1C7BX42-F1-model_v4 deleted 0.9623 1 96
AF-A0A7H9V1C8-F1-model_v4 deleted 0.9621 1 98

Map