F473616

General Info

Members Datasets Scaffolds Average Seq Length
664 358 645 95

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10309079|Ga0111539_103090791
Length 105
Sequence VSEQPENTEVTAEVTTPADAPKARGERKTREGLVVSDKMDKTVVVEVEDRVKHPKYGKVIRRTKRYKAHDAENACGVGDRVVLMETRPLSATKRWRVSQILEKAK

Samples

Sample ID Description Type Environment
1 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
2 2734482000 Kineosporia rhizophila JCM 9960 Isolate Unclassified
3 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
4 2811994880 Cellulomonas sp. SLBN-39 Isolate Unclassified
5 2857733635 Salinibacterium sp. R-73062 Isolate Unclassified
6 2904430863 Curtobacterium oceanosedimentum 1519 Isolate Rhizosphere
7 2904501621 Curtobacterium sp. 1909 Isolate Unclassified
8 2908674828 Curtobacterium sp. 1517 Isolate Rhizosphere
9 2909074476 Curtobacterium sp. 1310 Isolate Rhizosphere
10 2919039151 Curtobacterium sp. 260 Isolate Rhizosphere
11 2919042368 Curtobacterium sp. 320 Isolate Rhizosphere
12 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
13 2928104781 Curtobacterium sp. 1544 Isolate Rhizosphere
14 2928500415 Curtobacterium oceanosedimentum 1257 Isolate Rhizosphere
15 2932431166 Cellulosimicrobium sp. 4261 Isolate Rhizosphere
16 2966924647 Frigoribacterium sp. 2355 Isolate Rhizosphere
17 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root
18 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
19 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
20 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
21 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
22 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
23 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
24 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
25 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
26 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
27 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
28 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
29 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
30 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
31 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
32 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
39 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
40 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
41 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
42 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
43 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
44 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
49 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
50 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
51 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
68 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
69 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
70 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
71 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
111 3300019190 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
112 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
116 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
122 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
123 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
124 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
126 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
161 3300030889 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
162 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
164 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
165 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
166 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
167 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
168 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
169 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
170 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
171 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
172 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
173 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
174 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
175 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
176 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
177 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
178 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
179 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
180 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
181 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
182 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
183 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
184 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
185 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
186 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
187 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
188 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
189 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
190 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
191 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
192 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
193 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
194 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
195 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
196 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
198 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
199 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
200 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
201 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
202 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
203 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
204 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
205 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
206 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
207 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
208 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
209 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
210 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
211 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
212 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
213 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
214 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
215 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
216 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
217 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
218 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
219 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
220 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
221 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
222 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
223 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
224 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
225 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
226 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
227 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
228 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
229 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
230 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
231 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
232 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
233 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
234 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
235 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
236 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
237 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
238 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
239 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
240 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
241 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
242 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
243 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
244 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
245 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
246 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
247 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
248 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
249 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
250 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
251 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
252 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
253 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
254 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
255 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
256 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
257 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
258 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
259 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
260 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
261 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
262 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
263 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
264 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
265 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
266 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
267 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
268 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
269 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
270 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
271 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
272 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
273 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
274 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
275 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
276 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
277 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
278 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
279 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
280 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
281 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
282 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
283 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
284 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
285 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
286 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
287 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
288 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
289 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
290 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
291 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
292 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
293 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
294 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
295 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
296 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
297 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
298 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
299 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
300 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
301 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
302 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
303 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
304 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
305 3300049546 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
306 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
308 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
309 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
310 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
311 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
312 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
313 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
314 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
315 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
316 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
317 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
318 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
319 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
320 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
321 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
322 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
323 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
324 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
325 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
326 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
327 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
328 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
329 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
330 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
331 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
332 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
333 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
334 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
335 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
336 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
337 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
338 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
339 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
340 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
341 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
342 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
343 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
344 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
345 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
346 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
347 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
348 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
349 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
350 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
351 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
352 3300059650 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 69R_SD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
353 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
354 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
355 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
356 3300059659 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
357 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
358 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.38
Metatranscriptomes 14.76
Isolates 2.86

Biome Distribution

Category Percentage (%)
Aerial Root 0.45
Bulb 0
Endosphere 0.15
Nodule 0
Rhizoplane 4.52
Rhizosphere 88.86
Stem 0
Stem Tuber 0
Unclassified 6.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10028203 3300001990 Bacteria 1766
2 JGI24738J21930_10015386 3300002075 Bacteria 1628
3 Ga0006778J45830_1022691 3300003162 Bacteria 813
4 Ga0007410J51695_1043507 3300003574 Bacteria 1241
5 JGI25404J52841_10004898 3300003659 Bacteria 2747
6 Ga0032354_1051217 3300003693 Bacteria 577
7 Ga0058863_11721945 3300004799 Bacteria 770
8 Ga0058863_11957706 3300004799 Bacteria 1014
9 Ga0058860_11980957 3300004801 Bacteria 1101
10 Ga0058860_12148150 3300004801 Bacteria 714
11 Ga0058862_10000712 3300004803 Bacteria 896
12 Ga0058862_12871663 3300004803 Bacteria 732
13 Ga0070683_100189872 3300005329 Bacteria 1951
14 Ga0070683_100523299 3300005329 Bacteria 1133
15 Ga0070683_101823600 3300005329 Bacteria 585
16 Ga0070683_101841809 3300005329 Bacteria 582
17 Ga0070690_100732715 3300005330 Bacteria 762
18 Ga0070682_100387842 3300005337 Bacteria 1053
19 Ga0068868_100420703 3300005338 Bacteria 1157
20 Ga0070661_100117520 3300005344 Bacteria 1989
21 Ga0070661_100718822 3300005344 Bacteria 815
22 Ga0070692_10075882 3300005345 Bacteria 1801
23 Ga0070675_101670948 3300005354 Bacteria 587
24 Ga0070671_100227176 3300005355 Bacteria 1584
25 Ga0070659_100791008 3300005366 Bacteria 824
26 Ga0070703_10001744 3300005406 Bacteria 6448
27 Ga0070709_10276185 3300005434 Bacteria 1219
28 Ga0070709_10479627 3300005434 Bacteria 941
29 Ga0070709_11522147 3300005434 Bacteria 543
30 Ga0070714_100001124 3300005435 Bacteria 19227
31 Ga0070714_100003109 3300005435 Bacteria 12330
32 Ga0070714_100913651 3300005435 Bacteria 852
33 Ga0070714_101068137 3300005435 Bacteria 786
34 Ga0070714_101420419 3300005435 Bacteria 678
35 Ga0070714_102151578 3300005435 Bacteria 543
36 Ga0070713_100001233 3300005436 Bacteria 16350
37 Ga0070713_100227446 3300005436 Bacteria 1694
38 Ga0070713_100917954 3300005436 Bacteria 842
39 Ga0070713_101206283 3300005436 Bacteria 732
40 Ga0070713_101534455 3300005436 Bacteria 646
41 Ga0070713_102130459 3300005436 Bacteria 543
42 Ga0070710_10000437 3300005437 Bacteria 19522
43 Ga0070710_10314212 3300005437 Bacteria 1026
44 Ga0070710_11005374 3300005437 Bacteria 608
45 Ga0070711_100045638 3300005439 Bacteria 2982
46 Ga0070711_100072955 3300005439 Bacteria 2423
47 Ga0070711_100191052 3300005439 Bacteria 1574
48 Ga0070711_101812715 3300005439 Bacteria 535
49 Ga0070711_101833257 3300005439 Bacteria 532
50 Ga0070708_100659845 3300005445 Bacteria 985
51 Ga0070708_101187265 3300005445 Bacteria 714
52 Ga0070708_101468702 3300005445 Bacteria 635
53 Ga0070678_100500757 3300005456 Bacteria 1072
54 Ga0070662_100036864 3300005457 Bacteria 3463
55 Ga0070681_11804584 3300005458 Bacteria 539
56 Ga0070706_100003720 3300005467 Bacteria 14916
57 Ga0070706_100257139 3300005467 Bacteria 1630
58 Ga0070706_100346334 3300005467 Bacteria 1385
59 Ga0070707_100021481 3300005468 Bacteria 6102
60 Ga0070707_100098495 3300005468 Bacteria 2832
61 Ga0070707_100183589 3300005468 Bacteria 2039
62 Ga0070707_100197595 3300005468 Bacteria 1961
63 Ga0070707_100882677 3300005468 Bacteria 859
64 Ga0070707_101198117 3300005468 Bacteria 725
65 Ga0070707_101906745 3300005468 Bacteria 562
66 Ga0070707_102013802 3300005468 Bacteria 545
67 Ga0070698_100001882 3300005471 Bacteria 23378
68 Ga0070698_100018293 3300005471 Bacteria 7379
69 Ga0070698_100869854 3300005471 Bacteria 846
70 Ga0070699_100418034 3300005518 Bacteria 1213
71 Ga0070684_100362268 3300005535 Bacteria 1334
72 Ga0070684_100948705 3300005535 Bacteria 807
73 Ga0070697_100038833 3300005536 Bacteria 3847
74 Ga0070697_101408534 3300005536 Bacteria 622
75 Ga0070693_100581968 3300005547 Bacteria 806
76 Ga0070665_100476653 3300005548 Bacteria 1259
77 Ga0070664_100041377 3300005564 Bacteria 3888
78 Ga0068857_100364734 3300005577 Bacteria 1339
79 Ga0068857_101705902 3300005577 Bacteria 616
80 Ga0070702_100373834 3300005615 Bacteria 1011
81 Ga0070702_100785118 3300005615 Bacteria 735
82 Ga0070702_100813434 3300005615 Bacteria 724
83 Ga0068852_100729200 3300005616 Bacteria 1002
84 Ga0068859_100670474 3300005617 Bacteria 1128
85 Ga0068864_100089287 3300005618 Bacteria 2715
86 Ga0068864_100100693 3300005618 Bacteria 2561
87 Ga0068864_100467420 3300005618 Bacteria 1209
88 Ga0068861_100064654 3300005719 Bacteria 2815
89 Ga0068863_100366384 3300005841 Bacteria 1405
90 Ga0068858_100129309 3300005842 Bacteria 2367
91 Ga0068860_100644706 3300005843 Bacteria 1067
92 Ga0068860_101483819 3300005843 Bacteria 700
93 Ga0068862_101239261 3300005844 Bacteria 745
94 Ga0081540_1000341 3300005983 Bacteria 47794
95 Ga0081540_1022585 3300005983 Bacteria 3713
96 Ga0081540_1047724 3300005983 Bacteria 2151
97 Ga0081539_10104788 3300005985 Bacteria 1435
98 Ga0070717_10010919 3300006028 Bacteria 6876
99 Ga0070717_10135605 3300006028 Bacteria 2119
100 Ga0070717_10214680 3300006028 Bacteria 1689
101 Ga0070717_11273771 3300006028 Bacteria 668
102 Ga0070715_10188857 3300006163 Bacteria 1039
103 Ga0070715_10473647 3300006163 Bacteria 711
104 Ga0070716_100000511 3300006173 Bacteria 16168
105 Ga0070716_100084223 3300006173 Bacteria 1906
106 Ga0070712_100001287 3300006175 Bacteria 15146
107 Ga0070712_100014381 3300006175 Bacteria 5080
108 Ga0070712_100600539 3300006175 Bacteria 931
109 Ga0070712_101711548 3300006175 Bacteria 550
110 Ga0070712_101805339 3300006175 Bacteria 535
111 Ga0070712_102053952 3300006175 Bacteria 500
112 Ga0097621_100042306 3300006237 Bacteria 3669
113 Ga0097621_100351151 3300006237 Bacteria 1311
114 Ga0068871_100308964 3300006358 Bacteria 1390
115 Ga0075428_100099463 3300006844 Bacteria 3171
116 Ga0075430_100047794 3300006846 Bacteria 3613
117 Ga0075431_100006706 3300006847 Bacteria 11432
118 Ga0075431_100598519 3300006847 Bacteria 1087
119 Ga0075433_10271224 3300006852 Bacteria 1504
120 Ga0075434_100016693 3300006871 Bacteria 7062
121 Ga0075434_100126789 3300006871 Bacteria 2569
122 Ga0075434_100725765 3300006871 Bacteria 1011
123 Ga0075429_100005726 3300006880 Bacteria 10724
124 Ga0075429_100015532 3300006880 Bacteria 6597
125 Ga0075436_100227898 3300006914 Bacteria 1323
126 Ga0075436_100270029 3300006914 Bacteria 1214
127 Ga0097620_100670479 3300006931 Bacteria 1128
128 Ga0075435_100081437 3300007076 Bacteria 2659
129 Ga0075435_100281215 3300007076 Bacteria 1420
130 Ga0075435_100560897 3300007076 Bacteria 989
131 Ga0099795_10005676 3300007788 Bacteria 3343
132 Ga0099795_10263560 3300007788 Bacteria 747
133 Ga0111539_10309079 3300009094 Bacteria 1840
134 Ga0105245_10028695 3300009098 Bacteria 4911
135 Ga0105245_10516397 3300009098 Bacteria 1212
136 Ga0105247_11596078 3300009101 Bacteria 536
137 Ga0114129_10015903 3300009147 Bacteria 10703
138 Ga0114129_10085359 3300009147 Bacteria 4380
139 Ga0114129_11910986 3300009147 Bacteria 719
140 Ga0105243_11313044 3300009148 Bacteria 741
141 Ga0105241_12207243 3300009174 Bacteria 546
142 Ga0105242_11856509 3300009176 Bacteria 642
143 Ga0105237_10205919 3300009545 Bacteria 1968
144 Ga0105237_11157419 3300009545 Bacteria 780
145 Ga0105238_10389366 3300009551 Bacteria 1386
146 Ga0105249_12884881 3300009553 Bacteria 552
147 Ga0099796_10119283 3300010159 Bacteria 1012
148 Ga0105239_10031478 3300010375 Bacteria 5834
149 Ga0105239_12199722 3300010375 Bacteria 641
150 Ga0105246_10941664 3300011119 Bacteria 778
151 Ga0157370_10517815 3300013104 Bacteria 1095
152 Ga0157369_10858116 3300013105 Bacteria 932
153 Ga0157374_10030097 3300013296 Bacteria 4926
154 Ga0157374_10393549 3300013296 Bacteria 1381
155 Ga0157378_10437009 3300013297 Bacteria 1296
156 Ga0163162_10157865 3300013306 Bacteria 2389
157 Ga0157372_10217071 3300013307 Bacteria 2217
158 Ga0157372_10439772 3300013307 Bacteria 1520
159 Ga0157372_11393227 3300013307 Bacteria 808
160 Ga0157372_11900388 3300013307 Bacteria 684
161 Ga0157375_10289818 3300013308 Bacteria 1800
162 Ga0163163_10297835 3300014325 Bacteria 1665
163 Ga0163163_10321708 3300014325 Bacteria 1600
164 Ga0163163_11847124 3300014325 Bacteria 664
165 Ga0182008_10084220 3300014497 Bacteria 1566
166 Ga0157377_11276132 3300014745 Bacteria 573
167 Ga0157379_10011666 3300014968 Bacteria 7672
168 Ga0157379_10420833 3300014968 Bacteria 1230
169 Ga0157376_11099675 3300014969 Bacteria 821
170 Ga0182005_1092653 3300015265 Bacteria 841
171 Ga0184600_101748 3300019190 Bacteria 1242
172 Ga0197907_10537378 3300020069 Bacteria 589
173 Ga0197907_10950516 3300020069 Bacteria 705
174 Ga0197907_11321259 3300020069 Bacteria 4435
175 Ga0206356_11171823 3300020070 Bacteria 640
176 Ga0206356_11612728 3300020070 Bacteria 668
177 Ga0206349_1658620 3300020075 Bacteria 858
178 Ga0206355_1179809 3300020076 Bacteria 669
179 Ga0206355_1627926 3300020076 Bacteria 1319
180 Ga0206351_10373923 3300020077 Bacteria 1324
181 Ga0206352_11126397 3300020078 Bacteria 2897
182 Ga0206350_10990969 3300020080 Bacteria 908
183 Ga0206350_11613293 3300020080 Bacteria 1065
184 Ga0206354_10110661 3300020081 Bacteria 1231
185 Ga0206354_10368332 3300020081 Bacteria 1245
186 Ga0206354_10926327 3300020081 Bacteria 1296
187 Ga0206354_11310032 3300020081 Bacteria 1241
188 Ga0206354_11496319 3300020081 Bacteria 765
189 Ga0206353_10645923 3300020082 Bacteria 572
190 Ga0206353_11155186 3300020082 Bacteria 505
191 Ga0206353_11323745 3300020082 Bacteria 1146
192 Ga0206353_11381381 3300020082 Bacteria 868
193 Ga0206353_11847015 3300020082 Bacteria 2573
194 Ga0206353_11898514 3300020082 Bacteria 1131
195 Ga0213873_10149280 3300021358 Bacteria 703
196 Ga0213876_10522052 3300021384 Bacteria 632
197 Ga0213875_10010857 3300021388 Bacteria 4553
198 Ga0213875_10106303 3300021388 Bacteria 1310
199 Ga0213875_10243769 3300021388 Bacteria 847
200 Ga0224712_10037453 3300022467 Bacteria 1805
201 Ga0224712_10255346 3300022467 Bacteria 811
202 Ga0224712_10338561 3300022467 Bacteria 709
203 Ga0224572_1026985 3300024225 Bacteria 1100
204 Ga0207692_10001130 3300025898 Bacteria 9809
205 Ga0207692_10123800 3300025898 Bacteria 1451
206 Ga0207692_10228046 3300025898 Bacteria 1107
207 Ga0207692_11182624 3300025898 Bacteria 508
208 Ga0207710_10273231 3300025900 Bacteria 849
209 Ga0207688_10317498 3300025901 Bacteria 955
210 Ga0207688_10565290 3300025901 Bacteria 715
211 Ga0207699_10000260 3300025906 Bacteria 29008
212 Ga0207699_10563416 3300025906 Bacteria 827
213 Ga0207684_10016512 3300025910 Bacteria 6339
214 Ga0207684_10027808 3300025910 Bacteria 4817
215 Ga0207684_10333546 3300025910 Bacteria 1306
216 Ga0207684_10469944 3300025910 Bacteria 1079
217 Ga0207684_10886026 3300025910 Bacteria 751
218 Ga0207684_11430348 3300025910 Bacteria 565
219 Ga0207707_10388364 3300025912 Bacteria 1199
220 Ga0207707_11040894 3300025912 Bacteria 670
221 Ga0207671_10215586 3300025914 Bacteria 1503
222 Ga0207671_11313469 3300025914 Bacteria 563
223 Ga0207693_10004081 3300025915 Bacteria 12404
224 Ga0207693_10024997 3300025915 Bacteria 4737
225 Ga0207693_10178908 3300025915 Bacteria 1669
226 Ga0207693_10765073 3300025915 Bacteria 746
227 Ga0207663_10000595 3300025916 Bacteria 15977
228 Ga0207663_10212114 3300025916 Bacteria 1404
229 Ga0207663_11522477 3300025916 Bacteria 539
230 Ga0207657_10324694 3300025919 Bacteria 1216
231 Ga0207649_11492506 3300025920 Bacteria 535
232 Ga0207646_10019054 3300025922 Bacteria 6386
233 Ga0207646_10079404 3300025922 Bacteria 2933
234 Ga0207646_10091536 3300025922 Bacteria 2722
235 Ga0207646_10188791 3300025922 Bacteria 1861
236 Ga0207694_10909492 3300025924 Bacteria 744
237 Ga0207659_10835760 3300025926 Bacteria 791
238 Ga0207687_10050704 3300025927 Bacteria 2890
239 Ga0207700_10000091 3300025928 Bacteria 55792
240 Ga0207700_10053796 3300025928 Bacteria 3018
241 Ga0207700_10104512 3300025928 Bacteria 2266
242 Ga0207700_10600350 3300025928 Bacteria 979
243 Ga0207700_11699185 3300025928 Bacteria 557
244 Ga0207664_10001032 3300025929 Bacteria 18646
245 Ga0207664_10001323 3300025929 Bacteria 16307
246 Ga0207664_10016921 3300025929 Bacteria 5332
247 Ga0207664_10093952 3300025929 Bacteria 2464
248 Ga0207664_10409685 3300025929 Bacteria 1206
249 Ga0207664_10790899 3300025929 Bacteria 853
250 Ga0207664_10871334 3300025929 Bacteria 809
251 Ga0207644_11682359 3300025931 Bacteria 532
252 Ga0207706_10776718 3300025933 Bacteria 815
253 Ga0207709_10902866 3300025935 Bacteria 718
254 Ga0207665_10000821 3300025939 Bacteria 21034
255 Ga0207665_10012079 3300025939 Bacteria 5668
256 Ga0207665_10346687 3300025939 Bacteria 1120
257 Ga0207711_10216871 3300025941 Bacteria 1749
258 Ga0207661_10689520 3300025944 Bacteria 939
259 Ga0207661_11163908 3300025944 Bacteria 710
260 Ga0207677_10102410 3300026023 Bacteria 2111
261 Ga0207703_10089913 3300026035 Bacteria 2579
262 Ga0207703_10317468 3300026035 Bacteria 1426
263 Ga0207708_10254560 3300026075 Bacteria 1416
264 Ga0207708_10804487 3300026075 Bacteria 809
265 Ga0207702_10958647 3300026078 Bacteria 848
266 Ga0207641_10337316 3300026088 Bacteria 1433
267 Ga0207676_11547644 3300026095 Bacteria 660
268 Ga0207674_10014845 3300026116 Bacteria 8590
269 Ga0207674_10282848 3300026116 Bacteria 1607
270 Ga0207675_100010883 3300026118 Bacteria 8521
271 Ga0207698_11021238 3300026142 Bacteria 838
272 Ga0209179_1146784 3300027512 Bacteria 527
273 Ga0268266_10057547 3300028379 Bacteria 3346
274 Ga0265762_1005987 3300030760 Bacteria 2179
275 Ga0265761_108369 3300030889 Bacteria 579
276 Ga0265760_10128304 3300031090 Bacteria 818
277 Ga0307406_10162975 3300031901 Bacteria 1605
278 Ga0307409_102160686 3300031995 Bacteria 586
279 Ga0307416_102032414 3300032002 Bacteria 677
280 Ga0307415_100681042 3300032126 Bacteria 925
281 Ga0316212_1019878 3300033547 Bacteria 943
282 Ga0373930_0130636 3300034816 Bacteria 618
283 Ga0373950_0062232 3300034818 Bacteria 751
284 Ga0373958_0071457 3300034819 Bacteria 771
285 Ga0373938_0113643 3300034957 Bacteria 692
286 Ga0373926_0001795 3300035083 Bacteria 6662
287 Ga0373926_0398212 3300035083 Bacteria 543
288 Ga0373934_0030274 3300035086 Bacteria 2116
289 Ga0373934_0508346 3300035086 Bacteria 507
290 Ga0373940_0263542 3300035088 Bacteria 584
291 Ga0373944_0005972 3300035089 Bacteria 3222
292 Ga0373949_0090156 3300035090 Bacteria 828
293 Ga0373923_0012347 3300035111 Bacteria 3155
294 Ga0373923_0029180 3300035111 Bacteria 2210
295 Ga0373932_0221165 3300035112 Bacteria 680
296 Ga0373936_0090925 3300035113 Bacteria 1279
297 Ga0373936_0468932 3300035113 Bacteria 583
298 Ga0373939_0234561 3300035114 Bacteria 708
299 Ga0373945_0006856 3300035116 Bacteria 3681
300 Ga0373945_0071172 3300035116 Bacteria 1316
301 Ga0373945_0129528 3300035116 Bacteria 1010
302 Ga0373953_0010766 3300035117 Bacteria 3192
303 Ga0373954_0021194 3300035118 Bacteria 2941
304 Ga0373954_0032674 3300035118 Bacteria 2406
305 Ga0373954_0089960 3300035118 Bacteria 1474
306 Ga0373954_0258067 3300035118 Bacteria 858
307 Ga0373954_0294384 3300035118 Bacteria 800
308 Ga0373956_0064292 3300035119 Bacteria 1665
309 Ga0373956_0091360 3300035119 Bacteria 1404
310 Ga0373957_0001041 3300035120 Bacteria 7310
311 Ga0373957_0007693 3300035120 Bacteria 3457
312 Ga0373960_0179742 3300035121 Bacteria 738
313 Ga0373943_0011419 3300035170 Bacteria 3996
314 Ga0373943_0583776 3300035170 Bacteria 657
315 Ga0373955_0002432 3300035172 Bacteria 8128
316 Ga0373955_0028721 3300035172 Bacteria 2886
317 Ga0373924_0028077 3300035410 Bacteria 2240
318 Ga0373931_0018524 3300035691 Bacteria 3464
319 Ga0373935_0089335 3300035692 Bacteria 2014
320 Ga0373935_0090005 3300035692 Bacteria 2007
321 Ga0373927_0052651 3300035695 Bacteria 2632
322 Ga0373927_0588458 3300035695 Bacteria 735
323 Ga0373933_0126906 3300035724 Bacteria 1601
324 Ga0373933_0498813 3300035724 Bacteria 797
325 Ga0373947_0036657 3300035725 Bacteria 2908
326 Ga0373947_0175004 3300035725 Bacteria 1394
327 Ga0373947_0259543 3300035725 Bacteria 1151
328 Ga0373937_0145982 3300036401 Bacteria 2214
329 Ga0373937_0283190 3300036401 Bacteria 1565
330 Ga0373937_0762235 3300036401 Bacteria 915
331 Ga0373937_2055101 3300036401 Bacteria 517
332 Ga0265778_014641 3300036457 Bacteria 928
333 Ga0373925_0146321 3300037068 Bacteria 1852
334 Ga0373925_1072513 3300037068 Bacteria 663
335 Ga0395899_0320952 3300037312 Bacteria 1043
336 Ga0395899_0724377 3300037312 Bacteria 622
337 Ga0395900_0021670 3300037418 Bacteria 6569
338 Ga0395900_0123671 3300037418 Bacteria 2653
339 Ga0395900_0367318 3300037418 Bacteria 1409
340 Ga0395900_0853169 3300037418 Bacteria 836
341 Ga0395900_1155716 3300037418 Bacteria 690
342 Ga0395898_0072810 3300037466 Bacteria 3319
343 Ga0395898_1401769 3300037466 Bacteria 626
344 Ga0436364_0435690 3300037853 Bacteria 7681
345 Ga0436364_0572882 3300037853 Bacteria 1194
346 Ga0436364_0697983 3300037853 Bacteria 1996
347 Ga0436364_1139829 3300037853 Bacteria 2315
348 Ga0436364_1354648 3300037853 Bacteria 115417
349 Ga0436364_1385979 3300037853 Bacteria 1405
350 Ga0395901_0011417 3300038443 Bacteria 8999
351 Ga0395901_0013538 3300038443 Bacteria 8294
352 Ga0395901_0042762 3300038443 Bacteria 4699
353 Ga0436365_0140149 3300039437 Bacteria 747
354 Ga0436365_0323587 3300039437 Bacteria 1078
355 Ga0436365_0480233 3300039437 Bacteria 1127
356 Ga0436365_1206898 3300039437 Bacteria 532
357 Ga0436360_0896384 3300039438 Bacteria 683
358 Ga0436360_1358491 3300039438 Bacteria 1691
359 Ga0436363_0387806 3300039450 Bacteria 591
360 Ga0436363_0420441 3300039450 Bacteria 942
361 Ga0436363_0608057 3300039450 Bacteria 1214
362 Ga0436363_0984261 3300039450 Bacteria 1097
363 Ga0436363_1244160 3300039450 Bacteria 1912
364 Ga0436362_0080480 3300039453 Bacteria 1500
365 Ga0436362_0108632 3300039453 Bacteria 717
366 Ga0451795_0116542 3300041456 Bacteria 539
367 Ga0451806_416377 3300041462 Bacteria 687
368 Ga0451807_0540349 3300041486 Bacteria 592
369 Ga0451833_0714288 3300041491 Bacteria 2127
370 Ga0451835_0428021 3300041492 Bacteria 720
371 Ga0451839_0404311 3300041496 Bacteria 1350
372 Ga0451846_22992 3300041502 Bacteria 584
373 Ga0451851_0106851 3300041507 Bacteria 744
374 Ga0466969_0133478 3300044656 Bacteria 1150
375 Ga0466966_0333615 3300044684 Bacteria 911
376 Ga0466961_0018685 3300044693 Bacteria 4460
377 Ga0466963_0032630 3300044694 Bacteria 3374
378 Ga0466963_0056835 3300044694 Bacteria 2604
379 Ga0466963_0144726 3300044694 Bacteria 1648
380 Ga0466964_0401321 3300044706 Bacteria 716
381 Ga0466964_0456857 3300044706 Bacteria 678
382 Ga0466971_0168729 3300044719 Bacteria 1026
383 Ga0466968_0174414 3300044735 Bacteria 997
384 Ga0466968_0399061 3300044735 Bacteria 674
385 Ga0466970_0019956 3300044765 Bacteria 3478
386 Ga0466970_0938761 3300044765 Bacteria 509
387 Ga0466957_0342862 3300044842 Bacteria 1012
388 Ga0466957_0480171 3300044842 Bacteria 859
389 Ga0466957_0687294 3300044842 Bacteria 721
390 Ga0466957_1376465 3300044842 Bacteria 513
391 Ga0466960_0783069 3300044901 Bacteria 576
392 Ga0466960_0930207 3300044901 Bacteria 531
393 Ga0466959_0103930 3300045049 Bacteria 2032
394 Ga0466959_0500242 3300045049 Bacteria 821
395 Ga0466958_0017088 3300045836 Bacteria 4188
396 Ga0466958_0067645 3300045836 Bacteria 2182
397 Ga0466958_0129643 3300045836 Bacteria 1583
398 Ga0466958_0572110 3300045836 Bacteria 734
399 Ga0466958_0951943 3300045836 Bacteria 560
400 Ga0466967_0304013 3300045976 Bacteria 1535
401 Ga0466967_0374083 3300045976 Bacteria 1382
402 Ga0466967_1299720 3300045976 Bacteria 724
403 Ga0466967_1781871 3300045976 Bacteria 613
404 Ga0466967_2062256 3300045976 Bacteria 567
405 Ga0466967_2189473 3300045976 Bacteria 549
406 Ga0466967_2498688 3300045976 Bacteria 511
407 Ga0495592_0252251 3300046454 Bacteria 1165
408 Ga0495592_0296858 3300046454 Bacteria 1051
409 Ga0495603_0012499 3300046455 Bacteria 5139
410 Ga0495603_0287114 3300046455 Bacteria 945
411 Ga0495629_0004222 3300046459 Bacteria 10778
412 Ga0495629_0029225 3300046459 Bacteria 3911
413 Ga0495629_0030557 3300046459 Bacteria 3818
414 Ga0495629_0979595 3300046459 Bacteria 551
415 Ga0495641_0009678 3300046461 Bacteria 5697
416 Ga0495641_0197520 3300046461 Bacteria 901
417 Ga0495641_0224277 3300046461 Bacteria 843
418 Ga0495651_0029293 3300046462 Bacteria 4292
419 Ga0495651_0154494 3300046462 Bacteria 1650
420 Ga0495651_0400254 3300046462 Bacteria 896
421 Ga0495653_0035050 3300046463 Bacteria 3962
422 Ga0495653_0485801 3300046463 Bacteria 772
423 Ga0495653_0497819 3300046463 Bacteria 760
424 Ga0495580_0035177 3300046472 Bacteria 3602
425 Ga0495582_0060469 3300046473 Bacteria 2090
426 Ga0495639_0042296 3300046475 Bacteria 2054
427 Ga0495662_0027414 3300046476 Bacteria 2752
428 Ga0495662_0096283 3300046476 Bacteria 1446
429 Ga0495664_0030772 3300046477 Bacteria 3144
430 Ga0495664_0054637 3300046477 Bacteria 2374
431 Ga0495594_0018870 3300046499 Bacteria 3659
432 Ga0495594_0073965 3300046499 Bacteria 1898
433 Ga0495608_0054573 3300046511 Bacteria 2641
434 Ga0495618_0219548 3300046514 Bacteria 1199
435 Ga0495618_0309312 3300046514 Bacteria 980
436 Ga0495628_0006081 3300046516 Bacteria 10554
437 Ga0495628_0055025 3300046516 Bacteria 3134
438 Ga0495628_0684585 3300046516 Bacteria 725
439 Ga0495630_0068032 3300046517 Bacteria 2677
440 Ga0495630_0071972 3300046517 Bacteria 2602
441 Ga0495630_0076460 3300046517 Bacteria 2523
442 Ga0495630_0469106 3300046517 Bacteria 965
443 Ga0495630_1055863 3300046517 Bacteria 616
444 Ga0495630_1304177 3300046517 Bacteria 547
445 Ga0495666_0018448 3300046526 Bacteria 3471
446 Ga0495666_0055478 3300046526 Bacteria 1898
447 Ga0495652_0071875 3300046529 Bacteria 2885
448 Ga0495652_0385050 3300046529 Bacteria 996
449 Ga0495652_0405197 3300046529 Bacteria 964
450 Ga0495654_0038516 3300046530 Bacteria 2390
451 Ga0495665_0003597 3300046531 Bacteria 8412
452 Ga0495665_0013245 3300046531 Bacteria 4460
453 Ga0495665_0221432 3300046531 Bacteria 978
454 Ga0495640_0017469 3300046533 Bacteria 5347
455 Ga0495640_0035704 3300046533 Bacteria 3517
456 Ga0495640_0332618 3300046533 Bacteria 939
457 Ga0495586_0048616 3300046535 Bacteria 2292
458 Ga0495586_0075382 3300046535 Bacteria 1846
459 Ga0495586_0312129 3300046535 Bacteria 901
460 Ga0495587_0003443 3300046536 Bacteria 10553
461 Ga0495587_0062187 3300046536 Bacteria 2186
462 Ga0495587_0218056 3300046536 Bacteria 1076
463 Ga0495609_0064473 3300046538 Bacteria 1616
464 Ga0495609_0409771 3300046538 Bacteria 542
465 Ga0495645_0014290 3300046543 Bacteria 5629
466 Ga0495645_0086808 3300046543 Bacteria 2238
467 Ga0495645_0362974 3300046543 Bacteria 930
468 Ga0495622_0086097 3300046557 Bacteria 1445
469 Ga0495667_0070366 3300046559 Bacteria 2282
470 Ga0495667_0104561 3300046559 Bacteria 1830
471 Ga0495667_0538953 3300046559 Bacteria 729
472 Ga0495634_0005879 3300046642 Bacteria 9375
473 Ga0495634_0237069 3300046642 Bacteria 1120
474 Ga0495635_0011012 3300046663 Bacteria 6338
475 Ga0495635_0077571 3300046663 Bacteria 2275
476 Ga0495635_0228522 3300046663 Bacteria 1257
477 Ga0495635_0387390 3300046663 Bacteria 930
478 Ga0495588_0021306 3300046674 Bacteria 3193
479 Ga0495588_0328147 3300046674 Bacteria 805
480 Ga0495657_0041781 3300046675 Bacteria 3135
481 Ga0495657_0077614 3300046675 Bacteria 2154
482 Ga0495657_0093281 3300046675 Bacteria 1927
483 Ga0495599_0047758 3300046678 Bacteria 2682
484 Ga0495623_0012759 3300046679 Bacteria 5440
485 Ga0495623_0094847 3300046679 Bacteria 1824
486 Ga0495623_0149018 3300046679 Bacteria 1384
487 Ga0495646_0038695 3300046680 Bacteria 2943
488 Ga0495646_0384343 3300046680 Bacteria 731
489 Ga0495647_0005262 3300046681 Bacteria 4235
490 Ga0495658_0005793 3300046683 Bacteria 6064
491 Ga0495613_0017693 3300046689 Bacteria 5310
492 Ga0495613_0740839 3300046689 Bacteria 644
493 Ga0495624_0109904 3300046690 Bacteria 1695
494 Ga0495624_0254591 3300046690 Bacteria 1061
495 Ga0495624_0377485 3300046690 Bacteria 852
496 Ga0495600_0014591 3300046809 Bacteria 4952
497 Ga0495600_0073987 3300046809 Bacteria 2224
498 Ga0495600_0314608 3300046809 Bacteria 985
499 Ga0495660_0466038 3300046810 Bacteria 544
500 Ga0495581_0004893 3300047315 Bacteria 7747
501 Ga0495581_0031164 3300047315 Bacteria 3089
502 Ga0495604_0020620 3300047317 Bacteria 5263
503 Ga0495604_0064253 3300047317 Bacteria 2797
504 Ga0495604_0495633 3300047317 Bacteria 793
505 Ga0495674_0094452 3300047319 Bacteria 2550
506 Ga0495674_0135270 3300047319 Bacteria 2074
507 Ga0495674_0443917 3300047319 Bacteria 1043
508 Ga0495676_0024236 3300047321 Bacteria 5256
509 Ga0495680_0070920 3300047322 Bacteria 2654
510 Ga0495680_0104622 3300047322 Bacteria 2105
511 Ga0495680_1088183 3300047322 Bacteria 505
512 Ga0495675_0029568 3300047444 Bacteria 3495
513 Ga0495684_0006411 3300047471 Bacteria 9130
514 Ga0495684_0099936 3300047471 Bacteria 2193
515 Ga0495684_0356971 3300047471 Bacteria 1036
516 Ga0495684_0435140 3300047471 Bacteria 914
517 Ga0495593_0003319 3300047673 Bacteria 9645
518 Ga0495593_0052222 3300047673 Bacteria 2161
519 Ga0495602_0024963 3300048088 Bacteria 5791
520 Ga0495602_0315327 3300048088 Bacteria 1139
521 Ga0495614_0013559 3300048089 Bacteria 3573
522 Ga0495614_0086727 3300048089 Bacteria 1359
523 Ga0496101_0123183 3300048904 Bacteria 1962
524 Ga0496101_0470043 3300048904 Bacteria 993
525 Ga0496101_1448456 3300048904 Bacteria 535
526 Ga0496102_0032510 3300048905 Bacteria 4686
527 Ga0496102_0704893 3300048905 Bacteria 932
528 Ga0496103_0114239 3300048906 Bacteria 1716
529 Ga0496103_0448818 3300048906 Bacteria 827
530 Ga0496104_0002018 3300048907 Bacteria 17625
531 Ga0496104_0189600 3300048907 Bacteria 1967
532 Ga0496104_1499915 3300048907 Bacteria 577
533 Ga0496105_0039800 3300048908 Bacteria 3875
534 Ga0496105_0182716 3300048908 Bacteria 1717
535 Ga0496105_0639514 3300048908 Bacteria 822
536 Ga0496106_0367768 3300048909 Bacteria 1155
537 Ga0496107_0715960 3300048910 Bacteria 736
538 Ga0496108_0004105 3300048911 Bacteria 11697
539 Ga0496108_0546535 3300048911 Bacteria 1011
540 Ga0496109_0021226 3300048912 Bacteria 5741
541 Ga0496109_0853838 3300048912 Bacteria 848
542 Ga0496110_0012736 3300048913 Bacteria 6924
543 Ga0496111_0089264 3300048914 Bacteria 2257
544 Ga0496112_0421206 3300048915 Bacteria 1274
545 Ga0496112_1606780 3300048915 Bacteria 563
546 Ga0496113_0078786 3300048916 Bacteria 2521
547 Ga0496113_0409731 3300048916 Bacteria 1089
548 Ga0496115_0215335 3300048918 Bacteria 1586
549 Ga0496115_0418141 3300048918 Bacteria 1086
550 Ga0496117_0004445 3300048920 Bacteria 15459
551 Ga0496118_0000116 3300048921 Bacteria 145054
552 Ga0496119_0037894 3300048922 Bacteria 3123
553 Ga0496121_0161163 3300048924 Bacteria 1640
554 Ga0496122_0341832 3300048925 Bacteria 785
555 Ga0496124_0000135 3300048927 Bacteria 152458
556 Ga0496126_0243116 3300048929 Bacteria 1503
557 Ga0496126_0541537 3300048929 Bacteria 925
558 Ga0501306_017897 3300049127 Bacteria 965
559 Ga0501310_018138 3300049130 Bacteria 857
560 Ga0501311_022166 3300049527 Bacteria 871
561 Ga0501311_039132 3300049527 Bacteria 714
562 Ga0501311_097687 3300049527 Bacteria 517
563 Ga0501320_068869 3300049536 Bacteria 509
564 Ga0501323_027111 3300049539 Bacteria 788
565 Ga0501325_007622 3300049541 Bacteria 920
566 Ga0501330_011824 3300049546 Bacteria 633
567 Ga0501037_0728854 3300049573 Bacteria 658
568 Ga0501048_0397850 3300049582 Bacteria 984
569 Ga0501069_0424064 3300049585 Bacteria 789
570 Ga0501225_0177813 3300049705 Bacteria 663
571 nmdc:mga05p37_209234_c1 3300050507 Bacteria 2359
572 nmdc:mga05p37_707_c1 3300050507 Bacteria 37015
573 nmdc:mga09592_24046_c1 3300050508 Bacteria 5036
574 nmdc:mga09592_35_c1 3300050508 Bacteria 73534
575 nmdc:mga0qj67_33_c2 3300050509 Bacteria 85192
576 nmdc:mga06r32_1_c3 3300050510 Bacteria 67549
577 nmdc:mga08y16_1932564_c1 3300050511 Bacteria 540
578 nmdc:mga0n895_156854_c1 3300050512 Bacteria 2307
579 nmdc:mga0n895_207347_c1 3300050512 Bacteria 1991
580 nmdc:mga0rr50_32817_c1 3300050513 Bacteria 3704
581 nmdc:mga08x19_927337_c1 3300050514 Bacteria 619
582 nmdc:mga0a205_152513_c1 3300050515 Bacteria 2209
583 nmdc:mga0a205_28492_c1 3300050515 Bacteria 1249
584 Ga0495601_0009796 3300053077 Bacteria 5668
585 Ga0495601_0803111 3300053077 Bacteria 597
586 Ga0495612_0070859 3300053078 Bacteria 1453
587 Ga0495612_0082946 3300053078 Bacteria 1348
588 Ga0495612_0165261 3300053078 Bacteria 967
589 Ga0495595_0085328 3300053084 Bacteria 1509
590 Ga0495595_0100639 3300053084 Bacteria 1394
591 Ga0495619_0012355 3300053085 Bacteria 5375
592 Ga0495619_0531700 3300053085 Bacteria 807
593 Ga0500646_0075296 3300053090 Bacteria 1020
594 Ga0587084_019424 3300059477 Bacteria 1001
595 Ga0587066_002515 3300059490 Bacteria 2032
596 Ga0587066_077675 3300059490 Bacteria 713
597 Ga0587066_112134 3300059490 Bacteria 634
598 Ga0587073_0023027 3300059492 Bacteria 1215
599 Ga0587073_0032566 3300059492 Bacteria 1086
600 Ga0587073_0271992 3300059492 Bacteria 540
601 Ga0587077_001970 3300059493 Bacteria 2338
602 Ga0587077_064514 3300059493 Bacteria 803
603 Ga0587080_001892 3300059503 Bacteria 2373
604 Ga0587080_131587 3300059503 Bacteria 564
605 Ga0587082_003161 3300059504 Bacteria 1949
606 Ga0587082_007851 3300059504 Bacteria 1469
607 Ga0587082_094628 3300059504 Bacteria 642
608 Ga0587083_0002399 3300059505 Bacteria 2329
609 Ga0587085_149358 3300059506 Bacteria 538
610 Ga0587089_009457 3300059509 Bacteria 1197
611 Ga0587089_111823 3300059509 Bacteria 505
612 Ga0587090_029027 3300059510 Bacteria 914
613 Ga0587091_002709 3300059511 Bacteria 2139
614 Ga0587094_070829 3300059513 Bacteria 628
615 Ga0587098_000853 3300059604 Bacteria 2107
616 Ga0587106_013260 3300059605 Bacteria 1118
617 Ga0587099_000830 3300059622 Bacteria 1975
618 Ga0587099_057804 3300059622 Bacteria 530
619 Ga0587101_058124 3300059623 Bacteria 684
620 Ga0587115_012190 3300059626 Bacteria 1095
621 Ga0587117_054093 3300059627 Bacteria 674
622 Ga0587122_001445 3300059628 Bacteria 1552
623 Ga0587128_005236 3300059630 Bacteria 1541
624 Ga0587128_043241 3300059630 Bacteria 796
625 Ga0587062_035447 3300059639 Bacteria 785
626 Ga0587062_050706 3300059639 Bacteria 702
627 Ga0587067_002165 3300059640 Bacteria 2278
628 Ga0587067_059736 3300059640 Bacteria 796
629 Ga0587068_004670 3300059641 Bacteria 1823
630 Ga0587069_130416 3300059642 Bacteria 541
631 Ga0587072_006669 3300059643 Bacteria 1766
632 Ga0587072_016702 3300059643 Bacteria 1259
633 Ga0587075_018172 3300059644 Bacteria 1018
634 Ga0587076_020339 3300059645 Bacteria 1088
635 Ga0587078_034720 3300059646 Bacteria 692
636 Ga0587104_024499 3300059650 Bacteria 518
637 Ga0587107_001080 3300059652 Bacteria 2095
638 Ga0587110_030486 3300059654 Bacteria 655
639 Ga0587114_009012 3300059655 Bacteria 1186
640 Ga0587120_020535 3300059659 Bacteria 626
641 Ga0587071_003160 3300060344 Bacteria 2331
642 Ga0466962_0029867 3300061719 Bacteria 2609
643 Ga0466962_0044300 3300061719 Bacteria 2128
644 Ga0466962_0167900 3300061719 Bacteria 1068
645 Ga0466962_0514735 3300061719 Bacteria 606

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013306 Ga0163162_10157865 Ga0163162_101578652 85
2 3300035114 Ga0373939_0234561 Ga0373939_0234561_262_540 85
3 3300045836 Ga0466958_0951943 Ga0466958_0951943_127_453 85
4 3300050512 nmdc:mga0n895_207347_c1 nmdc:mga0n895_207347_c1_944_1222 85
5 3300050513 nmdc:mga0rr50_32817_c1 nmdc:mga0rr50_32817_c1_2892_3170 85
6 3300050515 nmdc:mga0a205_28492_c1 nmdc:mga0a205_28492_c1_156_434 85
7 iso_pu_bacteria 2984576629 2984579586 85
8 iso_pu_bacteria 2990256926 2990257193 85
9 3300020082 Ga0206353_11898514 Ga0206353_118985143 87
10 3300037418 Ga0395900_0021670 Ga0395900_0021670_2958_3272 87
11 3300038443 Ga0395901_0011417 Ga0395901_0011417_5688_6002 87
12 3300046463 Ga0495653_0485801 Ga0495653_0485801_285_548 87
13 3300049527 Ga0501311_022166 Ga0501311_022166_476_739 87
14 3300049546 Ga0501330_011824 Ga0501330_011824_75_350 87
15 3300049705 Ga0501225_0177813 Ga0501225_0177813_322_585 87
16 iso_pu_bacteria 2734482000 2734970101 87
17 3300005329 Ga0070683_101823600 Ga0070683_1018236001 88
18 3300005615 Ga0070702_100813434 Ga0070702_1008134341 88
19 3300013307 Ga0157372_11393227 Ga0157372_113932272 88
20 3300020077 Ga0206351_10373923 Ga0206351_103739232 88
21 3300020081 Ga0206354_10368332 Ga0206354_103683323 88
22 3300025910 Ga0207684_10886026 Ga0207684_108860261 88
23 3300037418 Ga0395900_0123671 Ga0395900_0123671_319_618 88
24 3300037466 Ga0395898_0072810 Ga0395898_0072810_1574_1873 88
25 3300044694 Ga0466963_0032630 Ga0466963_0032630_397_669 88
26 3300044842 Ga0466957_0342862 Ga0466957_0342862_493_765 88
27 3300045049 Ga0466959_0103930 Ga0466959_0103930_304_600 88
28 3300045836 Ga0466958_0017088 Ga0466958_0017088_686_958 88
29 3300045976 Ga0466967_2062256 Ga0466967_2062256_145_444 88
30 3300045976 Ga0466967_2189473 Ga0466967_2189473_104_400 88
31 3300045976 Ga0466967_2498688 Ga0466967_2498688_104_376 88
32 3300059623 Ga0587101_058124 Ga0587101_058124_221_517 88
33 3300061719 Ga0466962_0044300 Ga0466962_0044300_714_986 88
34 iso_pu_bacteria 2751185788 2753303689 88
35 iso_pu_bacteria 2904430863 2904432386 88
36 iso_pu_bacteria 2904501621 2904501818 88
37 iso_pu_bacteria 2908674828 2908676128 88
38 iso_pu_bacteria 2909074476 2909076605 88
39 iso_pu_bacteria 2919039151 2919040064 88
40 iso_pu_bacteria 2919042368 2919043183 88
41 iso_pu_bacteria 2928104781 2928105478 88
42 iso_pu_bacteria 2928500415 2928500996 88
43 iso_pu_bacteria 2984551494 2984551985 88
44 3300004801 Ga0058860_12148150 Ga0058860_121481502 89
45 3300019190 Ga0184600_101748 Ga0184600_1017481 89
46 3300021388 Ga0213875_10243769 Ga0213875_102437692 89
47 3300024225 Ga0224572_1026985 Ga0224572_10269853 89
48 3300025929 Ga0207664_10016921 Ga0207664_100169219 89
49 3300027512 Ga0209179_1146784 Ga0209179_11467842 89
50 3300033547 Ga0316212_1019878 Ga0316212_10198781 89
51 3300037853 Ga0436364_0697983 Ga0436364_0697983_285_566 89
52 3300037853 Ga0436364_1139829 Ga0436364_1139829_1625_1900 89
53 3300039438 Ga0436360_1358491 Ga0436360_1358491_496_780 89
54 3300039453 Ga0436362_0080480 Ga0436362_0080480_840_1124 89
55 3300044694 Ga0466963_0056835 Ga0466963_0056835_558_833 89
56 3300044694 Ga0466963_0144726 Ga0466963_0144726_595_870 89
57 3300045836 Ga0466958_0129643 Ga0466958_0129643_1162_1437 89
58 3300045976 Ga0466967_1781871 Ga0466967_1781871_224_493 89
59 3300049582 Ga0501048_0397850 Ga0501048_0397850_594_863 89
60 3300059639 Ga0587062_035447 Ga0587062_035447_165_434 89
61 iso_pu_bacteria 2811994880 2812364368 89
62 3300003574 Ga0007410J51695_1043507 Ga0007410J51695_10435073 90
63 3300003693 Ga0032354_1051217 Ga0032354_10512172 90
64 3300005435 Ga0070714_100001124 Ga0070714_10000112423 90
65 3300005436 Ga0070713_101206283 Ga0070713_1012062831 90
66 3300005445 Ga0070708_101187265 Ga0070708_1011872651 90
67 3300005467 Ga0070706_100257139 Ga0070706_1002571394 90
68 3300005467 Ga0070706_100346334 Ga0070706_1003463344 90
69 3300005468 Ga0070707_100098495 Ga0070707_1000984954 90
70 3300005468 Ga0070707_100197595 Ga0070707_1001975954 90
71 3300005468 Ga0070707_101906745 Ga0070707_1019067452 90
72 3300005471 Ga0070698_100001882 Ga0070698_10000188218 90
73 3300005518 Ga0070699_100418034 Ga0070699_1004180342 90
74 3300005536 Ga0070697_100038833 Ga0070697_1000388337 90
75 3300005983 Ga0081540_1022585 Ga0081540_10225854 90
76 3300006028 Ga0070717_10214680 Ga0070717_102146801 90
77 3300006844 Ga0075428_100099463 Ga0075428_1000994634 90
78 3300006846 Ga0075430_100047794 Ga0075430_1000477944 90
79 3300006847 Ga0075431_100006706 Ga0075431_10000670614 90
80 3300006852 Ga0075433_10271224 Ga0075433_102712243 90
81 3300006880 Ga0075429_100005726 Ga0075429_10000572613 90
82 3300006880 Ga0075429_100015532 Ga0075429_10001553212 90
83 3300009147 Ga0114129_10015903 Ga0114129_1001590320 90
84 3300009147 Ga0114129_10085359 Ga0114129_100853594 90
85 3300020069 Ga0197907_11321259 Ga0197907_113212599 90
86 3300020070 Ga0206356_11612728 Ga0206356_116127283 90
87 3300020075 Ga0206349_1658620 Ga0206349_16586201 90
88 3300020076 Ga0206355_1627926 Ga0206355_16279264 90
89 3300020078 Ga0206352_11126397 Ga0206352_111263973 90
90 3300020080 Ga0206350_11613293 Ga0206350_116132933 90
91 3300020081 Ga0206354_10926327 Ga0206354_109263273 90
92 3300020082 Ga0206353_11847015 Ga0206353_118470153 90
93 3300022467 Ga0224712_10037453 Ga0224712_100374533 90
94 3300025898 Ga0207692_10228046 Ga0207692_102280461 90
95 3300025910 Ga0207684_10027808 Ga0207684_100278083 90
96 3300025910 Ga0207684_10469944 Ga0207684_104699441 90
97 3300025922 Ga0207646_10079404 Ga0207646_100794046 90
98 3300025922 Ga0207646_10188791 Ga0207646_101887913 90
99 3300025929 Ga0207664_10001032 Ga0207664_1000103211 90
100 3300025929 Ga0207664_10093952 Ga0207664_100939523 90
101 3300025939 Ga0207665_10346687 Ga0207665_103466872 90
102 3300030889 Ga0265761_108369 Ga0265761_1083691 90
103 3300031090 Ga0265760_10128304 Ga0265760_101283042 90
104 3300031995 Ga0307409_102160686 Ga0307409_1021606861 90
105 3300035088 Ga0373940_0263542 Ga0373940_0263542_223_498 90
106 3300035112 Ga0373932_0221165 Ga0373932_0221165_295_567 90
107 3300035113 Ga0373936_0468932 Ga0373936_0468932_109_381 90
108 3300035118 Ga0373954_0089960 Ga0373954_0089960_667_939 90
109 3300035118 Ga0373954_0294384 Ga0373954_0294384_184_456 90
110 3300035121 Ga0373960_0179742 Ga0373960_0179742_415_705 90
111 3300036401 Ga0373937_0283190 Ga0373937_0283190_944_1216 90
112 3300036457 Ga0265778_014641 Ga0265778_014641_607_891 90
113 3300037312 Ga0395899_0724377 Ga0395899_0724377_65_340 90
114 3300037418 Ga0395900_0853169 Ga0395900_0853169_173_445 90
115 3300039450 Ga0436363_0387806 Ga0436363_0387806_261_539 90
116 3300044684 Ga0466966_0333615 Ga0466966_0333615_283_579 90
117 3300044693 Ga0466961_0018685 Ga0466961_0018685_153_431 90
118 3300044719 Ga0466971_0168729 Ga0466971_0168729_66_344 90
119 3300044765 Ga0466970_0938761 Ga0466970_0938761_96_374 90
120 3300045836 Ga0466958_0067645 Ga0466958_0067645_1104_1382 90
121 3300046459 Ga0495629_0979595 Ga0495629_0979595_176_448 90
122 3300046461 Ga0495641_0224277 Ga0495641_0224277_98_370 90
123 3300046462 Ga0495651_0154494 Ga0495651_0154494_921_1193 90
124 3300046499 Ga0495594_0073965 Ga0495594_0073965_458_748 90
125 3300046516 Ga0495628_0684585 Ga0495628_0684585_232_504 90
126 3300046517 Ga0495630_1055863 Ga0495630_1055863_323_595 90
127 3300046536 Ga0495587_0218056 Ga0495587_0218056_525_797 90
128 3300046559 Ga0495667_0104561 Ga0495667_0104561_971_1243 90
129 3300046642 Ga0495634_0237069 Ga0495634_0237069_556_828 90
130 3300046663 Ga0495635_0387390 Ga0495635_0387390_229_501 90
131 3300046675 Ga0495657_0093281 Ga0495657_0093281_985_1257 90
132 3300046679 Ga0495623_0094847 Ga0495623_0094847_954_1226 90
133 3300046690 Ga0495624_0377485 Ga0495624_0377485_28_300 90
134 3300046809 Ga0495600_0314608 Ga0495600_0314608_492_764 90
135 3300047322 Ga0495680_1088183 Ga0495680_1088183_12_284 90
136 3300047471 Ga0495684_0435140 Ga0495684_0435140_339_611 90
137 3300048907 Ga0496104_1499915 Ga0496104_1499915_163_435 90
138 3300048908 Ga0496105_0639514 Ga0496105_0639514_482_754 90
139 3300049573 Ga0501037_0728854 Ga0501037_0728854_307_582 90
140 3300050507 nmdc:mga05p37_209234_c1 nmdc:mga05p37_209234_c1_1795_2070 90
141 3300050507 nmdc:mga05p37_707_c1 nmdc:mga05p37_707_c1_14019_14294 90
142 3300050508 nmdc:mga09592_24046_c1 nmdc:mga09592_24046_c1_1545_1820 90
143 3300050508 nmdc:mga09592_35_c1 nmdc:mga09592_35_c1_65950_66225 90
144 3300050509 nmdc:mga0qj67_33_c2 nmdc:mga0qj67_33_c2_77547_77822 90
145 3300050510 nmdc:mga06r32_1_c3 nmdc:mga06r32_1_c3_1325_1600 90
146 3300050515 nmdc:mga0a205_152513_c1 nmdc:mga0a205_152513_c1_1027_1299 90
147 3300053078 Ga0495612_0165261 Ga0495612_0165261_153_425 90
148 3300059492 Ga0587073_0271992 Ga0587073_0271992_160_438 90
149 3300061719 Ga0466962_0514735 Ga0466962_0514735_205_483 90
150 iso_pu_bacteria 2622736605 2623497650 90
151 iso_pu_bacteria 2919051321 2919052525 90
152 3300001990 JGI24737J22298_10028203 JGI24737J22298_100282033 91
153 3300002075 JGI24738J21930_10015386 JGI24738J21930_100153861 91
154 3300003162 Ga0006778J45830_1022691 Ga0006778J45830_10226913 91
155 3300003659 JGI25404J52841_10004898 JGI25404J52841_100048981 91
156 3300004799 Ga0058863_11721945 Ga0058863_117219451 91
157 3300004799 Ga0058863_11957706 Ga0058863_119577063 91
158 3300004801 Ga0058860_11980957 Ga0058860_119809571 91
159 3300004803 Ga0058862_10000712 Ga0058862_100007123 91
160 3300004803 Ga0058862_12871663 Ga0058862_128716633 91
161 3300005329 Ga0070683_100189872 Ga0070683_1001898724 91
162 3300005329 Ga0070683_100523299 Ga0070683_1005232993 91
163 3300005329 Ga0070683_101841809 Ga0070683_1018418092 91
164 3300005330 Ga0070690_100732715 Ga0070690_1007327152 91
165 3300005337 Ga0070682_100387842 Ga0070682_1003878423 91
166 3300005338 Ga0068868_100420703 Ga0068868_1004207033 91
167 3300005344 Ga0070661_100117520 Ga0070661_1001175204 91
168 3300005344 Ga0070661_100718822 Ga0070661_1007188223 91
169 3300005345 Ga0070692_10075882 Ga0070692_100758822 91
170 3300005354 Ga0070675_101670948 Ga0070675_1016709481 91
171 3300005355 Ga0070671_100227176 Ga0070671_1002271762 91
172 3300005366 Ga0070659_100791008 Ga0070659_1007910082 91
173 3300005406 Ga0070703_10001744 Ga0070703_100017444 91
174 3300005434 Ga0070709_10276185 Ga0070709_102761852 91
175 3300005434 Ga0070709_10479627 Ga0070709_104796272 91
176 3300005434 Ga0070709_11522147 Ga0070709_115221472 91
177 3300005435 Ga0070714_100003109 Ga0070714_10000310921 91
178 3300005435 Ga0070714_100913651 Ga0070714_1009136512 91
179 3300005435 Ga0070714_101068137 Ga0070714_1010681372 91
180 3300005435 Ga0070714_101420419 Ga0070714_1014204192 91
181 3300005435 Ga0070714_102151578 Ga0070714_1021515782 91
182 3300005436 Ga0070713_100001233 Ga0070713_1000012334 91
183 3300005436 Ga0070713_100227446 Ga0070713_1002274463 91
184 3300005436 Ga0070713_100917954 Ga0070713_1009179542 91
185 3300005436 Ga0070713_101534455 Ga0070713_1015344552 91
186 3300005436 Ga0070713_102130459 Ga0070713_1021304592 91
187 3300005437 Ga0070710_10000437 Ga0070710_1000043710 91
188 3300005437 Ga0070710_10314212 Ga0070710_103142122 91
189 3300005437 Ga0070710_11005374 Ga0070710_110053741 91
190 3300005439 Ga0070711_100045638 Ga0070711_1000456384 91
191 3300005439 Ga0070711_100072955 Ga0070711_1000729552 91
192 3300005439 Ga0070711_100191052 Ga0070711_1001910524 91
193 3300005439 Ga0070711_101812715 Ga0070711_1018127151 91
194 3300005439 Ga0070711_101833257 Ga0070711_1018332571 91
195 3300005445 Ga0070708_100659845 Ga0070708_1006598451 91
196 3300005445 Ga0070708_101468702 Ga0070708_1014687021 91
197 3300005456 Ga0070678_100500757 Ga0070678_1005007572 91
198 3300005457 Ga0070662_100036864 Ga0070662_1000368648 91
199 3300005458 Ga0070681_11804584 Ga0070681_118045841 91
200 3300005467 Ga0070706_100003720 Ga0070706_1000037209 91
201 3300005468 Ga0070707_100021481 Ga0070707_1000214816 91
202 3300005468 Ga0070707_100183589 Ga0070707_1001835894 91
203 3300005468 Ga0070707_100882677 Ga0070707_1008826771 91
204 3300005468 Ga0070707_101198117 Ga0070707_1011981171 91
205 3300005468 Ga0070707_102013802 Ga0070707_1020138021 91
206 3300005471 Ga0070698_100018293 Ga0070698_1000182934 91
207 3300005471 Ga0070698_100869854 Ga0070698_1008698542 91
208 3300005535 Ga0070684_100362268 Ga0070684_1003622683 91
209 3300005535 Ga0070684_100948705 Ga0070684_1009487052 91
210 3300005536 Ga0070697_101408534 Ga0070697_1014085342 91
211 3300005547 Ga0070693_100581968 Ga0070693_1005819682 91
212 3300005548 Ga0070665_100476653 Ga0070665_1004766532 91
213 3300005564 Ga0070664_100041377 Ga0070664_1000413772 91
214 3300005577 Ga0068857_100364734 Ga0068857_1003647343 91
215 3300005577 Ga0068857_101705902 Ga0068857_1017059022 91
216 3300005615 Ga0070702_100373834 Ga0070702_1003738343 91
217 3300005615 Ga0070702_100785118 Ga0070702_1007851181 91
218 3300005616 Ga0068852_100729200 Ga0068852_1007292002 91
219 3300005617 Ga0068859_100670474 Ga0068859_1006704743 91
220 3300005618 Ga0068864_100089287 Ga0068864_1000892876 91
221 3300005618 Ga0068864_100100693 Ga0068864_1001006936 91
222 3300005618 Ga0068864_100467420 Ga0068864_1004674203 91
223 3300005719 Ga0068861_100064654 Ga0068861_1000646545 91
224 3300005841 Ga0068863_100366384 Ga0068863_1003663842 91
225 3300005842 Ga0068858_100129309 Ga0068858_1001293092 91
226 3300005843 Ga0068860_100644706 Ga0068860_1006447063 91
227 3300005843 Ga0068860_101483819 Ga0068860_1014838192 91
228 3300005844 Ga0068862_101239261 Ga0068862_1012392612 91
229 3300005983 Ga0081540_1000341 Ga0081540_100034131 91
230 3300005983 Ga0081540_1047724 Ga0081540_10477244 91
231 3300005985 Ga0081539_10104788 Ga0081539_101047884 91
232 3300006028 Ga0070717_10010919 Ga0070717_100109193 91
233 3300006028 Ga0070717_10135605 Ga0070717_101356052 91
234 3300006028 Ga0070717_11273771 Ga0070717_112737712 91
235 3300006163 Ga0070715_10188857 Ga0070715_101888572 91
236 3300006163 Ga0070715_10473647 Ga0070715_104736472 91
237 3300006173 Ga0070716_100000511 Ga0070716_10000051124 91
238 3300006173 Ga0070716_100084223 Ga0070716_1000842234 91
239 3300006175 Ga0070712_100001287 Ga0070712_1000012873 91
240 3300006175 Ga0070712_100014381 Ga0070712_10001438110 91
241 3300006175 Ga0070712_100600539 Ga0070712_1006005392 91
242 3300006175 Ga0070712_101711548 Ga0070712_1017115482 91
243 3300006175 Ga0070712_101805339 Ga0070712_1018053391 91
244 3300006175 Ga0070712_102053952 Ga0070712_1020539522 91
245 3300006237 Ga0097621_100042306 Ga0097621_1000423063 91
246 3300006237 Ga0097621_100351151 Ga0097621_1003511513 91
247 3300006358 Ga0068871_100308964 Ga0068871_1003089642 91
248 3300006847 Ga0075431_100598519 Ga0075431_1005985192 91
249 3300006871 Ga0075434_100016693 Ga0075434_1000166935 91
250 3300006871 Ga0075434_100126789 Ga0075434_1001267895 91
251 3300006871 Ga0075434_100725765 Ga0075434_1007257653 91
252 3300006914 Ga0075436_100227898 Ga0075436_1002278982 91
253 3300006914 Ga0075436_100270029 Ga0075436_1002700292 91
254 3300006931 Ga0097620_100670479 Ga0097620_1006704793 91
255 3300007076 Ga0075435_100081437 Ga0075435_1000814376 91
256 3300007076 Ga0075435_100281215 Ga0075435_1002812154 91
257 3300007076 Ga0075435_100560897 Ga0075435_1005608973 91
258 3300007788 Ga0099795_10005676 Ga0099795_100056763 91
259 3300007788 Ga0099795_10263560 Ga0099795_102635603 91
260 3300009094 Ga0111539_10309079 Ga0111539_103090791 91
261 3300009098 Ga0105245_10028695 Ga0105245_100286954 91
262 3300009098 Ga0105245_10516397 Ga0105245_105163971 91
263 3300009101 Ga0105247_11596078 Ga0105247_115960781 91
264 3300009147 Ga0114129_11910986 Ga0114129_119109862 91
265 3300009148 Ga0105243_11313044 Ga0105243_113130441 91
266 3300009174 Ga0105241_12207243 Ga0105241_122072431 91
267 3300009176 Ga0105242_11856509 Ga0105242_118565092 91
268 3300009545 Ga0105237_10205919 Ga0105237_102059191 91
269 3300009545 Ga0105237_11157419 Ga0105237_111574192 91
270 3300009551 Ga0105238_10389366 Ga0105238_103893663 91
271 3300009553 Ga0105249_12884881 Ga0105249_128848811 91
272 3300010159 Ga0099796_10119283 Ga0099796_101192833 91
273 3300010375 Ga0105239_10031478 Ga0105239_100314784 91
274 3300010375 Ga0105239_12199722 Ga0105239_121997221 91
275 3300011119 Ga0105246_10941664 Ga0105246_109416642 91
276 3300013104 Ga0157370_10517815 Ga0157370_105178152 91
277 3300013105 Ga0157369_10858116 Ga0157369_108581162 91
278 3300013296 Ga0157374_10030097 Ga0157374_1003009711 91
279 3300013296 Ga0157374_10393549 Ga0157374_103935493 91
280 3300013297 Ga0157378_10437009 Ga0157378_104370094 91
281 3300013307 Ga0157372_10217071 Ga0157372_102170713 91
282 3300013307 Ga0157372_10439772 Ga0157372_104397723 91
283 3300013307 Ga0157372_11900388 Ga0157372_119003881 91
284 3300013308 Ga0157375_10289818 Ga0157375_102898184 91
285 3300014325 Ga0163163_10297835 Ga0163163_102978354 91
286 3300014325 Ga0163163_10321708 Ga0163163_103217082 91
287 3300014325 Ga0163163_11847124 Ga0163163_118471242 91
288 3300014497 Ga0182008_10084220 Ga0182008_100842203 91
289 3300014745 Ga0157377_11276132 Ga0157377_112761321 91
290 3300014968 Ga0157379_10011666 Ga0157379_1001166614 91
291 3300014968 Ga0157379_10420833 Ga0157379_104208332 91
292 3300014969 Ga0157376_11099675 Ga0157376_110996752 91
293 3300015265 Ga0182005_1092653 Ga0182005_10926531 91
294 3300020069 Ga0197907_10537378 Ga0197907_105373782 91
295 3300020069 Ga0197907_10950516 Ga0197907_109505162 91
296 3300020070 Ga0206356_11171823 Ga0206356_111718232 91
297 3300020076 Ga0206355_1179809 Ga0206355_11798092 91
298 3300020080 Ga0206350_10990969 Ga0206350_109909693 91
299 3300020081 Ga0206354_10110661 Ga0206354_101106613 91
300 3300020081 Ga0206354_11310032 Ga0206354_113100322 91
301 3300020081 Ga0206354_11496319 Ga0206354_114963191 91
302 3300020082 Ga0206353_10645923 Ga0206353_106459231 91
303 3300020082 Ga0206353_11155186 Ga0206353_111551862 91
304 3300020082 Ga0206353_11323745 Ga0206353_113237453 91
305 3300020082 Ga0206353_11381381 Ga0206353_113813811 91
306 3300021358 Ga0213873_10149280 Ga0213873_101492802 91
307 3300021384 Ga0213876_10522052 Ga0213876_105220521 91
308 3300021388 Ga0213875_10010857 Ga0213875_100108579 91
309 3300021388 Ga0213875_10106303 Ga0213875_101063034 91
310 3300022467 Ga0224712_10255346 Ga0224712_102553461 91
311 3300022467 Ga0224712_10338561 Ga0224712_103385612 91
312 3300025898 Ga0207692_10001130 Ga0207692_1000113012 91
313 3300025898 Ga0207692_10123800 Ga0207692_101238004 91
314 3300025898 Ga0207692_11182624 Ga0207692_111826242 91
315 3300025900 Ga0207710_10273231 Ga0207710_102732312 91
316 3300025901 Ga0207688_10317498 Ga0207688_103174982 91
317 3300025901 Ga0207688_10565290 Ga0207688_105652902 91
318 3300025906 Ga0207699_10000260 Ga0207699_1000026016 91
319 3300025906 Ga0207699_10563416 Ga0207699_105634161 91
320 3300025910 Ga0207684_10016512 Ga0207684_1001651211 91
321 3300025910 Ga0207684_10333546 Ga0207684_103335464 91
322 3300025910 Ga0207684_11430348 Ga0207684_114303482 91
323 3300025912 Ga0207707_10388364 Ga0207707_103883643 91
324 3300025912 Ga0207707_11040894 Ga0207707_110408942 91
325 3300025914 Ga0207671_10215586 Ga0207671_102155862 91
326 3300025914 Ga0207671_11313469 Ga0207671_113134692 91
327 3300025915 Ga0207693_10004081 Ga0207693_1000408120 91
328 3300025915 Ga0207693_10024997 Ga0207693_1002499710 91
329 3300025915 Ga0207693_10178908 Ga0207693_101789084 91
330 3300025915 Ga0207693_10765073 Ga0207693_107650732 91
331 3300025916 Ga0207663_10000595 Ga0207663_1000059524 91
332 3300025916 Ga0207663_10212114 Ga0207663_102121144 91
333 3300025916 Ga0207663_11522477 Ga0207663_115224772 91
334 3300025919 Ga0207657_10324694 Ga0207657_103246942 91
335 3300025920 Ga0207649_11492506 Ga0207649_114925062 91
336 3300025922 Ga0207646_10019054 Ga0207646_100190544 91
337 3300025922 Ga0207646_10091536 Ga0207646_100915362 91
338 3300025924 Ga0207694_10909492 Ga0207694_109094923 91
339 3300025926 Ga0207659_10835760 Ga0207659_108357603 91
340 3300025927 Ga0207687_10050704 Ga0207687_100507044 91
341 3300025928 Ga0207700_10000091 Ga0207700_1000009145 91
342 3300025928 Ga0207700_10053796 Ga0207700_100537964 91
343 3300025928 Ga0207700_10104512 Ga0207700_101045123 91
344 3300025928 Ga0207700_10600350 Ga0207700_106003503 91
345 3300025928 Ga0207700_11699185 Ga0207700_116991851 91
346 3300025929 Ga0207664_10001323 Ga0207664_1000132324 91
347 3300025929 Ga0207664_10409685 Ga0207664_104096854 91
348 3300025929 Ga0207664_10790899 Ga0207664_107908992 91
349 3300025929 Ga0207664_10871334 Ga0207664_108713342 91
350 3300025931 Ga0207644_11682359 Ga0207644_116823591 91
351 3300025933 Ga0207706_10776718 Ga0207706_107767181 91
352 3300025935 Ga0207709_10902866 Ga0207709_109028661 91
353 3300025939 Ga0207665_10000821 Ga0207665_1000082124 91
354 3300025939 Ga0207665_10012079 Ga0207665_100120792 91
355 3300025941 Ga0207711_10216871 Ga0207711_102168713 91
356 3300025944 Ga0207661_10689520 Ga0207661_106895203 91
357 3300025944 Ga0207661_11163908 Ga0207661_111639082 91
358 3300026023 Ga0207677_10102410 Ga0207677_101024102 91
359 3300026035 Ga0207703_10089913 Ga0207703_100899132 91
360 3300026035 Ga0207703_10317468 Ga0207703_103174682 91
361 3300026075 Ga0207708_10254560 Ga0207708_102545603 91
362 3300026075 Ga0207708_10804487 Ga0207708_108044873 91
363 3300026078 Ga0207702_10958647 Ga0207702_109586472 91
364 3300026088 Ga0207641_10337316 Ga0207641_103373164 91
365 3300026095 Ga0207676_11547644 Ga0207676_115476442 91
366 3300026116 Ga0207674_10014845 Ga0207674_1001484515 91
367 3300026116 Ga0207674_10282848 Ga0207674_102828483 91
368 3300026118 Ga0207675_100010883 Ga0207675_10001088311 91
369 3300026142 Ga0207698_11021238 Ga0207698_110212382 91
370 3300028379 Ga0268266_10057547 Ga0268266_100575473 91
371 3300030760 Ga0265762_1005987 Ga0265762_10059872 91
372 3300031901 Ga0307406_10162975 Ga0307406_101629753 91
373 3300032002 Ga0307416_102032414 Ga0307416_1020324141 91
374 3300032126 Ga0307415_100681042 Ga0307415_1006810422 91
375 3300034816 Ga0373930_0130636 Ga0373930_0130636_230_514 91
376 3300034818 Ga0373950_0062232 Ga0373950_0062232_218_502 91
377 3300034819 Ga0373958_0071457 Ga0373958_0071457_334_624 91
378 3300034957 Ga0373938_0113643 Ga0373938_0113643_204_515 91
379 3300035083 Ga0373926_0001795 Ga0373926_0001795_6225_6509 91
380 3300035083 Ga0373926_0398212 Ga0373926_0398212_107_403 91
381 3300035086 Ga0373934_0030274 Ga0373934_0030274_874_1158 91
382 3300035086 Ga0373934_0508346 Ga0373934_0508346_143_430 91
383 3300035089 Ga0373944_0005972 Ga0373944_0005972_1217_1501 91
384 3300035090 Ga0373949_0090156 Ga0373949_0090156_109_393 91
385 3300035111 Ga0373923_0012347 Ga0373923_0012347_1135_1431 91
386 3300035111 Ga0373923_0029180 Ga0373923_0029180_1455_1739 91
387 3300035113 Ga0373936_0090925 Ga0373936_0090925_227_511 91
388 3300035116 Ga0373945_0006856 Ga0373945_0006856_2181_2465 91
389 3300035116 Ga0373945_0071172 Ga0373945_0071172_491_787 91
390 3300035116 Ga0373945_0129528 Ga0373945_0129528_38_316 91
391 3300035117 Ga0373953_0010766 Ga0373953_0010766_1258_1542 91
392 3300035118 Ga0373954_0021194 Ga0373954_0021194_883_1167 91
393 3300035118 Ga0373954_0032674 Ga0373954_0032674_1360_1656 91
394 3300035118 Ga0373954_0258067 Ga0373954_0258067_422_706 91
395 3300035119 Ga0373956_0064292 Ga0373956_0064292_91_387 91
396 3300035119 Ga0373956_0091360 Ga0373956_0091360_13_297 91
397 3300035120 Ga0373957_0001041 Ga0373957_0001041_5730_6026 91
398 3300035120 Ga0373957_0007693 Ga0373957_0007693_2127_2411 91
399 3300035170 Ga0373943_0011419 Ga0373943_0011419_1098_1382 91
400 3300035170 Ga0373943_0583776 Ga0373943_0583776_258_536 91
401 3300035172 Ga0373955_0002432 Ga0373955_0002432_5836_6132 91
402 3300035172 Ga0373955_0028721 Ga0373955_0028721_864_1148 91
403 3300035410 Ga0373924_0028077 Ga0373924_0028077_265_561 91
404 3300035691 Ga0373931_0018524 Ga0373931_0018524_164_475 91
405 3300035692 Ga0373935_0089335 Ga0373935_0089335_690_986 91
406 3300035692 Ga0373935_0090005 Ga0373935_0090005_1117_1401 91
407 3300035695 Ga0373927_0052651 Ga0373927_0052651_1015_1299 91
408 3300035695 Ga0373927_0588458 Ga0373927_0588458_105_401 91
409 3300035724 Ga0373933_0126906 Ga0373933_0126906_773_1057 91
410 3300035724 Ga0373933_0498813 Ga0373933_0498813_415_711 91
411 3300035725 Ga0373947_0036657 Ga0373947_0036657_143_439 91
412 3300035725 Ga0373947_0175004 Ga0373947_0175004_600_884 91
413 3300035725 Ga0373947_0259543 Ga0373947_0259543_398_676 91
414 3300036401 Ga0373937_0145982 Ga0373937_0145982_964_1248 91
415 3300036401 Ga0373937_0762235 Ga0373937_0762235_579_857 91
416 3300036401 Ga0373937_2055101 Ga0373937_2055101_36_323 91
417 3300037068 Ga0373925_0146321 Ga0373925_0146321_1010_1294 91
418 3300037068 Ga0373925_1072513 Ga0373925_1072513_19_306 91
419 3300037312 Ga0395899_0320952 Ga0395899_0320952_165_458 91
420 3300037418 Ga0395900_0367318 Ga0395900_0367318_629_922 91
421 3300037418 Ga0395900_1155716 Ga0395900_1155716_55_366 91
422 3300037466 Ga0395898_1401769 Ga0395898_1401769_39_332 91
423 3300037853 Ga0436364_0435690 Ga0436364_0435690_97_381 91
424 3300037853 Ga0436364_0572882 Ga0436364_0572882_261_560 91
425 3300037853 Ga0436364_1354648 Ga0436364_1354648_50146_50436 91
426 3300037853 Ga0436364_1385979 Ga0436364_1385979_42_320 91
427 3300038443 Ga0395901_0013538 Ga0395901_0013538_4449_4760 91
428 3300038443 Ga0395901_0042762 Ga0395901_0042762_2473_2766 91
429 3300039437 Ga0436365_0140149 Ga0436365_0140149_211_495 91
430 3300039437 Ga0436365_0323587 Ga0436365_0323587_619_909 91
431 3300039437 Ga0436365_0480233 Ga0436365_0480233_361_660 91
432 3300039437 Ga0436365_1206898 Ga0436365_1206898_205_498 91
433 3300039438 Ga0436360_0896384 Ga0436360_0896384_372_647 91
434 3300039450 Ga0436363_0420441 Ga0436363_0420441_121_408 91
435 3300039450 Ga0436363_0608057 Ga0436363_0608057_560_853 91
436 3300039450 Ga0436363_0984261 Ga0436363_0984261_486_785 91
437 3300039450 Ga0436363_1244160 Ga0436363_1244160_867_1166 91
438 3300039453 Ga0436362_0108632 Ga0436362_0108632_266_568 91
439 3300041456 Ga0451795_0116542 Ga0451795_0116542_85_387 91
440 3300041462 Ga0451806_416377 Ga0451806_416377_253_537 91
441 3300041486 Ga0451807_0540349 Ga0451807_0540349_241_525 91
442 3300041491 Ga0451833_0714288 Ga0451833_0714288_1442_1744 91
443 3300041492 Ga0451835_0428021 Ga0451835_0428021_299_601 91
444 3300041496 Ga0451839_0404311 Ga0451839_0404311_716_1000 91
445 3300041502 Ga0451846_22992 Ga0451846_22992_17_301 91
446 3300041507 Ga0451851_0106851 Ga0451851_0106851_143_445 91
447 3300044656 Ga0466969_0133478 Ga0466969_0133478_131_415 91
448 3300044706 Ga0466964_0401321 Ga0466964_0401321_56_367 91
449 3300044706 Ga0466964_0456857 Ga0466964_0456857_90_389 91
450 3300044735 Ga0466968_0174414 Ga0466968_0174414_420_704 91
451 3300044735 Ga0466968_0399061 Ga0466968_0399061_327_614 91
452 3300044765 Ga0466970_0019956 Ga0466970_0019956_3062_3346 91
453 3300044842 Ga0466957_0480171 Ga0466957_0480171_42_353 91
454 3300044842 Ga0466957_0687294 Ga0466957_0687294_165_464 91
455 3300044842 Ga0466957_1376465 Ga0466957_1376465_154_465 91
456 3300044901 Ga0466960_0783069 Ga0466960_0783069_167_451 91
457 3300044901 Ga0466960_0930207 Ga0466960_0930207_63_377 91
458 3300045049 Ga0466959_0500242 Ga0466959_0500242_190_501 91
459 3300045836 Ga0466958_0572110 Ga0466958_0572110_264_563 91
460 3300045976 Ga0466967_0304013 Ga0466967_0304013_756_1049 91
461 3300045976 Ga0466967_0374083 Ga0466967_0374083_400_687 91
462 3300045976 Ga0466967_1299720 Ga0466967_1299720_115_405 91
463 3300046454 Ga0495592_0252251 Ga0495592_0252251_747_1031 91
464 3300046454 Ga0495592_0296858 Ga0495592_0296858_282_578 91
465 3300046455 Ga0495603_0012499 Ga0495603_0012499_3194_3478 91
466 3300046455 Ga0495603_0287114 Ga0495603_0287114_73_369 91
467 3300046459 Ga0495629_0004222 Ga0495629_0004222_9515_9799 91
468 3300046459 Ga0495629_0029225 Ga0495629_0029225_1709_1987 91
469 3300046459 Ga0495629_0030557 Ga0495629_0030557_3045_3341 91
470 3300046461 Ga0495641_0009678 Ga0495641_0009678_20_304 91
471 3300046461 Ga0495641_0197520 Ga0495641_0197520_546_842 91
472 3300046462 Ga0495651_0029293 Ga0495651_0029293_1999_2295 91
473 3300046462 Ga0495651_0400254 Ga0495651_0400254_472_756 91
474 3300046463 Ga0495653_0035050 Ga0495653_0035050_3045_3341 91
475 3300046463 Ga0495653_0497819 Ga0495653_0497819_192_479 91
476 3300046472 Ga0495580_0035177 Ga0495580_0035177_1648_1932 91
477 3300046473 Ga0495582_0060469 Ga0495582_0060469_571_855 91
478 3300046475 Ga0495639_0042296 Ga0495639_0042296_980_1264 91
479 3300046476 Ga0495662_0027414 Ga0495662_0027414_1814_2110 91
480 3300046476 Ga0495662_0096283 Ga0495662_0096283_384_668 91
481 3300046477 Ga0495664_0030772 Ga0495664_0030772_1189_1473 91
482 3300046477 Ga0495664_0054637 Ga0495664_0054637_142_432 91
483 3300046499 Ga0495594_0018870 Ga0495594_0018870_886_1170 91
484 3300046511 Ga0495608_0054573 Ga0495608_0054573_269_565 91
485 3300046514 Ga0495618_0219548 Ga0495618_0219548_282_578 91
486 3300046514 Ga0495618_0309312 Ga0495618_0309312_222_515 91
487 3300046516 Ga0495628_0006081 Ga0495628_0006081_227_511 91
488 3300046516 Ga0495628_0055025 Ga0495628_0055025_295_591 91
489 3300046517 Ga0495630_0068032 Ga0495630_0068032_1527_1811 91
490 3300046517 Ga0495630_0071972 Ga0495630_0071972_2196_2492 91
491 3300046517 Ga0495630_0076460 Ga0495630_0076460_1741_2019 91
492 3300046517 Ga0495630_0469106 Ga0495630_0469106_203_490 91
493 3300046517 Ga0495630_1304177 Ga0495630_1304177_215_511 91
494 3300046526 Ga0495666_0018448 Ga0495666_0018448_1701_1985 91
495 3300046526 Ga0495666_0055478 Ga0495666_0055478_1363_1659 91
496 3300046529 Ga0495652_0071875 Ga0495652_0071875_1462_1746 91
497 3300046529 Ga0495652_0385050 Ga0495652_0385050_347_640 91
498 3300046529 Ga0495652_0405197 Ga0495652_0405197_97_393 91
499 3300046530 Ga0495654_0038516 Ga0495654_0038516_136_420 91
500 3300046531 Ga0495665_0003597 Ga0495665_0003597_550_834 91
501 3300046531 Ga0495665_0013245 Ga0495665_0013245_1693_1989 91
502 3300046531 Ga0495665_0221432 Ga0495665_0221432_683_961 91
503 3300046533 Ga0495640_0017469 Ga0495640_0017469_597_893 91
504 3300046533 Ga0495640_0035704 Ga0495640_0035704_1714_1998 91
505 3300046533 Ga0495640_0332618 Ga0495640_0332618_236_529 91
506 3300046535 Ga0495586_0048616 Ga0495586_0048616_1306_1596 91
507 3300046535 Ga0495586_0075382 Ga0495586_0075382_686_970 91
508 3300046535 Ga0495586_0312129 Ga0495586_0312129_148_441 91
509 3300046536 Ga0495587_0003443 Ga0495587_0003443_5902_6198 91
510 3300046536 Ga0495587_0062187 Ga0495587_0062187_188_472 91
511 3300046538 Ga0495609_0064473 Ga0495609_0064473_1210_1494 91
512 3300046538 Ga0495609_0409771 Ga0495609_0409771_80_370 91
513 3300046543 Ga0495645_0014290 Ga0495645_0014290_5326_5610 91
514 3300046543 Ga0495645_0086808 Ga0495645_0086808_802_1098 91
515 3300046543 Ga0495645_0362974 Ga0495645_0362974_153_446 91
516 3300046557 Ga0495622_0086097 Ga0495622_0086097_663_947 91
517 3300046559 Ga0495667_0070366 Ga0495667_0070366_1527_1811 91
518 3300046559 Ga0495667_0538953 Ga0495667_0538953_269_565 91
519 3300046642 Ga0495634_0005879 Ga0495634_0005879_7824_8108 91
520 3300046663 Ga0495635_0011012 Ga0495635_0011012_5901_6197 91
521 3300046663 Ga0495635_0077571 Ga0495635_0077571_1520_1804 91
522 3300046663 Ga0495635_0228522 Ga0495635_0228522_175_462 91
523 3300046674 Ga0495588_0021306 Ga0495588_0021306_404_688 91
524 3300046674 Ga0495588_0328147 Ga0495588_0328147_489_785 91
525 3300046675 Ga0495657_0041781 Ga0495657_0041781_1349_1645 91
526 3300046675 Ga0495657_0077614 Ga0495657_0077614_994_1278 91
527 3300046678 Ga0495599_0047758 Ga0495599_0047758_1652_1936 91
528 3300046679 Ga0495623_0012759 Ga0495623_0012759_4877_5173 91
529 3300046679 Ga0495623_0149018 Ga0495623_0149018_227_511 91
530 3300046680 Ga0495646_0038695 Ga0495646_0038695_1140_1424 91
531 3300046680 Ga0495646_0384343 Ga0495646_0384343_295_591 91
532 3300046681 Ga0495647_0005262 Ga0495647_0005262_1038_1322 91
533 3300046683 Ga0495658_0005793 Ga0495658_0005793_511_795 91
534 3300046689 Ga0495613_0017693 Ga0495613_0017693_3635_3919 91
535 3300046689 Ga0495613_0740839 Ga0495613_0740839_269_565 91
536 3300046690 Ga0495624_0109904 Ga0495624_0109904_1262_1552 91
537 3300046690 Ga0495624_0254591 Ga0495624_0254591_758_1042 91
538 3300046809 Ga0495600_0014591 Ga0495600_0014591_950_1246 91
539 3300046809 Ga0495600_0073987 Ga0495600_0073987_227_511 91
540 3300046810 Ga0495660_0466038 Ga0495660_0466038_105_389 91
541 3300047315 Ga0495581_0004893 Ga0495581_0004893_3195_3479 91
542 3300047315 Ga0495581_0031164 Ga0495581_0031164_1980_2276 91
543 3300047317 Ga0495604_0020620 Ga0495604_0020620_2439_2735 91
544 3300047317 Ga0495604_0064253 Ga0495604_0064253_994_1278 91
545 3300047317 Ga0495604_0495633 Ga0495604_0495633_482_769 91
546 3300047319 Ga0495674_0094452 Ga0495674_0094452_747_1031 91
547 3300047319 Ga0495674_0135270 Ga0495674_0135270_111_407 91
548 3300047319 Ga0495674_0443917 Ga0495674_0443917_549_836 91
549 3300047321 Ga0495676_0024236 Ga0495676_0024236_2616_2900 91
550 3300047322 Ga0495680_0070920 Ga0495680_0070920_244_540 91
551 3300047322 Ga0495680_0104622 Ga0495680_0104622_1595_1879 91
552 3300047444 Ga0495675_0029568 Ga0495675_0029568_1326_1622 91
553 3300047471 Ga0495684_0006411 Ga0495684_0006411_1268_1552 91
554 3300047471 Ga0495684_0099936 Ga0495684_0099936_1326_1622 91
555 3300047471 Ga0495684_0356971 Ga0495684_0356971_560_847 91
556 3300047673 Ga0495593_0003319 Ga0495593_0003319_8613_8897 91
557 3300047673 Ga0495593_0052222 Ga0495593_0052222_1092_1388 91
558 3300048088 Ga0495602_0024963 Ga0495602_0024963_110_406 91
559 3300048088 Ga0495602_0315327 Ga0495602_0315327_109_393 91
560 3300048089 Ga0495614_0013559 Ga0495614_0013559_610_894 91
561 3300048089 Ga0495614_0086727 Ga0495614_0086727_1023_1319 91
562 3300048904 Ga0496101_0123183 Ga0496101_0123183_1255_1539 91
563 3300048904 Ga0496101_0470043 Ga0496101_0470043_626_937 91
564 3300048904 Ga0496101_1448456 Ga0496101_1448456_30_329 91
565 3300048905 Ga0496102_0032510 Ga0496102_0032510_984_1268 91
566 3300048905 Ga0496102_0704893 Ga0496102_0704893_290_583 91
567 3300048906 Ga0496103_0114239 Ga0496103_0114239_917_1201 91
568 3300048906 Ga0496103_0448818 Ga0496103_0448818_254_553 91
569 3300048907 Ga0496104_0002018 Ga0496104_0002018_15442_15735 91
570 3300048907 Ga0496104_0189600 Ga0496104_0189600_1251_1535 91
571 3300048908 Ga0496105_0039800 Ga0496105_0039800_1682_1975 91
572 3300048908 Ga0496105_0182716 Ga0496105_0182716_1372_1656 91
573 3300048909 Ga0496106_0367768 Ga0496106_0367768_110_403 91
574 3300048910 Ga0496107_0715960 Ga0496107_0715960_262_540 91
575 3300048911 Ga0496108_0004105 Ga0496108_0004105_5698_5997 91
576 3300048911 Ga0496108_0546535 Ga0496108_0546535_384_695 91
577 3300048912 Ga0496109_0021226 Ga0496109_0021226_37_330 91
578 3300048912 Ga0496109_0853838 Ga0496109_0853838_170_481 91
579 3300048913 Ga0496110_0012736 Ga0496110_0012736_4337_4636 91
580 3300048914 Ga0496111_0089264 Ga0496111_0089264_969_1268 91
581 3300048915 Ga0496112_0421206 Ga0496112_0421206_219_530 91
582 3300048915 Ga0496112_1606780 Ga0496112_1606780_232_510 91
583 3300048916 Ga0496113_0078786 Ga0496113_0078786_476_769 91
584 3300048916 Ga0496113_0409731 Ga0496113_0409731_272_556 91
585 3300048918 Ga0496115_0215335 Ga0496115_0215335_929_1207 91
586 3300048918 Ga0496115_0418141 Ga0496115_0418141_776_1057 91
587 3300048920 Ga0496117_0004445 Ga0496117_0004445_5020_5304 91
588 3300048921 Ga0496118_0000116 Ga0496118_0000116_140428_140712 91
589 3300048922 Ga0496119_0037894 Ga0496119_0037894_735_1019 91
590 3300048924 Ga0496121_0161163 Ga0496121_0161163_343_627 91
591 3300048925 Ga0496122_0341832 Ga0496122_0341832_29_313 91
592 3300048927 Ga0496124_0000135 Ga0496124_0000135_966_1250 91
593 3300048929 Ga0496126_0243116 Ga0496126_0243116_295_579 91
594 3300048929 Ga0496126_0541537 Ga0496126_0541537_317_598 91
595 3300049127 Ga0501306_017897 Ga0501306_017897_343_633 91
596 3300049130 Ga0501310_018138 Ga0501310_018138_181_477 91
597 3300049527 Ga0501311_039132 Ga0501311_039132_198_500 91
598 3300049527 Ga0501311_097687 Ga0501311_097687_219_494 91
599 3300049536 Ga0501320_068869 Ga0501320_068869_65_376 91
600 3300049539 Ga0501323_027111 Ga0501323_027111_372_662 91
601 3300049541 Ga0501325_007622 Ga0501325_007622_183_497 91
602 3300049585 Ga0501069_0424064 Ga0501069_0424064_141_437 91
603 3300050511 nmdc:mga08y16_1932564_c1 nmdc:mga08y16_1932564_c1_162_461 91
604 3300050512 nmdc:mga0n895_156854_c1 nmdc:mga0n895_156854_c1_213_506 91
605 3300050514 nmdc:mga08x19_927337_c1 nmdc:mga08x19_927337_c1_275_559 91
606 3300053077 Ga0495601_0009796 Ga0495601_0009796_4913_5197 91
607 3300053077 Ga0495601_0803111 Ga0495601_0803111_265_552 91
608 3300053078 Ga0495612_0070859 Ga0495612_0070859_461_757 91
609 3300053078 Ga0495612_0082946 Ga0495612_0082946_466_750 91
610 3300053084 Ga0495595_0085328 Ga0495595_0085328_1027_1311 91
611 3300053084 Ga0495595_0100639 Ga0495595_0100639_879_1175 91
612 3300053085 Ga0495619_0012355 Ga0495619_0012355_1486_1782 91
613 3300053085 Ga0495619_0531700 Ga0495619_0531700_78_356 91
614 3300053090 Ga0500646_0075296 Ga0500646_0075296_343_621 91
615 3300059477 Ga0587084_019424 Ga0587084_019424_698_982 91
616 3300059490 Ga0587066_002515 Ga0587066_002515_1090_1368 91
617 3300059490 Ga0587066_077675 Ga0587066_077675_159_494 91
618 3300059490 Ga0587066_112134 Ga0587066_112134_289_573 91
619 3300059492 Ga0587073_0023027 Ga0587073_0023027_664_948 91
620 3300059492 Ga0587073_0032566 Ga0587073_0032566_141_419 91
621 3300059493 Ga0587077_001970 Ga0587077_001970_715_993 91
622 3300059493 Ga0587077_064514 Ga0587077_064514_135_419 91
623 3300059503 Ga0587080_001892 Ga0587080_001892_1432_1710 91
624 3300059503 Ga0587080_131587 Ga0587080_131587_148_426 91
625 3300059504 Ga0587082_003161 Ga0587082_003161_1268_1546 91
626 3300059504 Ga0587082_007851 Ga0587082_007851_510_803 91
627 3300059504 Ga0587082_094628 Ga0587082_094628_330_623 91
628 3300059505 Ga0587083_0002399 Ga0587083_0002399_1610_1888 91
629 3300059506 Ga0587085_149358 Ga0587085_149358_214_507 91
630 3300059509 Ga0587089_009457 Ga0587089_009457_209_487 91
631 3300059509 Ga0587089_111823 Ga0587089_111823_155_439 91
632 3300059510 Ga0587090_029027 Ga0587090_029027_496_780 91
633 3300059511 Ga0587091_002709 Ga0587091_002709_1331_1609 91
634 3300059513 Ga0587094_070829 Ga0587094_070829_106_381 91
635 3300059604 Ga0587098_000853 Ga0587098_000853_703_981 91
636 3300059605 Ga0587106_013260 Ga0587106_013260_700_978 91
637 3300059622 Ga0587099_000830 Ga0587099_000830_1371_1649 91
638 3300059622 Ga0587099_057804 Ga0587099_057804_75_359 91
639 3300059626 Ga0587115_012190 Ga0587115_012190_70_348 91
640 3300059627 Ga0587117_054093 Ga0587117_054093_40_324 91
641 3300059628 Ga0587122_001445 Ga0587122_001445_181_459 91
642 3300059630 Ga0587128_005236 Ga0587128_005236_1118_1396 91
643 3300059630 Ga0587128_043241 Ga0587128_043241_75_356 91
644 3300059639 Ga0587062_050706 Ga0587062_050706_24_299 91
645 3300059640 Ga0587067_002165 Ga0587067_002165_261_539 91
646 3300059640 Ga0587067_059736 Ga0587067_059736_33_317 91
647 3300059641 Ga0587068_004670 Ga0587068_004670_643_921 91
648 3300059642 Ga0587069_130416 Ga0587069_130416_207_500 91
649 3300059643 Ga0587072_006669 Ga0587072_006669_548_826 91
650 3300059643 Ga0587072_016702 Ga0587072_016702_259_543 91
651 3300059644 Ga0587075_018172 Ga0587075_018172_690_974 91
652 3300059645 Ga0587076_020339 Ga0587076_020339_141_419 91
653 3300059646 Ga0587078_034720 Ga0587078_034720_342_635 91
654 3300059650 Ga0587104_024499 Ga0587104_024499_46_330 91
655 3300059652 Ga0587107_001080 Ga0587107_001080_803_1081 91
656 3300059654 Ga0587110_030486 Ga0587110_030486_199_483 91
657 3300059655 Ga0587114_009012 Ga0587114_009012_362_646 91
658 3300059659 Ga0587120_020535 Ga0587120_020535_230_508 91
659 3300060344 Ga0587071_003160 Ga0587071_003160_633_911 91
660 3300061719 Ga0466962_0029867 Ga0466962_0029867_1275_1586 91
661 3300061719 Ga0466962_0167900 Ga0466962_0167900_336_650 91
662 iso_pu_bacteria 2857733635 2857734538 91
663 iso_pu_bacteria 2932431166 2932432198 91
664 iso_pu_bacteria 2966924647 2966926529 91

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00366

Ribosomal_S17

Ribosomal protein S17

32

99

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4v4b-assembly1.cif.gz_AQ structure of the ribosomal 80s-eef2-sordarin complex from yeast obtained by docking atomic models for rna and protein components into a 11.7 a cryo-em map. 0.8567 14 87
7pkq-assembly1.cif.gz_q small subunit of the chlamydomonas reinhardtii mitoribosome 0.832 16 91
7ane-assembly1.cif.gz_k leishmania major mitochondrial ribosome 0.8293 15 88
6z1p-assembly1.cif.gz_Bq structure of the mitochondrial ribosome from tetrahymena thermophila 0.8258 15 91
4v4b-assembly1.cif.gz_AQ structure of the ribosomal 80s-eef2-sordarin complex from yeast obtained by docking atomic models for rna and protein components into a 11.7 a cryo-em map. 0.8258 14 87
ID Description Score Start End Superfamily
af_Q8ID56_26_114_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8713 15 91 2.40.50.140
af_C6T0V9_1_79_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8322 14 91 2.40.50.140
af_Q4E4R7_93_168_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8215 16 90 2.40.50.140
af_Q9LHN1_1_100_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8163 14 91 2.40.50.140
5xyuQ00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8137 13 90 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A7E4S8B2-F1-model_v4 deleted 0.8552 13 91
AF-A0A496RHA2-F1-model_v4 Small ribosomal subunit protein uS17 0.8533 13 91 GO:0003735
GO:0006412
GO:0019843
GO:0022627
AF-A0A0F2J2M8-F1-model_v4 deleted 0.8516 13 90
AF-A0A535DPF9-F1-model_v4 Small ribosomal subunit protein uS17 0.8511 12 91 GO:0003735
GO:0006412
GO:0019843
GO:0022627
AF-A0A1G8TMN1-F1-model_v4 Small ribosomal subunit protein uS17 0.8463 12 91 GO:0003735
GO:0006412
GO:0019843
GO:0022627

Feature Viewer

pLDDT pTM Quality
81.43 0.61 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map