F473616
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 664 | 358 | 645 | 95 |
Family's Representative Sequence
| Representative Sequence | 3300009094|Ga0111539_10309079|Ga0111539_103090791 |
| Length | 105 |
| Sequence | VSEQPENTEVTAEVTTPADAPKARGERKTREGLVVSDKMDKTVVVEVEDRVKHPKYGKVIRRTKRYKAHDAENACGVGDRVVLMETRPLSATKRWRVSQILEKAK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2622736605 | Geodermatophilus ruber DSM 45317 | Isolate | Rhizosphere |
| 2 | 2734482000 | Kineosporia rhizophila JCM 9960 | Isolate | Unclassified |
| 3 | 2751185788 | Curtobacterium pusillum AA3 | Isolate | Unclassified |
| 4 | 2811994880 | Cellulomonas sp. SLBN-39 | Isolate | Unclassified |
| 5 | 2857733635 | Salinibacterium sp. R-73062 | Isolate | Unclassified |
| 6 | 2904430863 | Curtobacterium oceanosedimentum 1519 | Isolate | Rhizosphere |
| 7 | 2904501621 | Curtobacterium sp. 1909 | Isolate | Unclassified |
| 8 | 2908674828 | Curtobacterium sp. 1517 | Isolate | Rhizosphere |
| 9 | 2909074476 | Curtobacterium sp. 1310 | Isolate | Rhizosphere |
| 10 | 2919039151 | Curtobacterium sp. 260 | Isolate | Rhizosphere |
| 11 | 2919042368 | Curtobacterium sp. 320 | Isolate | Rhizosphere |
| 12 | 2919051321 | Sinomonas atrocyanea 1003 | Isolate | Rhizosphere |
| 13 | 2928104781 | Curtobacterium sp. 1544 | Isolate | Rhizosphere |
| 14 | 2928500415 | Curtobacterium oceanosedimentum 1257 | Isolate | Rhizosphere |
| 15 | 2932431166 | Cellulosimicrobium sp. 4261 | Isolate | Rhizosphere |
| 16 | 2966924647 | Frigoribacterium sp. 2355 | Isolate | Rhizosphere |
| 17 | 2984551494 | Curtobacterium sp. SORGH_AS776 | Isolate | Aerial Root |
| 18 | 2984576629 | Nocardioides zeae SORGH_AS913 | Isolate | Aerial Root |
| 19 | 2990256926 | Nocardioides zeae SORGH_AS885 | Isolate | Aerial Root |
| 20 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 21 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 22 | 3300003162 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 23 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 24 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 25 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 26 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 27 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 28 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 29 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 33 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 58 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 60 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 61 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 62 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 63 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 64 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 65 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 66 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 67 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 68 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 69 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 75 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 76 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 77 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 78 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 79 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 80 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 81 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 82 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 84 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 85 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 96 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 107 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 111 | 3300019190 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE3 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 112 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 113 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 114 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 115 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 116 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 117 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 118 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 119 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 120 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 121 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 122 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 123 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 124 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 125 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 126 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 161 | 3300030889 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 162 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 163 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 164 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 165 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 166 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 167 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 168 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 169 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 170 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 171 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 172 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 173 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 174 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 175 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 176 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 177 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 178 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 179 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 180 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 181 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 182 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 183 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 184 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 185 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 186 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 187 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 188 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 189 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 190 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 191 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 192 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 193 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 194 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 195 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 196 | 3300036457 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 197 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 198 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 199 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 200 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 201 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 202 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 203 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 204 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 205 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 206 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 207 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 208 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 209 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 210 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 211 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 212 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 213 | 3300041502 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT | Metatranscriptome | Unclassified |
| 214 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 215 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 216 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 217 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 218 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 219 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 220 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 221 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 222 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 223 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 224 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 225 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 226 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 227 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 228 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 279 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 280 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 281 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 282 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 283 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 284 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 285 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 286 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 287 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 288 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 289 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 290 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 291 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 292 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 293 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 294 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 295 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 296 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 297 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 298 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 299 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 300 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 301 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 302 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 303 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 304 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 305 | 3300049546 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 306 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 310 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 324 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 325 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 326 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 327 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 328 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 329 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 330 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 331 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 332 | 3300059509 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 333 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 334 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 335 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 336 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 337 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 338 | 3300059622 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 339 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 340 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 341 | 3300059627 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 342 | 3300059628 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 343 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 344 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 345 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 346 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 347 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 348 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 349 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 350 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 351 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 352 | 3300059650 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 69R_SD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 353 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 354 | 3300059654 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 355 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 356 | 3300059659 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 357 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 358 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 82.38 |
| Metatranscriptomes | 14.76 |
| Isolates | 2.86 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.45 |
| Bulb | 0 |
| Endosphere | 0.15 |
| Nodule | 0 |
| Rhizoplane | 4.52 |
| Rhizosphere | 88.86 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.02 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24737J22298_10028203 | 3300001990 | Bacteria | 1766 |
| 2 | JGI24738J21930_10015386 | 3300002075 | Bacteria | 1628 |
| 3 | Ga0006778J45830_1022691 | 3300003162 | Bacteria | 813 |
| 4 | Ga0007410J51695_1043507 | 3300003574 | Bacteria | 1241 |
| 5 | JGI25404J52841_10004898 | 3300003659 | Bacteria | 2747 |
| 6 | Ga0032354_1051217 | 3300003693 | Bacteria | 577 |
| 7 | Ga0058863_11721945 | 3300004799 | Bacteria | 770 |
| 8 | Ga0058863_11957706 | 3300004799 | Bacteria | 1014 |
| 9 | Ga0058860_11980957 | 3300004801 | Bacteria | 1101 |
| 10 | Ga0058860_12148150 | 3300004801 | Bacteria | 714 |
| 11 | Ga0058862_10000712 | 3300004803 | Bacteria | 896 |
| 12 | Ga0058862_12871663 | 3300004803 | Bacteria | 732 |
| 13 | Ga0070683_100189872 | 3300005329 | Bacteria | 1951 |
| 14 | Ga0070683_100523299 | 3300005329 | Bacteria | 1133 |
| 15 | Ga0070683_101823600 | 3300005329 | Bacteria | 585 |
| 16 | Ga0070683_101841809 | 3300005329 | Bacteria | 582 |
| 17 | Ga0070690_100732715 | 3300005330 | Bacteria | 762 |
| 18 | Ga0070682_100387842 | 3300005337 | Bacteria | 1053 |
| 19 | Ga0068868_100420703 | 3300005338 | Bacteria | 1157 |
| 20 | Ga0070661_100117520 | 3300005344 | Bacteria | 1989 |
| 21 | Ga0070661_100718822 | 3300005344 | Bacteria | 815 |
| 22 | Ga0070692_10075882 | 3300005345 | Bacteria | 1801 |
| 23 | Ga0070675_101670948 | 3300005354 | Bacteria | 587 |
| 24 | Ga0070671_100227176 | 3300005355 | Bacteria | 1584 |
| 25 | Ga0070659_100791008 | 3300005366 | Bacteria | 824 |
| 26 | Ga0070703_10001744 | 3300005406 | Bacteria | 6448 |
| 27 | Ga0070709_10276185 | 3300005434 | Bacteria | 1219 |
| 28 | Ga0070709_10479627 | 3300005434 | Bacteria | 941 |
| 29 | Ga0070709_11522147 | 3300005434 | Bacteria | 543 |
| 30 | Ga0070714_100001124 | 3300005435 | Bacteria | 19227 |
| 31 | Ga0070714_100003109 | 3300005435 | Bacteria | 12330 |
| 32 | Ga0070714_100913651 | 3300005435 | Bacteria | 852 |
| 33 | Ga0070714_101068137 | 3300005435 | Bacteria | 786 |
| 34 | Ga0070714_101420419 | 3300005435 | Bacteria | 678 |
| 35 | Ga0070714_102151578 | 3300005435 | Bacteria | 543 |
| 36 | Ga0070713_100001233 | 3300005436 | Bacteria | 16350 |
| 37 | Ga0070713_100227446 | 3300005436 | Bacteria | 1694 |
| 38 | Ga0070713_100917954 | 3300005436 | Bacteria | 842 |
| 39 | Ga0070713_101206283 | 3300005436 | Bacteria | 732 |
| 40 | Ga0070713_101534455 | 3300005436 | Bacteria | 646 |
| 41 | Ga0070713_102130459 | 3300005436 | Bacteria | 543 |
| 42 | Ga0070710_10000437 | 3300005437 | Bacteria | 19522 |
| 43 | Ga0070710_10314212 | 3300005437 | Bacteria | 1026 |
| 44 | Ga0070710_11005374 | 3300005437 | Bacteria | 608 |
| 45 | Ga0070711_100045638 | 3300005439 | Bacteria | 2982 |
| 46 | Ga0070711_100072955 | 3300005439 | Bacteria | 2423 |
| 47 | Ga0070711_100191052 | 3300005439 | Bacteria | 1574 |
| 48 | Ga0070711_101812715 | 3300005439 | Bacteria | 535 |
| 49 | Ga0070711_101833257 | 3300005439 | Bacteria | 532 |
| 50 | Ga0070708_100659845 | 3300005445 | Bacteria | 985 |
| 51 | Ga0070708_101187265 | 3300005445 | Bacteria | 714 |
| 52 | Ga0070708_101468702 | 3300005445 | Bacteria | 635 |
| 53 | Ga0070678_100500757 | 3300005456 | Bacteria | 1072 |
| 54 | Ga0070662_100036864 | 3300005457 | Bacteria | 3463 |
| 55 | Ga0070681_11804584 | 3300005458 | Bacteria | 539 |
| 56 | Ga0070706_100003720 | 3300005467 | Bacteria | 14916 |
| 57 | Ga0070706_100257139 | 3300005467 | Bacteria | 1630 |
| 58 | Ga0070706_100346334 | 3300005467 | Bacteria | 1385 |
| 59 | Ga0070707_100021481 | 3300005468 | Bacteria | 6102 |
| 60 | Ga0070707_100098495 | 3300005468 | Bacteria | 2832 |
| 61 | Ga0070707_100183589 | 3300005468 | Bacteria | 2039 |
| 62 | Ga0070707_100197595 | 3300005468 | Bacteria | 1961 |
| 63 | Ga0070707_100882677 | 3300005468 | Bacteria | 859 |
| 64 | Ga0070707_101198117 | 3300005468 | Bacteria | 725 |
| 65 | Ga0070707_101906745 | 3300005468 | Bacteria | 562 |
| 66 | Ga0070707_102013802 | 3300005468 | Bacteria | 545 |
| 67 | Ga0070698_100001882 | 3300005471 | Bacteria | 23378 |
| 68 | Ga0070698_100018293 | 3300005471 | Bacteria | 7379 |
| 69 | Ga0070698_100869854 | 3300005471 | Bacteria | 846 |
| 70 | Ga0070699_100418034 | 3300005518 | Bacteria | 1213 |
| 71 | Ga0070684_100362268 | 3300005535 | Bacteria | 1334 |
| 72 | Ga0070684_100948705 | 3300005535 | Bacteria | 807 |
| 73 | Ga0070697_100038833 | 3300005536 | Bacteria | 3847 |
| 74 | Ga0070697_101408534 | 3300005536 | Bacteria | 622 |
| 75 | Ga0070693_100581968 | 3300005547 | Bacteria | 806 |
| 76 | Ga0070665_100476653 | 3300005548 | Bacteria | 1259 |
| 77 | Ga0070664_100041377 | 3300005564 | Bacteria | 3888 |
| 78 | Ga0068857_100364734 | 3300005577 | Bacteria | 1339 |
| 79 | Ga0068857_101705902 | 3300005577 | Bacteria | 616 |
| 80 | Ga0070702_100373834 | 3300005615 | Bacteria | 1011 |
| 81 | Ga0070702_100785118 | 3300005615 | Bacteria | 735 |
| 82 | Ga0070702_100813434 | 3300005615 | Bacteria | 724 |
| 83 | Ga0068852_100729200 | 3300005616 | Bacteria | 1002 |
| 84 | Ga0068859_100670474 | 3300005617 | Bacteria | 1128 |
| 85 | Ga0068864_100089287 | 3300005618 | Bacteria | 2715 |
| 86 | Ga0068864_100100693 | 3300005618 | Bacteria | 2561 |
| 87 | Ga0068864_100467420 | 3300005618 | Bacteria | 1209 |
| 88 | Ga0068861_100064654 | 3300005719 | Bacteria | 2815 |
| 89 | Ga0068863_100366384 | 3300005841 | Bacteria | 1405 |
| 90 | Ga0068858_100129309 | 3300005842 | Bacteria | 2367 |
| 91 | Ga0068860_100644706 | 3300005843 | Bacteria | 1067 |
| 92 | Ga0068860_101483819 | 3300005843 | Bacteria | 700 |
| 93 | Ga0068862_101239261 | 3300005844 | Bacteria | 745 |
| 94 | Ga0081540_1000341 | 3300005983 | Bacteria | 47794 |
| 95 | Ga0081540_1022585 | 3300005983 | Bacteria | 3713 |
| 96 | Ga0081540_1047724 | 3300005983 | Bacteria | 2151 |
| 97 | Ga0081539_10104788 | 3300005985 | Bacteria | 1435 |
| 98 | Ga0070717_10010919 | 3300006028 | Bacteria | 6876 |
| 99 | Ga0070717_10135605 | 3300006028 | Bacteria | 2119 |
| 100 | Ga0070717_10214680 | 3300006028 | Bacteria | 1689 |
| 101 | Ga0070717_11273771 | 3300006028 | Bacteria | 668 |
| 102 | Ga0070715_10188857 | 3300006163 | Bacteria | 1039 |
| 103 | Ga0070715_10473647 | 3300006163 | Bacteria | 711 |
| 104 | Ga0070716_100000511 | 3300006173 | Bacteria | 16168 |
| 105 | Ga0070716_100084223 | 3300006173 | Bacteria | 1906 |
| 106 | Ga0070712_100001287 | 3300006175 | Bacteria | 15146 |
| 107 | Ga0070712_100014381 | 3300006175 | Bacteria | 5080 |
| 108 | Ga0070712_100600539 | 3300006175 | Bacteria | 931 |
| 109 | Ga0070712_101711548 | 3300006175 | Bacteria | 550 |
| 110 | Ga0070712_101805339 | 3300006175 | Bacteria | 535 |
| 111 | Ga0070712_102053952 | 3300006175 | Bacteria | 500 |
| 112 | Ga0097621_100042306 | 3300006237 | Bacteria | 3669 |
| 113 | Ga0097621_100351151 | 3300006237 | Bacteria | 1311 |
| 114 | Ga0068871_100308964 | 3300006358 | Bacteria | 1390 |
| 115 | Ga0075428_100099463 | 3300006844 | Bacteria | 3171 |
| 116 | Ga0075430_100047794 | 3300006846 | Bacteria | 3613 |
| 117 | Ga0075431_100006706 | 3300006847 | Bacteria | 11432 |
| 118 | Ga0075431_100598519 | 3300006847 | Bacteria | 1087 |
| 119 | Ga0075433_10271224 | 3300006852 | Bacteria | 1504 |
| 120 | Ga0075434_100016693 | 3300006871 | Bacteria | 7062 |
| 121 | Ga0075434_100126789 | 3300006871 | Bacteria | 2569 |
| 122 | Ga0075434_100725765 | 3300006871 | Bacteria | 1011 |
| 123 | Ga0075429_100005726 | 3300006880 | Bacteria | 10724 |
| 124 | Ga0075429_100015532 | 3300006880 | Bacteria | 6597 |
| 125 | Ga0075436_100227898 | 3300006914 | Bacteria | 1323 |
| 126 | Ga0075436_100270029 | 3300006914 | Bacteria | 1214 |
| 127 | Ga0097620_100670479 | 3300006931 | Bacteria | 1128 |
| 128 | Ga0075435_100081437 | 3300007076 | Bacteria | 2659 |
| 129 | Ga0075435_100281215 | 3300007076 | Bacteria | 1420 |
| 130 | Ga0075435_100560897 | 3300007076 | Bacteria | 989 |
| 131 | Ga0099795_10005676 | 3300007788 | Bacteria | 3343 |
| 132 | Ga0099795_10263560 | 3300007788 | Bacteria | 747 |
| 133 | Ga0111539_10309079 | 3300009094 | Bacteria | 1840 |
| 134 | Ga0105245_10028695 | 3300009098 | Bacteria | 4911 |
| 135 | Ga0105245_10516397 | 3300009098 | Bacteria | 1212 |
| 136 | Ga0105247_11596078 | 3300009101 | Bacteria | 536 |
| 137 | Ga0114129_10015903 | 3300009147 | Bacteria | 10703 |
| 138 | Ga0114129_10085359 | 3300009147 | Bacteria | 4380 |
| 139 | Ga0114129_11910986 | 3300009147 | Bacteria | 719 |
| 140 | Ga0105243_11313044 | 3300009148 | Bacteria | 741 |
| 141 | Ga0105241_12207243 | 3300009174 | Bacteria | 546 |
| 142 | Ga0105242_11856509 | 3300009176 | Bacteria | 642 |
| 143 | Ga0105237_10205919 | 3300009545 | Bacteria | 1968 |
| 144 | Ga0105237_11157419 | 3300009545 | Bacteria | 780 |
| 145 | Ga0105238_10389366 | 3300009551 | Bacteria | 1386 |
| 146 | Ga0105249_12884881 | 3300009553 | Bacteria | 552 |
| 147 | Ga0099796_10119283 | 3300010159 | Bacteria | 1012 |
| 148 | Ga0105239_10031478 | 3300010375 | Bacteria | 5834 |
| 149 | Ga0105239_12199722 | 3300010375 | Bacteria | 641 |
| 150 | Ga0105246_10941664 | 3300011119 | Bacteria | 778 |
| 151 | Ga0157370_10517815 | 3300013104 | Bacteria | 1095 |
| 152 | Ga0157369_10858116 | 3300013105 | Bacteria | 932 |
| 153 | Ga0157374_10030097 | 3300013296 | Bacteria | 4926 |
| 154 | Ga0157374_10393549 | 3300013296 | Bacteria | 1381 |
| 155 | Ga0157378_10437009 | 3300013297 | Bacteria | 1296 |
| 156 | Ga0163162_10157865 | 3300013306 | Bacteria | 2389 |
| 157 | Ga0157372_10217071 | 3300013307 | Bacteria | 2217 |
| 158 | Ga0157372_10439772 | 3300013307 | Bacteria | 1520 |
| 159 | Ga0157372_11393227 | 3300013307 | Bacteria | 808 |
| 160 | Ga0157372_11900388 | 3300013307 | Bacteria | 684 |
| 161 | Ga0157375_10289818 | 3300013308 | Bacteria | 1800 |
| 162 | Ga0163163_10297835 | 3300014325 | Bacteria | 1665 |
| 163 | Ga0163163_10321708 | 3300014325 | Bacteria | 1600 |
| 164 | Ga0163163_11847124 | 3300014325 | Bacteria | 664 |
| 165 | Ga0182008_10084220 | 3300014497 | Bacteria | 1566 |
| 166 | Ga0157377_11276132 | 3300014745 | Bacteria | 573 |
| 167 | Ga0157379_10011666 | 3300014968 | Bacteria | 7672 |
| 168 | Ga0157379_10420833 | 3300014968 | Bacteria | 1230 |
| 169 | Ga0157376_11099675 | 3300014969 | Bacteria | 821 |
| 170 | Ga0182005_1092653 | 3300015265 | Bacteria | 841 |
| 171 | Ga0184600_101748 | 3300019190 | Bacteria | 1242 |
| 172 | Ga0197907_10537378 | 3300020069 | Bacteria | 589 |
| 173 | Ga0197907_10950516 | 3300020069 | Bacteria | 705 |
| 174 | Ga0197907_11321259 | 3300020069 | Bacteria | 4435 |
| 175 | Ga0206356_11171823 | 3300020070 | Bacteria | 640 |
| 176 | Ga0206356_11612728 | 3300020070 | Bacteria | 668 |
| 177 | Ga0206349_1658620 | 3300020075 | Bacteria | 858 |
| 178 | Ga0206355_1179809 | 3300020076 | Bacteria | 669 |
| 179 | Ga0206355_1627926 | 3300020076 | Bacteria | 1319 |
| 180 | Ga0206351_10373923 | 3300020077 | Bacteria | 1324 |
| 181 | Ga0206352_11126397 | 3300020078 | Bacteria | 2897 |
| 182 | Ga0206350_10990969 | 3300020080 | Bacteria | 908 |
| 183 | Ga0206350_11613293 | 3300020080 | Bacteria | 1065 |
| 184 | Ga0206354_10110661 | 3300020081 | Bacteria | 1231 |
| 185 | Ga0206354_10368332 | 3300020081 | Bacteria | 1245 |
| 186 | Ga0206354_10926327 | 3300020081 | Bacteria | 1296 |
| 187 | Ga0206354_11310032 | 3300020081 | Bacteria | 1241 |
| 188 | Ga0206354_11496319 | 3300020081 | Bacteria | 765 |
| 189 | Ga0206353_10645923 | 3300020082 | Bacteria | 572 |
| 190 | Ga0206353_11155186 | 3300020082 | Bacteria | 505 |
| 191 | Ga0206353_11323745 | 3300020082 | Bacteria | 1146 |
| 192 | Ga0206353_11381381 | 3300020082 | Bacteria | 868 |
| 193 | Ga0206353_11847015 | 3300020082 | Bacteria | 2573 |
| 194 | Ga0206353_11898514 | 3300020082 | Bacteria | 1131 |
| 195 | Ga0213873_10149280 | 3300021358 | Bacteria | 703 |
| 196 | Ga0213876_10522052 | 3300021384 | Bacteria | 632 |
| 197 | Ga0213875_10010857 | 3300021388 | Bacteria | 4553 |
| 198 | Ga0213875_10106303 | 3300021388 | Bacteria | 1310 |
| 199 | Ga0213875_10243769 | 3300021388 | Bacteria | 847 |
| 200 | Ga0224712_10037453 | 3300022467 | Bacteria | 1805 |
| 201 | Ga0224712_10255346 | 3300022467 | Bacteria | 811 |
| 202 | Ga0224712_10338561 | 3300022467 | Bacteria | 709 |
| 203 | Ga0224572_1026985 | 3300024225 | Bacteria | 1100 |
| 204 | Ga0207692_10001130 | 3300025898 | Bacteria | 9809 |
| 205 | Ga0207692_10123800 | 3300025898 | Bacteria | 1451 |
| 206 | Ga0207692_10228046 | 3300025898 | Bacteria | 1107 |
| 207 | Ga0207692_11182624 | 3300025898 | Bacteria | 508 |
| 208 | Ga0207710_10273231 | 3300025900 | Bacteria | 849 |
| 209 | Ga0207688_10317498 | 3300025901 | Bacteria | 955 |
| 210 | Ga0207688_10565290 | 3300025901 | Bacteria | 715 |
| 211 | Ga0207699_10000260 | 3300025906 | Bacteria | 29008 |
| 212 | Ga0207699_10563416 | 3300025906 | Bacteria | 827 |
| 213 | Ga0207684_10016512 | 3300025910 | Bacteria | 6339 |
| 214 | Ga0207684_10027808 | 3300025910 | Bacteria | 4817 |
| 215 | Ga0207684_10333546 | 3300025910 | Bacteria | 1306 |
| 216 | Ga0207684_10469944 | 3300025910 | Bacteria | 1079 |
| 217 | Ga0207684_10886026 | 3300025910 | Bacteria | 751 |
| 218 | Ga0207684_11430348 | 3300025910 | Bacteria | 565 |
| 219 | Ga0207707_10388364 | 3300025912 | Bacteria | 1199 |
| 220 | Ga0207707_11040894 | 3300025912 | Bacteria | 670 |
| 221 | Ga0207671_10215586 | 3300025914 | Bacteria | 1503 |
| 222 | Ga0207671_11313469 | 3300025914 | Bacteria | 563 |
| 223 | Ga0207693_10004081 | 3300025915 | Bacteria | 12404 |
| 224 | Ga0207693_10024997 | 3300025915 | Bacteria | 4737 |
| 225 | Ga0207693_10178908 | 3300025915 | Bacteria | 1669 |
| 226 | Ga0207693_10765073 | 3300025915 | Bacteria | 746 |
| 227 | Ga0207663_10000595 | 3300025916 | Bacteria | 15977 |
| 228 | Ga0207663_10212114 | 3300025916 | Bacteria | 1404 |
| 229 | Ga0207663_11522477 | 3300025916 | Bacteria | 539 |
| 230 | Ga0207657_10324694 | 3300025919 | Bacteria | 1216 |
| 231 | Ga0207649_11492506 | 3300025920 | Bacteria | 535 |
| 232 | Ga0207646_10019054 | 3300025922 | Bacteria | 6386 |
| 233 | Ga0207646_10079404 | 3300025922 | Bacteria | 2933 |
| 234 | Ga0207646_10091536 | 3300025922 | Bacteria | 2722 |
| 235 | Ga0207646_10188791 | 3300025922 | Bacteria | 1861 |
| 236 | Ga0207694_10909492 | 3300025924 | Bacteria | 744 |
| 237 | Ga0207659_10835760 | 3300025926 | Bacteria | 791 |
| 238 | Ga0207687_10050704 | 3300025927 | Bacteria | 2890 |
| 239 | Ga0207700_10000091 | 3300025928 | Bacteria | 55792 |
| 240 | Ga0207700_10053796 | 3300025928 | Bacteria | 3018 |
| 241 | Ga0207700_10104512 | 3300025928 | Bacteria | 2266 |
| 242 | Ga0207700_10600350 | 3300025928 | Bacteria | 979 |
| 243 | Ga0207700_11699185 | 3300025928 | Bacteria | 557 |
| 244 | Ga0207664_10001032 | 3300025929 | Bacteria | 18646 |
| 245 | Ga0207664_10001323 | 3300025929 | Bacteria | 16307 |
| 246 | Ga0207664_10016921 | 3300025929 | Bacteria | 5332 |
| 247 | Ga0207664_10093952 | 3300025929 | Bacteria | 2464 |
| 248 | Ga0207664_10409685 | 3300025929 | Bacteria | 1206 |
| 249 | Ga0207664_10790899 | 3300025929 | Bacteria | 853 |
| 250 | Ga0207664_10871334 | 3300025929 | Bacteria | 809 |
| 251 | Ga0207644_11682359 | 3300025931 | Bacteria | 532 |
| 252 | Ga0207706_10776718 | 3300025933 | Bacteria | 815 |
| 253 | Ga0207709_10902866 | 3300025935 | Bacteria | 718 |
| 254 | Ga0207665_10000821 | 3300025939 | Bacteria | 21034 |
| 255 | Ga0207665_10012079 | 3300025939 | Bacteria | 5668 |
| 256 | Ga0207665_10346687 | 3300025939 | Bacteria | 1120 |
| 257 | Ga0207711_10216871 | 3300025941 | Bacteria | 1749 |
| 258 | Ga0207661_10689520 | 3300025944 | Bacteria | 939 |
| 259 | Ga0207661_11163908 | 3300025944 | Bacteria | 710 |
| 260 | Ga0207677_10102410 | 3300026023 | Bacteria | 2111 |
| 261 | Ga0207703_10089913 | 3300026035 | Bacteria | 2579 |
| 262 | Ga0207703_10317468 | 3300026035 | Bacteria | 1426 |
| 263 | Ga0207708_10254560 | 3300026075 | Bacteria | 1416 |
| 264 | Ga0207708_10804487 | 3300026075 | Bacteria | 809 |
| 265 | Ga0207702_10958647 | 3300026078 | Bacteria | 848 |
| 266 | Ga0207641_10337316 | 3300026088 | Bacteria | 1433 |
| 267 | Ga0207676_11547644 | 3300026095 | Bacteria | 660 |
| 268 | Ga0207674_10014845 | 3300026116 | Bacteria | 8590 |
| 269 | Ga0207674_10282848 | 3300026116 | Bacteria | 1607 |
| 270 | Ga0207675_100010883 | 3300026118 | Bacteria | 8521 |
| 271 | Ga0207698_11021238 | 3300026142 | Bacteria | 838 |
| 272 | Ga0209179_1146784 | 3300027512 | Bacteria | 527 |
| 273 | Ga0268266_10057547 | 3300028379 | Bacteria | 3346 |
| 274 | Ga0265762_1005987 | 3300030760 | Bacteria | 2179 |
| 275 | Ga0265761_108369 | 3300030889 | Bacteria | 579 |
| 276 | Ga0265760_10128304 | 3300031090 | Bacteria | 818 |
| 277 | Ga0307406_10162975 | 3300031901 | Bacteria | 1605 |
| 278 | Ga0307409_102160686 | 3300031995 | Bacteria | 586 |
| 279 | Ga0307416_102032414 | 3300032002 | Bacteria | 677 |
| 280 | Ga0307415_100681042 | 3300032126 | Bacteria | 925 |
| 281 | Ga0316212_1019878 | 3300033547 | Bacteria | 943 |
| 282 | Ga0373930_0130636 | 3300034816 | Bacteria | 618 |
| 283 | Ga0373950_0062232 | 3300034818 | Bacteria | 751 |
| 284 | Ga0373958_0071457 | 3300034819 | Bacteria | 771 |
| 285 | Ga0373938_0113643 | 3300034957 | Bacteria | 692 |
| 286 | Ga0373926_0001795 | 3300035083 | Bacteria | 6662 |
| 287 | Ga0373926_0398212 | 3300035083 | Bacteria | 543 |
| 288 | Ga0373934_0030274 | 3300035086 | Bacteria | 2116 |
| 289 | Ga0373934_0508346 | 3300035086 | Bacteria | 507 |
| 290 | Ga0373940_0263542 | 3300035088 | Bacteria | 584 |
| 291 | Ga0373944_0005972 | 3300035089 | Bacteria | 3222 |
| 292 | Ga0373949_0090156 | 3300035090 | Bacteria | 828 |
| 293 | Ga0373923_0012347 | 3300035111 | Bacteria | 3155 |
| 294 | Ga0373923_0029180 | 3300035111 | Bacteria | 2210 |
| 295 | Ga0373932_0221165 | 3300035112 | Bacteria | 680 |
| 296 | Ga0373936_0090925 | 3300035113 | Bacteria | 1279 |
| 297 | Ga0373936_0468932 | 3300035113 | Bacteria | 583 |
| 298 | Ga0373939_0234561 | 3300035114 | Bacteria | 708 |
| 299 | Ga0373945_0006856 | 3300035116 | Bacteria | 3681 |
| 300 | Ga0373945_0071172 | 3300035116 | Bacteria | 1316 |
| 301 | Ga0373945_0129528 | 3300035116 | Bacteria | 1010 |
| 302 | Ga0373953_0010766 | 3300035117 | Bacteria | 3192 |
| 303 | Ga0373954_0021194 | 3300035118 | Bacteria | 2941 |
| 304 | Ga0373954_0032674 | 3300035118 | Bacteria | 2406 |
| 305 | Ga0373954_0089960 | 3300035118 | Bacteria | 1474 |
| 306 | Ga0373954_0258067 | 3300035118 | Bacteria | 858 |
| 307 | Ga0373954_0294384 | 3300035118 | Bacteria | 800 |
| 308 | Ga0373956_0064292 | 3300035119 | Bacteria | 1665 |
| 309 | Ga0373956_0091360 | 3300035119 | Bacteria | 1404 |
| 310 | Ga0373957_0001041 | 3300035120 | Bacteria | 7310 |
| 311 | Ga0373957_0007693 | 3300035120 | Bacteria | 3457 |
| 312 | Ga0373960_0179742 | 3300035121 | Bacteria | 738 |
| 313 | Ga0373943_0011419 | 3300035170 | Bacteria | 3996 |
| 314 | Ga0373943_0583776 | 3300035170 | Bacteria | 657 |
| 315 | Ga0373955_0002432 | 3300035172 | Bacteria | 8128 |
| 316 | Ga0373955_0028721 | 3300035172 | Bacteria | 2886 |
| 317 | Ga0373924_0028077 | 3300035410 | Bacteria | 2240 |
| 318 | Ga0373931_0018524 | 3300035691 | Bacteria | 3464 |
| 319 | Ga0373935_0089335 | 3300035692 | Bacteria | 2014 |
| 320 | Ga0373935_0090005 | 3300035692 | Bacteria | 2007 |
| 321 | Ga0373927_0052651 | 3300035695 | Bacteria | 2632 |
| 322 | Ga0373927_0588458 | 3300035695 | Bacteria | 735 |
| 323 | Ga0373933_0126906 | 3300035724 | Bacteria | 1601 |
| 324 | Ga0373933_0498813 | 3300035724 | Bacteria | 797 |
| 325 | Ga0373947_0036657 | 3300035725 | Bacteria | 2908 |
| 326 | Ga0373947_0175004 | 3300035725 | Bacteria | 1394 |
| 327 | Ga0373947_0259543 | 3300035725 | Bacteria | 1151 |
| 328 | Ga0373937_0145982 | 3300036401 | Bacteria | 2214 |
| 329 | Ga0373937_0283190 | 3300036401 | Bacteria | 1565 |
| 330 | Ga0373937_0762235 | 3300036401 | Bacteria | 915 |
| 331 | Ga0373937_2055101 | 3300036401 | Bacteria | 517 |
| 332 | Ga0265778_014641 | 3300036457 | Bacteria | 928 |
| 333 | Ga0373925_0146321 | 3300037068 | Bacteria | 1852 |
| 334 | Ga0373925_1072513 | 3300037068 | Bacteria | 663 |
| 335 | Ga0395899_0320952 | 3300037312 | Bacteria | 1043 |
| 336 | Ga0395899_0724377 | 3300037312 | Bacteria | 622 |
| 337 | Ga0395900_0021670 | 3300037418 | Bacteria | 6569 |
| 338 | Ga0395900_0123671 | 3300037418 | Bacteria | 2653 |
| 339 | Ga0395900_0367318 | 3300037418 | Bacteria | 1409 |
| 340 | Ga0395900_0853169 | 3300037418 | Bacteria | 836 |
| 341 | Ga0395900_1155716 | 3300037418 | Bacteria | 690 |
| 342 | Ga0395898_0072810 | 3300037466 | Bacteria | 3319 |
| 343 | Ga0395898_1401769 | 3300037466 | Bacteria | 626 |
| 344 | Ga0436364_0435690 | 3300037853 | Bacteria | 7681 |
| 345 | Ga0436364_0572882 | 3300037853 | Bacteria | 1194 |
| 346 | Ga0436364_0697983 | 3300037853 | Bacteria | 1996 |
| 347 | Ga0436364_1139829 | 3300037853 | Bacteria | 2315 |
| 348 | Ga0436364_1354648 | 3300037853 | Bacteria | 115417 |
| 349 | Ga0436364_1385979 | 3300037853 | Bacteria | 1405 |
| 350 | Ga0395901_0011417 | 3300038443 | Bacteria | 8999 |
| 351 | Ga0395901_0013538 | 3300038443 | Bacteria | 8294 |
| 352 | Ga0395901_0042762 | 3300038443 | Bacteria | 4699 |
| 353 | Ga0436365_0140149 | 3300039437 | Bacteria | 747 |
| 354 | Ga0436365_0323587 | 3300039437 | Bacteria | 1078 |
| 355 | Ga0436365_0480233 | 3300039437 | Bacteria | 1127 |
| 356 | Ga0436365_1206898 | 3300039437 | Bacteria | 532 |
| 357 | Ga0436360_0896384 | 3300039438 | Bacteria | 683 |
| 358 | Ga0436360_1358491 | 3300039438 | Bacteria | 1691 |
| 359 | Ga0436363_0387806 | 3300039450 | Bacteria | 591 |
| 360 | Ga0436363_0420441 | 3300039450 | Bacteria | 942 |
| 361 | Ga0436363_0608057 | 3300039450 | Bacteria | 1214 |
| 362 | Ga0436363_0984261 | 3300039450 | Bacteria | 1097 |
| 363 | Ga0436363_1244160 | 3300039450 | Bacteria | 1912 |
| 364 | Ga0436362_0080480 | 3300039453 | Bacteria | 1500 |
| 365 | Ga0436362_0108632 | 3300039453 | Bacteria | 717 |
| 366 | Ga0451795_0116542 | 3300041456 | Bacteria | 539 |
| 367 | Ga0451806_416377 | 3300041462 | Bacteria | 687 |
| 368 | Ga0451807_0540349 | 3300041486 | Bacteria | 592 |
| 369 | Ga0451833_0714288 | 3300041491 | Bacteria | 2127 |
| 370 | Ga0451835_0428021 | 3300041492 | Bacteria | 720 |
| 371 | Ga0451839_0404311 | 3300041496 | Bacteria | 1350 |
| 372 | Ga0451846_22992 | 3300041502 | Bacteria | 584 |
| 373 | Ga0451851_0106851 | 3300041507 | Bacteria | 744 |
| 374 | Ga0466969_0133478 | 3300044656 | Bacteria | 1150 |
| 375 | Ga0466966_0333615 | 3300044684 | Bacteria | 911 |
| 376 | Ga0466961_0018685 | 3300044693 | Bacteria | 4460 |
| 377 | Ga0466963_0032630 | 3300044694 | Bacteria | 3374 |
| 378 | Ga0466963_0056835 | 3300044694 | Bacteria | 2604 |
| 379 | Ga0466963_0144726 | 3300044694 | Bacteria | 1648 |
| 380 | Ga0466964_0401321 | 3300044706 | Bacteria | 716 |
| 381 | Ga0466964_0456857 | 3300044706 | Bacteria | 678 |
| 382 | Ga0466971_0168729 | 3300044719 | Bacteria | 1026 |
| 383 | Ga0466968_0174414 | 3300044735 | Bacteria | 997 |
| 384 | Ga0466968_0399061 | 3300044735 | Bacteria | 674 |
| 385 | Ga0466970_0019956 | 3300044765 | Bacteria | 3478 |
| 386 | Ga0466970_0938761 | 3300044765 | Bacteria | 509 |
| 387 | Ga0466957_0342862 | 3300044842 | Bacteria | 1012 |
| 388 | Ga0466957_0480171 | 3300044842 | Bacteria | 859 |
| 389 | Ga0466957_0687294 | 3300044842 | Bacteria | 721 |
| 390 | Ga0466957_1376465 | 3300044842 | Bacteria | 513 |
| 391 | Ga0466960_0783069 | 3300044901 | Bacteria | 576 |
| 392 | Ga0466960_0930207 | 3300044901 | Bacteria | 531 |
| 393 | Ga0466959_0103930 | 3300045049 | Bacteria | 2032 |
| 394 | Ga0466959_0500242 | 3300045049 | Bacteria | 821 |
| 395 | Ga0466958_0017088 | 3300045836 | Bacteria | 4188 |
| 396 | Ga0466958_0067645 | 3300045836 | Bacteria | 2182 |
| 397 | Ga0466958_0129643 | 3300045836 | Bacteria | 1583 |
| 398 | Ga0466958_0572110 | 3300045836 | Bacteria | 734 |
| 399 | Ga0466958_0951943 | 3300045836 | Bacteria | 560 |
| 400 | Ga0466967_0304013 | 3300045976 | Bacteria | 1535 |
| 401 | Ga0466967_0374083 | 3300045976 | Bacteria | 1382 |
| 402 | Ga0466967_1299720 | 3300045976 | Bacteria | 724 |
| 403 | Ga0466967_1781871 | 3300045976 | Bacteria | 613 |
| 404 | Ga0466967_2062256 | 3300045976 | Bacteria | 567 |
| 405 | Ga0466967_2189473 | 3300045976 | Bacteria | 549 |
| 406 | Ga0466967_2498688 | 3300045976 | Bacteria | 511 |
| 407 | Ga0495592_0252251 | 3300046454 | Bacteria | 1165 |
| 408 | Ga0495592_0296858 | 3300046454 | Bacteria | 1051 |
| 409 | Ga0495603_0012499 | 3300046455 | Bacteria | 5139 |
| 410 | Ga0495603_0287114 | 3300046455 | Bacteria | 945 |
| 411 | Ga0495629_0004222 | 3300046459 | Bacteria | 10778 |
| 412 | Ga0495629_0029225 | 3300046459 | Bacteria | 3911 |
| 413 | Ga0495629_0030557 | 3300046459 | Bacteria | 3818 |
| 414 | Ga0495629_0979595 | 3300046459 | Bacteria | 551 |
| 415 | Ga0495641_0009678 | 3300046461 | Bacteria | 5697 |
| 416 | Ga0495641_0197520 | 3300046461 | Bacteria | 901 |
| 417 | Ga0495641_0224277 | 3300046461 | Bacteria | 843 |
| 418 | Ga0495651_0029293 | 3300046462 | Bacteria | 4292 |
| 419 | Ga0495651_0154494 | 3300046462 | Bacteria | 1650 |
| 420 | Ga0495651_0400254 | 3300046462 | Bacteria | 896 |
| 421 | Ga0495653_0035050 | 3300046463 | Bacteria | 3962 |
| 422 | Ga0495653_0485801 | 3300046463 | Bacteria | 772 |
| 423 | Ga0495653_0497819 | 3300046463 | Bacteria | 760 |
| 424 | Ga0495580_0035177 | 3300046472 | Bacteria | 3602 |
| 425 | Ga0495582_0060469 | 3300046473 | Bacteria | 2090 |
| 426 | Ga0495639_0042296 | 3300046475 | Bacteria | 2054 |
| 427 | Ga0495662_0027414 | 3300046476 | Bacteria | 2752 |
| 428 | Ga0495662_0096283 | 3300046476 | Bacteria | 1446 |
| 429 | Ga0495664_0030772 | 3300046477 | Bacteria | 3144 |
| 430 | Ga0495664_0054637 | 3300046477 | Bacteria | 2374 |
| 431 | Ga0495594_0018870 | 3300046499 | Bacteria | 3659 |
| 432 | Ga0495594_0073965 | 3300046499 | Bacteria | 1898 |
| 433 | Ga0495608_0054573 | 3300046511 | Bacteria | 2641 |
| 434 | Ga0495618_0219548 | 3300046514 | Bacteria | 1199 |
| 435 | Ga0495618_0309312 | 3300046514 | Bacteria | 980 |
| 436 | Ga0495628_0006081 | 3300046516 | Bacteria | 10554 |
| 437 | Ga0495628_0055025 | 3300046516 | Bacteria | 3134 |
| 438 | Ga0495628_0684585 | 3300046516 | Bacteria | 725 |
| 439 | Ga0495630_0068032 | 3300046517 | Bacteria | 2677 |
| 440 | Ga0495630_0071972 | 3300046517 | Bacteria | 2602 |
| 441 | Ga0495630_0076460 | 3300046517 | Bacteria | 2523 |
| 442 | Ga0495630_0469106 | 3300046517 | Bacteria | 965 |
| 443 | Ga0495630_1055863 | 3300046517 | Bacteria | 616 |
| 444 | Ga0495630_1304177 | 3300046517 | Bacteria | 547 |
| 445 | Ga0495666_0018448 | 3300046526 | Bacteria | 3471 |
| 446 | Ga0495666_0055478 | 3300046526 | Bacteria | 1898 |
| 447 | Ga0495652_0071875 | 3300046529 | Bacteria | 2885 |
| 448 | Ga0495652_0385050 | 3300046529 | Bacteria | 996 |
| 449 | Ga0495652_0405197 | 3300046529 | Bacteria | 964 |
| 450 | Ga0495654_0038516 | 3300046530 | Bacteria | 2390 |
| 451 | Ga0495665_0003597 | 3300046531 | Bacteria | 8412 |
| 452 | Ga0495665_0013245 | 3300046531 | Bacteria | 4460 |
| 453 | Ga0495665_0221432 | 3300046531 | Bacteria | 978 |
| 454 | Ga0495640_0017469 | 3300046533 | Bacteria | 5347 |
| 455 | Ga0495640_0035704 | 3300046533 | Bacteria | 3517 |
| 456 | Ga0495640_0332618 | 3300046533 | Bacteria | 939 |
| 457 | Ga0495586_0048616 | 3300046535 | Bacteria | 2292 |
| 458 | Ga0495586_0075382 | 3300046535 | Bacteria | 1846 |
| 459 | Ga0495586_0312129 | 3300046535 | Bacteria | 901 |
| 460 | Ga0495587_0003443 | 3300046536 | Bacteria | 10553 |
| 461 | Ga0495587_0062187 | 3300046536 | Bacteria | 2186 |
| 462 | Ga0495587_0218056 | 3300046536 | Bacteria | 1076 |
| 463 | Ga0495609_0064473 | 3300046538 | Bacteria | 1616 |
| 464 | Ga0495609_0409771 | 3300046538 | Bacteria | 542 |
| 465 | Ga0495645_0014290 | 3300046543 | Bacteria | 5629 |
| 466 | Ga0495645_0086808 | 3300046543 | Bacteria | 2238 |
| 467 | Ga0495645_0362974 | 3300046543 | Bacteria | 930 |
| 468 | Ga0495622_0086097 | 3300046557 | Bacteria | 1445 |
| 469 | Ga0495667_0070366 | 3300046559 | Bacteria | 2282 |
| 470 | Ga0495667_0104561 | 3300046559 | Bacteria | 1830 |
| 471 | Ga0495667_0538953 | 3300046559 | Bacteria | 729 |
| 472 | Ga0495634_0005879 | 3300046642 | Bacteria | 9375 |
| 473 | Ga0495634_0237069 | 3300046642 | Bacteria | 1120 |
| 474 | Ga0495635_0011012 | 3300046663 | Bacteria | 6338 |
| 475 | Ga0495635_0077571 | 3300046663 | Bacteria | 2275 |
| 476 | Ga0495635_0228522 | 3300046663 | Bacteria | 1257 |
| 477 | Ga0495635_0387390 | 3300046663 | Bacteria | 930 |
| 478 | Ga0495588_0021306 | 3300046674 | Bacteria | 3193 |
| 479 | Ga0495588_0328147 | 3300046674 | Bacteria | 805 |
| 480 | Ga0495657_0041781 | 3300046675 | Bacteria | 3135 |
| 481 | Ga0495657_0077614 | 3300046675 | Bacteria | 2154 |
| 482 | Ga0495657_0093281 | 3300046675 | Bacteria | 1927 |
| 483 | Ga0495599_0047758 | 3300046678 | Bacteria | 2682 |
| 484 | Ga0495623_0012759 | 3300046679 | Bacteria | 5440 |
| 485 | Ga0495623_0094847 | 3300046679 | Bacteria | 1824 |
| 486 | Ga0495623_0149018 | 3300046679 | Bacteria | 1384 |
| 487 | Ga0495646_0038695 | 3300046680 | Bacteria | 2943 |
| 488 | Ga0495646_0384343 | 3300046680 | Bacteria | 731 |
| 489 | Ga0495647_0005262 | 3300046681 | Bacteria | 4235 |
| 490 | Ga0495658_0005793 | 3300046683 | Bacteria | 6064 |
| 491 | Ga0495613_0017693 | 3300046689 | Bacteria | 5310 |
| 492 | Ga0495613_0740839 | 3300046689 | Bacteria | 644 |
| 493 | Ga0495624_0109904 | 3300046690 | Bacteria | 1695 |
| 494 | Ga0495624_0254591 | 3300046690 | Bacteria | 1061 |
| 495 | Ga0495624_0377485 | 3300046690 | Bacteria | 852 |
| 496 | Ga0495600_0014591 | 3300046809 | Bacteria | 4952 |
| 497 | Ga0495600_0073987 | 3300046809 | Bacteria | 2224 |
| 498 | Ga0495600_0314608 | 3300046809 | Bacteria | 985 |
| 499 | Ga0495660_0466038 | 3300046810 | Bacteria | 544 |
| 500 | Ga0495581_0004893 | 3300047315 | Bacteria | 7747 |
| 501 | Ga0495581_0031164 | 3300047315 | Bacteria | 3089 |
| 502 | Ga0495604_0020620 | 3300047317 | Bacteria | 5263 |
| 503 | Ga0495604_0064253 | 3300047317 | Bacteria | 2797 |
| 504 | Ga0495604_0495633 | 3300047317 | Bacteria | 793 |
| 505 | Ga0495674_0094452 | 3300047319 | Bacteria | 2550 |
| 506 | Ga0495674_0135270 | 3300047319 | Bacteria | 2074 |
| 507 | Ga0495674_0443917 | 3300047319 | Bacteria | 1043 |
| 508 | Ga0495676_0024236 | 3300047321 | Bacteria | 5256 |
| 509 | Ga0495680_0070920 | 3300047322 | Bacteria | 2654 |
| 510 | Ga0495680_0104622 | 3300047322 | Bacteria | 2105 |
| 511 | Ga0495680_1088183 | 3300047322 | Bacteria | 505 |
| 512 | Ga0495675_0029568 | 3300047444 | Bacteria | 3495 |
| 513 | Ga0495684_0006411 | 3300047471 | Bacteria | 9130 |
| 514 | Ga0495684_0099936 | 3300047471 | Bacteria | 2193 |
| 515 | Ga0495684_0356971 | 3300047471 | Bacteria | 1036 |
| 516 | Ga0495684_0435140 | 3300047471 | Bacteria | 914 |
| 517 | Ga0495593_0003319 | 3300047673 | Bacteria | 9645 |
| 518 | Ga0495593_0052222 | 3300047673 | Bacteria | 2161 |
| 519 | Ga0495602_0024963 | 3300048088 | Bacteria | 5791 |
| 520 | Ga0495602_0315327 | 3300048088 | Bacteria | 1139 |
| 521 | Ga0495614_0013559 | 3300048089 | Bacteria | 3573 |
| 522 | Ga0495614_0086727 | 3300048089 | Bacteria | 1359 |
| 523 | Ga0496101_0123183 | 3300048904 | Bacteria | 1962 |
| 524 | Ga0496101_0470043 | 3300048904 | Bacteria | 993 |
| 525 | Ga0496101_1448456 | 3300048904 | Bacteria | 535 |
| 526 | Ga0496102_0032510 | 3300048905 | Bacteria | 4686 |
| 527 | Ga0496102_0704893 | 3300048905 | Bacteria | 932 |
| 528 | Ga0496103_0114239 | 3300048906 | Bacteria | 1716 |
| 529 | Ga0496103_0448818 | 3300048906 | Bacteria | 827 |
| 530 | Ga0496104_0002018 | 3300048907 | Bacteria | 17625 |
| 531 | Ga0496104_0189600 | 3300048907 | Bacteria | 1967 |
| 532 | Ga0496104_1499915 | 3300048907 | Bacteria | 577 |
| 533 | Ga0496105_0039800 | 3300048908 | Bacteria | 3875 |
| 534 | Ga0496105_0182716 | 3300048908 | Bacteria | 1717 |
| 535 | Ga0496105_0639514 | 3300048908 | Bacteria | 822 |
| 536 | Ga0496106_0367768 | 3300048909 | Bacteria | 1155 |
| 537 | Ga0496107_0715960 | 3300048910 | Bacteria | 736 |
| 538 | Ga0496108_0004105 | 3300048911 | Bacteria | 11697 |
| 539 | Ga0496108_0546535 | 3300048911 | Bacteria | 1011 |
| 540 | Ga0496109_0021226 | 3300048912 | Bacteria | 5741 |
| 541 | Ga0496109_0853838 | 3300048912 | Bacteria | 848 |
| 542 | Ga0496110_0012736 | 3300048913 | Bacteria | 6924 |
| 543 | Ga0496111_0089264 | 3300048914 | Bacteria | 2257 |
| 544 | Ga0496112_0421206 | 3300048915 | Bacteria | 1274 |
| 545 | Ga0496112_1606780 | 3300048915 | Bacteria | 563 |
| 546 | Ga0496113_0078786 | 3300048916 | Bacteria | 2521 |
| 547 | Ga0496113_0409731 | 3300048916 | Bacteria | 1089 |
| 548 | Ga0496115_0215335 | 3300048918 | Bacteria | 1586 |
| 549 | Ga0496115_0418141 | 3300048918 | Bacteria | 1086 |
| 550 | Ga0496117_0004445 | 3300048920 | Bacteria | 15459 |
| 551 | Ga0496118_0000116 | 3300048921 | Bacteria | 145054 |
| 552 | Ga0496119_0037894 | 3300048922 | Bacteria | 3123 |
| 553 | Ga0496121_0161163 | 3300048924 | Bacteria | 1640 |
| 554 | Ga0496122_0341832 | 3300048925 | Bacteria | 785 |
| 555 | Ga0496124_0000135 | 3300048927 | Bacteria | 152458 |
| 556 | Ga0496126_0243116 | 3300048929 | Bacteria | 1503 |
| 557 | Ga0496126_0541537 | 3300048929 | Bacteria | 925 |
| 558 | Ga0501306_017897 | 3300049127 | Bacteria | 965 |
| 559 | Ga0501310_018138 | 3300049130 | Bacteria | 857 |
| 560 | Ga0501311_022166 | 3300049527 | Bacteria | 871 |
| 561 | Ga0501311_039132 | 3300049527 | Bacteria | 714 |
| 562 | Ga0501311_097687 | 3300049527 | Bacteria | 517 |
| 563 | Ga0501320_068869 | 3300049536 | Bacteria | 509 |
| 564 | Ga0501323_027111 | 3300049539 | Bacteria | 788 |
| 565 | Ga0501325_007622 | 3300049541 | Bacteria | 920 |
| 566 | Ga0501330_011824 | 3300049546 | Bacteria | 633 |
| 567 | Ga0501037_0728854 | 3300049573 | Bacteria | 658 |
| 568 | Ga0501048_0397850 | 3300049582 | Bacteria | 984 |
| 569 | Ga0501069_0424064 | 3300049585 | Bacteria | 789 |
| 570 | Ga0501225_0177813 | 3300049705 | Bacteria | 663 |
| 571 | nmdc:mga05p37_209234_c1 | 3300050507 | Bacteria | 2359 |
| 572 | nmdc:mga05p37_707_c1 | 3300050507 | Bacteria | 37015 |
| 573 | nmdc:mga09592_24046_c1 | 3300050508 | Bacteria | 5036 |
| 574 | nmdc:mga09592_35_c1 | 3300050508 | Bacteria | 73534 |
| 575 | nmdc:mga0qj67_33_c2 | 3300050509 | Bacteria | 85192 |
| 576 | nmdc:mga06r32_1_c3 | 3300050510 | Bacteria | 67549 |
| 577 | nmdc:mga08y16_1932564_c1 | 3300050511 | Bacteria | 540 |
| 578 | nmdc:mga0n895_156854_c1 | 3300050512 | Bacteria | 2307 |
| 579 | nmdc:mga0n895_207347_c1 | 3300050512 | Bacteria | 1991 |
| 580 | nmdc:mga0rr50_32817_c1 | 3300050513 | Bacteria | 3704 |
| 581 | nmdc:mga08x19_927337_c1 | 3300050514 | Bacteria | 619 |
| 582 | nmdc:mga0a205_152513_c1 | 3300050515 | Bacteria | 2209 |
| 583 | nmdc:mga0a205_28492_c1 | 3300050515 | Bacteria | 1249 |
| 584 | Ga0495601_0009796 | 3300053077 | Bacteria | 5668 |
| 585 | Ga0495601_0803111 | 3300053077 | Bacteria | 597 |
| 586 | Ga0495612_0070859 | 3300053078 | Bacteria | 1453 |
| 587 | Ga0495612_0082946 | 3300053078 | Bacteria | 1348 |
| 588 | Ga0495612_0165261 | 3300053078 | Bacteria | 967 |
| 589 | Ga0495595_0085328 | 3300053084 | Bacteria | 1509 |
| 590 | Ga0495595_0100639 | 3300053084 | Bacteria | 1394 |
| 591 | Ga0495619_0012355 | 3300053085 | Bacteria | 5375 |
| 592 | Ga0495619_0531700 | 3300053085 | Bacteria | 807 |
| 593 | Ga0500646_0075296 | 3300053090 | Bacteria | 1020 |
| 594 | Ga0587084_019424 | 3300059477 | Bacteria | 1001 |
| 595 | Ga0587066_002515 | 3300059490 | Bacteria | 2032 |
| 596 | Ga0587066_077675 | 3300059490 | Bacteria | 713 |
| 597 | Ga0587066_112134 | 3300059490 | Bacteria | 634 |
| 598 | Ga0587073_0023027 | 3300059492 | Bacteria | 1215 |
| 599 | Ga0587073_0032566 | 3300059492 | Bacteria | 1086 |
| 600 | Ga0587073_0271992 | 3300059492 | Bacteria | 540 |
| 601 | Ga0587077_001970 | 3300059493 | Bacteria | 2338 |
| 602 | Ga0587077_064514 | 3300059493 | Bacteria | 803 |
| 603 | Ga0587080_001892 | 3300059503 | Bacteria | 2373 |
| 604 | Ga0587080_131587 | 3300059503 | Bacteria | 564 |
| 605 | Ga0587082_003161 | 3300059504 | Bacteria | 1949 |
| 606 | Ga0587082_007851 | 3300059504 | Bacteria | 1469 |
| 607 | Ga0587082_094628 | 3300059504 | Bacteria | 642 |
| 608 | Ga0587083_0002399 | 3300059505 | Bacteria | 2329 |
| 609 | Ga0587085_149358 | 3300059506 | Bacteria | 538 |
| 610 | Ga0587089_009457 | 3300059509 | Bacteria | 1197 |
| 611 | Ga0587089_111823 | 3300059509 | Bacteria | 505 |
| 612 | Ga0587090_029027 | 3300059510 | Bacteria | 914 |
| 613 | Ga0587091_002709 | 3300059511 | Bacteria | 2139 |
| 614 | Ga0587094_070829 | 3300059513 | Bacteria | 628 |
| 615 | Ga0587098_000853 | 3300059604 | Bacteria | 2107 |
| 616 | Ga0587106_013260 | 3300059605 | Bacteria | 1118 |
| 617 | Ga0587099_000830 | 3300059622 | Bacteria | 1975 |
| 618 | Ga0587099_057804 | 3300059622 | Bacteria | 530 |
| 619 | Ga0587101_058124 | 3300059623 | Bacteria | 684 |
| 620 | Ga0587115_012190 | 3300059626 | Bacteria | 1095 |
| 621 | Ga0587117_054093 | 3300059627 | Bacteria | 674 |
| 622 | Ga0587122_001445 | 3300059628 | Bacteria | 1552 |
| 623 | Ga0587128_005236 | 3300059630 | Bacteria | 1541 |
| 624 | Ga0587128_043241 | 3300059630 | Bacteria | 796 |
| 625 | Ga0587062_035447 | 3300059639 | Bacteria | 785 |
| 626 | Ga0587062_050706 | 3300059639 | Bacteria | 702 |
| 627 | Ga0587067_002165 | 3300059640 | Bacteria | 2278 |
| 628 | Ga0587067_059736 | 3300059640 | Bacteria | 796 |
| 629 | Ga0587068_004670 | 3300059641 | Bacteria | 1823 |
| 630 | Ga0587069_130416 | 3300059642 | Bacteria | 541 |
| 631 | Ga0587072_006669 | 3300059643 | Bacteria | 1766 |
| 632 | Ga0587072_016702 | 3300059643 | Bacteria | 1259 |
| 633 | Ga0587075_018172 | 3300059644 | Bacteria | 1018 |
| 634 | Ga0587076_020339 | 3300059645 | Bacteria | 1088 |
| 635 | Ga0587078_034720 | 3300059646 | Bacteria | 692 |
| 636 | Ga0587104_024499 | 3300059650 | Bacteria | 518 |
| 637 | Ga0587107_001080 | 3300059652 | Bacteria | 2095 |
| 638 | Ga0587110_030486 | 3300059654 | Bacteria | 655 |
| 639 | Ga0587114_009012 | 3300059655 | Bacteria | 1186 |
| 640 | Ga0587120_020535 | 3300059659 | Bacteria | 626 |
| 641 | Ga0587071_003160 | 3300060344 | Bacteria | 2331 |
| 642 | Ga0466962_0029867 | 3300061719 | Bacteria | 2609 |
| 643 | Ga0466962_0044300 | 3300061719 | Bacteria | 2128 |
| 644 | Ga0466962_0167900 | 3300061719 | Bacteria | 1068 |
| 645 | Ga0466962_0514735 | 3300061719 | Bacteria | 606 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013306 | Ga0163162_10157865 | Ga0163162_101578652 | 85 |
| 2 | 3300035114 | Ga0373939_0234561 | Ga0373939_0234561_262_540 | 85 |
| 3 | 3300045836 | Ga0466958_0951943 | Ga0466958_0951943_127_453 | 85 |
| 4 | 3300050512 | nmdc:mga0n895_207347_c1 | nmdc:mga0n895_207347_c1_944_1222 | 85 |
| 5 | 3300050513 | nmdc:mga0rr50_32817_c1 | nmdc:mga0rr50_32817_c1_2892_3170 | 85 |
| 6 | 3300050515 | nmdc:mga0a205_28492_c1 | nmdc:mga0a205_28492_c1_156_434 | 85 |
| 7 | iso_pu_bacteria | 2984576629 | 2984579586 | 85 |
| 8 | iso_pu_bacteria | 2990256926 | 2990257193 | 85 |
| 9 | 3300020082 | Ga0206353_11898514 | Ga0206353_118985143 | 87 |
| 10 | 3300037418 | Ga0395900_0021670 | Ga0395900_0021670_2958_3272 | 87 |
| 11 | 3300038443 | Ga0395901_0011417 | Ga0395901_0011417_5688_6002 | 87 |
| 12 | 3300046463 | Ga0495653_0485801 | Ga0495653_0485801_285_548 | 87 |
| 13 | 3300049527 | Ga0501311_022166 | Ga0501311_022166_476_739 | 87 |
| 14 | 3300049546 | Ga0501330_011824 | Ga0501330_011824_75_350 | 87 |
| 15 | 3300049705 | Ga0501225_0177813 | Ga0501225_0177813_322_585 | 87 |
| 16 | iso_pu_bacteria | 2734482000 | 2734970101 | 87 |
| 17 | 3300005329 | Ga0070683_101823600 | Ga0070683_1018236001 | 88 |
| 18 | 3300005615 | Ga0070702_100813434 | Ga0070702_1008134341 | 88 |
| 19 | 3300013307 | Ga0157372_11393227 | Ga0157372_113932272 | 88 |
| 20 | 3300020077 | Ga0206351_10373923 | Ga0206351_103739232 | 88 |
| 21 | 3300020081 | Ga0206354_10368332 | Ga0206354_103683323 | 88 |
| 22 | 3300025910 | Ga0207684_10886026 | Ga0207684_108860261 | 88 |
| 23 | 3300037418 | Ga0395900_0123671 | Ga0395900_0123671_319_618 | 88 |
| 24 | 3300037466 | Ga0395898_0072810 | Ga0395898_0072810_1574_1873 | 88 |
| 25 | 3300044694 | Ga0466963_0032630 | Ga0466963_0032630_397_669 | 88 |
| 26 | 3300044842 | Ga0466957_0342862 | Ga0466957_0342862_493_765 | 88 |
| 27 | 3300045049 | Ga0466959_0103930 | Ga0466959_0103930_304_600 | 88 |
| 28 | 3300045836 | Ga0466958_0017088 | Ga0466958_0017088_686_958 | 88 |
| 29 | 3300045976 | Ga0466967_2062256 | Ga0466967_2062256_145_444 | 88 |
| 30 | 3300045976 | Ga0466967_2189473 | Ga0466967_2189473_104_400 | 88 |
| 31 | 3300045976 | Ga0466967_2498688 | Ga0466967_2498688_104_376 | 88 |
| 32 | 3300059623 | Ga0587101_058124 | Ga0587101_058124_221_517 | 88 |
| 33 | 3300061719 | Ga0466962_0044300 | Ga0466962_0044300_714_986 | 88 |
| 34 | iso_pu_bacteria | 2751185788 | 2753303689 | 88 |
| 35 | iso_pu_bacteria | 2904430863 | 2904432386 | 88 |
| 36 | iso_pu_bacteria | 2904501621 | 2904501818 | 88 |
| 37 | iso_pu_bacteria | 2908674828 | 2908676128 | 88 |
| 38 | iso_pu_bacteria | 2909074476 | 2909076605 | 88 |
| 39 | iso_pu_bacteria | 2919039151 | 2919040064 | 88 |
| 40 | iso_pu_bacteria | 2919042368 | 2919043183 | 88 |
| 41 | iso_pu_bacteria | 2928104781 | 2928105478 | 88 |
| 42 | iso_pu_bacteria | 2928500415 | 2928500996 | 88 |
| 43 | iso_pu_bacteria | 2984551494 | 2984551985 | 88 |
| 44 | 3300004801 | Ga0058860_12148150 | Ga0058860_121481502 | 89 |
| 45 | 3300019190 | Ga0184600_101748 | Ga0184600_1017481 | 89 |
| 46 | 3300021388 | Ga0213875_10243769 | Ga0213875_102437692 | 89 |
| 47 | 3300024225 | Ga0224572_1026985 | Ga0224572_10269853 | 89 |
| 48 | 3300025929 | Ga0207664_10016921 | Ga0207664_100169219 | 89 |
| 49 | 3300027512 | Ga0209179_1146784 | Ga0209179_11467842 | 89 |
| 50 | 3300033547 | Ga0316212_1019878 | Ga0316212_10198781 | 89 |
| 51 | 3300037853 | Ga0436364_0697983 | Ga0436364_0697983_285_566 | 89 |
| 52 | 3300037853 | Ga0436364_1139829 | Ga0436364_1139829_1625_1900 | 89 |
| 53 | 3300039438 | Ga0436360_1358491 | Ga0436360_1358491_496_780 | 89 |
| 54 | 3300039453 | Ga0436362_0080480 | Ga0436362_0080480_840_1124 | 89 |
| 55 | 3300044694 | Ga0466963_0056835 | Ga0466963_0056835_558_833 | 89 |
| 56 | 3300044694 | Ga0466963_0144726 | Ga0466963_0144726_595_870 | 89 |
| 57 | 3300045836 | Ga0466958_0129643 | Ga0466958_0129643_1162_1437 | 89 |
| 58 | 3300045976 | Ga0466967_1781871 | Ga0466967_1781871_224_493 | 89 |
| 59 | 3300049582 | Ga0501048_0397850 | Ga0501048_0397850_594_863 | 89 |
| 60 | 3300059639 | Ga0587062_035447 | Ga0587062_035447_165_434 | 89 |
| 61 | iso_pu_bacteria | 2811994880 | 2812364368 | 89 |
| 62 | 3300003574 | Ga0007410J51695_1043507 | Ga0007410J51695_10435073 | 90 |
| 63 | 3300003693 | Ga0032354_1051217 | Ga0032354_10512172 | 90 |
| 64 | 3300005435 | Ga0070714_100001124 | Ga0070714_10000112423 | 90 |
| 65 | 3300005436 | Ga0070713_101206283 | Ga0070713_1012062831 | 90 |
| 66 | 3300005445 | Ga0070708_101187265 | Ga0070708_1011872651 | 90 |
| 67 | 3300005467 | Ga0070706_100257139 | Ga0070706_1002571394 | 90 |
| 68 | 3300005467 | Ga0070706_100346334 | Ga0070706_1003463344 | 90 |
| 69 | 3300005468 | Ga0070707_100098495 | Ga0070707_1000984954 | 90 |
| 70 | 3300005468 | Ga0070707_100197595 | Ga0070707_1001975954 | 90 |
| 71 | 3300005468 | Ga0070707_101906745 | Ga0070707_1019067452 | 90 |
| 72 | 3300005471 | Ga0070698_100001882 | Ga0070698_10000188218 | 90 |
| 73 | 3300005518 | Ga0070699_100418034 | Ga0070699_1004180342 | 90 |
| 74 | 3300005536 | Ga0070697_100038833 | Ga0070697_1000388337 | 90 |
| 75 | 3300005983 | Ga0081540_1022585 | Ga0081540_10225854 | 90 |
| 76 | 3300006028 | Ga0070717_10214680 | Ga0070717_102146801 | 90 |
| 77 | 3300006844 | Ga0075428_100099463 | Ga0075428_1000994634 | 90 |
| 78 | 3300006846 | Ga0075430_100047794 | Ga0075430_1000477944 | 90 |
| 79 | 3300006847 | Ga0075431_100006706 | Ga0075431_10000670614 | 90 |
| 80 | 3300006852 | Ga0075433_10271224 | Ga0075433_102712243 | 90 |
| 81 | 3300006880 | Ga0075429_100005726 | Ga0075429_10000572613 | 90 |
| 82 | 3300006880 | Ga0075429_100015532 | Ga0075429_10001553212 | 90 |
| 83 | 3300009147 | Ga0114129_10015903 | Ga0114129_1001590320 | 90 |
| 84 | 3300009147 | Ga0114129_10085359 | Ga0114129_100853594 | 90 |
| 85 | 3300020069 | Ga0197907_11321259 | Ga0197907_113212599 | 90 |
| 86 | 3300020070 | Ga0206356_11612728 | Ga0206356_116127283 | 90 |
| 87 | 3300020075 | Ga0206349_1658620 | Ga0206349_16586201 | 90 |
| 88 | 3300020076 | Ga0206355_1627926 | Ga0206355_16279264 | 90 |
| 89 | 3300020078 | Ga0206352_11126397 | Ga0206352_111263973 | 90 |
| 90 | 3300020080 | Ga0206350_11613293 | Ga0206350_116132933 | 90 |
| 91 | 3300020081 | Ga0206354_10926327 | Ga0206354_109263273 | 90 |
| 92 | 3300020082 | Ga0206353_11847015 | Ga0206353_118470153 | 90 |
| 93 | 3300022467 | Ga0224712_10037453 | Ga0224712_100374533 | 90 |
| 94 | 3300025898 | Ga0207692_10228046 | Ga0207692_102280461 | 90 |
| 95 | 3300025910 | Ga0207684_10027808 | Ga0207684_100278083 | 90 |
| 96 | 3300025910 | Ga0207684_10469944 | Ga0207684_104699441 | 90 |
| 97 | 3300025922 | Ga0207646_10079404 | Ga0207646_100794046 | 90 |
| 98 | 3300025922 | Ga0207646_10188791 | Ga0207646_101887913 | 90 |
| 99 | 3300025929 | Ga0207664_10001032 | Ga0207664_1000103211 | 90 |
| 100 | 3300025929 | Ga0207664_10093952 | Ga0207664_100939523 | 90 |
| 101 | 3300025939 | Ga0207665_10346687 | Ga0207665_103466872 | 90 |
| 102 | 3300030889 | Ga0265761_108369 | Ga0265761_1083691 | 90 |
| 103 | 3300031090 | Ga0265760_10128304 | Ga0265760_101283042 | 90 |
| 104 | 3300031995 | Ga0307409_102160686 | Ga0307409_1021606861 | 90 |
| 105 | 3300035088 | Ga0373940_0263542 | Ga0373940_0263542_223_498 | 90 |
| 106 | 3300035112 | Ga0373932_0221165 | Ga0373932_0221165_295_567 | 90 |
| 107 | 3300035113 | Ga0373936_0468932 | Ga0373936_0468932_109_381 | 90 |
| 108 | 3300035118 | Ga0373954_0089960 | Ga0373954_0089960_667_939 | 90 |
| 109 | 3300035118 | Ga0373954_0294384 | Ga0373954_0294384_184_456 | 90 |
| 110 | 3300035121 | Ga0373960_0179742 | Ga0373960_0179742_415_705 | 90 |
| 111 | 3300036401 | Ga0373937_0283190 | Ga0373937_0283190_944_1216 | 90 |
| 112 | 3300036457 | Ga0265778_014641 | Ga0265778_014641_607_891 | 90 |
| 113 | 3300037312 | Ga0395899_0724377 | Ga0395899_0724377_65_340 | 90 |
| 114 | 3300037418 | Ga0395900_0853169 | Ga0395900_0853169_173_445 | 90 |
| 115 | 3300039450 | Ga0436363_0387806 | Ga0436363_0387806_261_539 | 90 |
| 116 | 3300044684 | Ga0466966_0333615 | Ga0466966_0333615_283_579 | 90 |
| 117 | 3300044693 | Ga0466961_0018685 | Ga0466961_0018685_153_431 | 90 |
| 118 | 3300044719 | Ga0466971_0168729 | Ga0466971_0168729_66_344 | 90 |
| 119 | 3300044765 | Ga0466970_0938761 | Ga0466970_0938761_96_374 | 90 |
| 120 | 3300045836 | Ga0466958_0067645 | Ga0466958_0067645_1104_1382 | 90 |
| 121 | 3300046459 | Ga0495629_0979595 | Ga0495629_0979595_176_448 | 90 |
| 122 | 3300046461 | Ga0495641_0224277 | Ga0495641_0224277_98_370 | 90 |
| 123 | 3300046462 | Ga0495651_0154494 | Ga0495651_0154494_921_1193 | 90 |
| 124 | 3300046499 | Ga0495594_0073965 | Ga0495594_0073965_458_748 | 90 |
| 125 | 3300046516 | Ga0495628_0684585 | Ga0495628_0684585_232_504 | 90 |
| 126 | 3300046517 | Ga0495630_1055863 | Ga0495630_1055863_323_595 | 90 |
| 127 | 3300046536 | Ga0495587_0218056 | Ga0495587_0218056_525_797 | 90 |
| 128 | 3300046559 | Ga0495667_0104561 | Ga0495667_0104561_971_1243 | 90 |
| 129 | 3300046642 | Ga0495634_0237069 | Ga0495634_0237069_556_828 | 90 |
| 130 | 3300046663 | Ga0495635_0387390 | Ga0495635_0387390_229_501 | 90 |
| 131 | 3300046675 | Ga0495657_0093281 | Ga0495657_0093281_985_1257 | 90 |
| 132 | 3300046679 | Ga0495623_0094847 | Ga0495623_0094847_954_1226 | 90 |
| 133 | 3300046690 | Ga0495624_0377485 | Ga0495624_0377485_28_300 | 90 |
| 134 | 3300046809 | Ga0495600_0314608 | Ga0495600_0314608_492_764 | 90 |
| 135 | 3300047322 | Ga0495680_1088183 | Ga0495680_1088183_12_284 | 90 |
| 136 | 3300047471 | Ga0495684_0435140 | Ga0495684_0435140_339_611 | 90 |
| 137 | 3300048907 | Ga0496104_1499915 | Ga0496104_1499915_163_435 | 90 |
| 138 | 3300048908 | Ga0496105_0639514 | Ga0496105_0639514_482_754 | 90 |
| 139 | 3300049573 | Ga0501037_0728854 | Ga0501037_0728854_307_582 | 90 |
| 140 | 3300050507 | nmdc:mga05p37_209234_c1 | nmdc:mga05p37_209234_c1_1795_2070 | 90 |
| 141 | 3300050507 | nmdc:mga05p37_707_c1 | nmdc:mga05p37_707_c1_14019_14294 | 90 |
| 142 | 3300050508 | nmdc:mga09592_24046_c1 | nmdc:mga09592_24046_c1_1545_1820 | 90 |
| 143 | 3300050508 | nmdc:mga09592_35_c1 | nmdc:mga09592_35_c1_65950_66225 | 90 |
| 144 | 3300050509 | nmdc:mga0qj67_33_c2 | nmdc:mga0qj67_33_c2_77547_77822 | 90 |
| 145 | 3300050510 | nmdc:mga06r32_1_c3 | nmdc:mga06r32_1_c3_1325_1600 | 90 |
| 146 | 3300050515 | nmdc:mga0a205_152513_c1 | nmdc:mga0a205_152513_c1_1027_1299 | 90 |
| 147 | 3300053078 | Ga0495612_0165261 | Ga0495612_0165261_153_425 | 90 |
| 148 | 3300059492 | Ga0587073_0271992 | Ga0587073_0271992_160_438 | 90 |
| 149 | 3300061719 | Ga0466962_0514735 | Ga0466962_0514735_205_483 | 90 |
| 150 | iso_pu_bacteria | 2622736605 | 2623497650 | 90 |
| 151 | iso_pu_bacteria | 2919051321 | 2919052525 | 90 |
| 152 | 3300001990 | JGI24737J22298_10028203 | JGI24737J22298_100282033 | 91 |
| 153 | 3300002075 | JGI24738J21930_10015386 | JGI24738J21930_100153861 | 91 |
| 154 | 3300003162 | Ga0006778J45830_1022691 | Ga0006778J45830_10226913 | 91 |
| 155 | 3300003659 | JGI25404J52841_10004898 | JGI25404J52841_100048981 | 91 |
| 156 | 3300004799 | Ga0058863_11721945 | Ga0058863_117219451 | 91 |
| 157 | 3300004799 | Ga0058863_11957706 | Ga0058863_119577063 | 91 |
| 158 | 3300004801 | Ga0058860_11980957 | Ga0058860_119809571 | 91 |
| 159 | 3300004803 | Ga0058862_10000712 | Ga0058862_100007123 | 91 |
| 160 | 3300004803 | Ga0058862_12871663 | Ga0058862_128716633 | 91 |
| 161 | 3300005329 | Ga0070683_100189872 | Ga0070683_1001898724 | 91 |
| 162 | 3300005329 | Ga0070683_100523299 | Ga0070683_1005232993 | 91 |
| 163 | 3300005329 | Ga0070683_101841809 | Ga0070683_1018418092 | 91 |
| 164 | 3300005330 | Ga0070690_100732715 | Ga0070690_1007327152 | 91 |
| 165 | 3300005337 | Ga0070682_100387842 | Ga0070682_1003878423 | 91 |
| 166 | 3300005338 | Ga0068868_100420703 | Ga0068868_1004207033 | 91 |
| 167 | 3300005344 | Ga0070661_100117520 | Ga0070661_1001175204 | 91 |
| 168 | 3300005344 | Ga0070661_100718822 | Ga0070661_1007188223 | 91 |
| 169 | 3300005345 | Ga0070692_10075882 | Ga0070692_100758822 | 91 |
| 170 | 3300005354 | Ga0070675_101670948 | Ga0070675_1016709481 | 91 |
| 171 | 3300005355 | Ga0070671_100227176 | Ga0070671_1002271762 | 91 |
| 172 | 3300005366 | Ga0070659_100791008 | Ga0070659_1007910082 | 91 |
| 173 | 3300005406 | Ga0070703_10001744 | Ga0070703_100017444 | 91 |
| 174 | 3300005434 | Ga0070709_10276185 | Ga0070709_102761852 | 91 |
| 175 | 3300005434 | Ga0070709_10479627 | Ga0070709_104796272 | 91 |
| 176 | 3300005434 | Ga0070709_11522147 | Ga0070709_115221472 | 91 |
| 177 | 3300005435 | Ga0070714_100003109 | Ga0070714_10000310921 | 91 |
| 178 | 3300005435 | Ga0070714_100913651 | Ga0070714_1009136512 | 91 |
| 179 | 3300005435 | Ga0070714_101068137 | Ga0070714_1010681372 | 91 |
| 180 | 3300005435 | Ga0070714_101420419 | Ga0070714_1014204192 | 91 |
| 181 | 3300005435 | Ga0070714_102151578 | Ga0070714_1021515782 | 91 |
| 182 | 3300005436 | Ga0070713_100001233 | Ga0070713_1000012334 | 91 |
| 183 | 3300005436 | Ga0070713_100227446 | Ga0070713_1002274463 | 91 |
| 184 | 3300005436 | Ga0070713_100917954 | Ga0070713_1009179542 | 91 |
| 185 | 3300005436 | Ga0070713_101534455 | Ga0070713_1015344552 | 91 |
| 186 | 3300005436 | Ga0070713_102130459 | Ga0070713_1021304592 | 91 |
| 187 | 3300005437 | Ga0070710_10000437 | Ga0070710_1000043710 | 91 |
| 188 | 3300005437 | Ga0070710_10314212 | Ga0070710_103142122 | 91 |
| 189 | 3300005437 | Ga0070710_11005374 | Ga0070710_110053741 | 91 |
| 190 | 3300005439 | Ga0070711_100045638 | Ga0070711_1000456384 | 91 |
| 191 | 3300005439 | Ga0070711_100072955 | Ga0070711_1000729552 | 91 |
| 192 | 3300005439 | Ga0070711_100191052 | Ga0070711_1001910524 | 91 |
| 193 | 3300005439 | Ga0070711_101812715 | Ga0070711_1018127151 | 91 |
| 194 | 3300005439 | Ga0070711_101833257 | Ga0070711_1018332571 | 91 |
| 195 | 3300005445 | Ga0070708_100659845 | Ga0070708_1006598451 | 91 |
| 196 | 3300005445 | Ga0070708_101468702 | Ga0070708_1014687021 | 91 |
| 197 | 3300005456 | Ga0070678_100500757 | Ga0070678_1005007572 | 91 |
| 198 | 3300005457 | Ga0070662_100036864 | Ga0070662_1000368648 | 91 |
| 199 | 3300005458 | Ga0070681_11804584 | Ga0070681_118045841 | 91 |
| 200 | 3300005467 | Ga0070706_100003720 | Ga0070706_1000037209 | 91 |
| 201 | 3300005468 | Ga0070707_100021481 | Ga0070707_1000214816 | 91 |
| 202 | 3300005468 | Ga0070707_100183589 | Ga0070707_1001835894 | 91 |
| 203 | 3300005468 | Ga0070707_100882677 | Ga0070707_1008826771 | 91 |
| 204 | 3300005468 | Ga0070707_101198117 | Ga0070707_1011981171 | 91 |
| 205 | 3300005468 | Ga0070707_102013802 | Ga0070707_1020138021 | 91 |
| 206 | 3300005471 | Ga0070698_100018293 | Ga0070698_1000182934 | 91 |
| 207 | 3300005471 | Ga0070698_100869854 | Ga0070698_1008698542 | 91 |
| 208 | 3300005535 | Ga0070684_100362268 | Ga0070684_1003622683 | 91 |
| 209 | 3300005535 | Ga0070684_100948705 | Ga0070684_1009487052 | 91 |
| 210 | 3300005536 | Ga0070697_101408534 | Ga0070697_1014085342 | 91 |
| 211 | 3300005547 | Ga0070693_100581968 | Ga0070693_1005819682 | 91 |
| 212 | 3300005548 | Ga0070665_100476653 | Ga0070665_1004766532 | 91 |
| 213 | 3300005564 | Ga0070664_100041377 | Ga0070664_1000413772 | 91 |
| 214 | 3300005577 | Ga0068857_100364734 | Ga0068857_1003647343 | 91 |
| 215 | 3300005577 | Ga0068857_101705902 | Ga0068857_1017059022 | 91 |
| 216 | 3300005615 | Ga0070702_100373834 | Ga0070702_1003738343 | 91 |
| 217 | 3300005615 | Ga0070702_100785118 | Ga0070702_1007851181 | 91 |
| 218 | 3300005616 | Ga0068852_100729200 | Ga0068852_1007292002 | 91 |
| 219 | 3300005617 | Ga0068859_100670474 | Ga0068859_1006704743 | 91 |
| 220 | 3300005618 | Ga0068864_100089287 | Ga0068864_1000892876 | 91 |
| 221 | 3300005618 | Ga0068864_100100693 | Ga0068864_1001006936 | 91 |
| 222 | 3300005618 | Ga0068864_100467420 | Ga0068864_1004674203 | 91 |
| 223 | 3300005719 | Ga0068861_100064654 | Ga0068861_1000646545 | 91 |
| 224 | 3300005841 | Ga0068863_100366384 | Ga0068863_1003663842 | 91 |
| 225 | 3300005842 | Ga0068858_100129309 | Ga0068858_1001293092 | 91 |
| 226 | 3300005843 | Ga0068860_100644706 | Ga0068860_1006447063 | 91 |
| 227 | 3300005843 | Ga0068860_101483819 | Ga0068860_1014838192 | 91 |
| 228 | 3300005844 | Ga0068862_101239261 | Ga0068862_1012392612 | 91 |
| 229 | 3300005983 | Ga0081540_1000341 | Ga0081540_100034131 | 91 |
| 230 | 3300005983 | Ga0081540_1047724 | Ga0081540_10477244 | 91 |
| 231 | 3300005985 | Ga0081539_10104788 | Ga0081539_101047884 | 91 |
| 232 | 3300006028 | Ga0070717_10010919 | Ga0070717_100109193 | 91 |
| 233 | 3300006028 | Ga0070717_10135605 | Ga0070717_101356052 | 91 |
| 234 | 3300006028 | Ga0070717_11273771 | Ga0070717_112737712 | 91 |
| 235 | 3300006163 | Ga0070715_10188857 | Ga0070715_101888572 | 91 |
| 236 | 3300006163 | Ga0070715_10473647 | Ga0070715_104736472 | 91 |
| 237 | 3300006173 | Ga0070716_100000511 | Ga0070716_10000051124 | 91 |
| 238 | 3300006173 | Ga0070716_100084223 | Ga0070716_1000842234 | 91 |
| 239 | 3300006175 | Ga0070712_100001287 | Ga0070712_1000012873 | 91 |
| 240 | 3300006175 | Ga0070712_100014381 | Ga0070712_10001438110 | 91 |
| 241 | 3300006175 | Ga0070712_100600539 | Ga0070712_1006005392 | 91 |
| 242 | 3300006175 | Ga0070712_101711548 | Ga0070712_1017115482 | 91 |
| 243 | 3300006175 | Ga0070712_101805339 | Ga0070712_1018053391 | 91 |
| 244 | 3300006175 | Ga0070712_102053952 | Ga0070712_1020539522 | 91 |
| 245 | 3300006237 | Ga0097621_100042306 | Ga0097621_1000423063 | 91 |
| 246 | 3300006237 | Ga0097621_100351151 | Ga0097621_1003511513 | 91 |
| 247 | 3300006358 | Ga0068871_100308964 | Ga0068871_1003089642 | 91 |
| 248 | 3300006847 | Ga0075431_100598519 | Ga0075431_1005985192 | 91 |
| 249 | 3300006871 | Ga0075434_100016693 | Ga0075434_1000166935 | 91 |
| 250 | 3300006871 | Ga0075434_100126789 | Ga0075434_1001267895 | 91 |
| 251 | 3300006871 | Ga0075434_100725765 | Ga0075434_1007257653 | 91 |
| 252 | 3300006914 | Ga0075436_100227898 | Ga0075436_1002278982 | 91 |
| 253 | 3300006914 | Ga0075436_100270029 | Ga0075436_1002700292 | 91 |
| 254 | 3300006931 | Ga0097620_100670479 | Ga0097620_1006704793 | 91 |
| 255 | 3300007076 | Ga0075435_100081437 | Ga0075435_1000814376 | 91 |
| 256 | 3300007076 | Ga0075435_100281215 | Ga0075435_1002812154 | 91 |
| 257 | 3300007076 | Ga0075435_100560897 | Ga0075435_1005608973 | 91 |
| 258 | 3300007788 | Ga0099795_10005676 | Ga0099795_100056763 | 91 |
| 259 | 3300007788 | Ga0099795_10263560 | Ga0099795_102635603 | 91 |
| 260 | 3300009094 | Ga0111539_10309079 | Ga0111539_103090791 | 91 |
| 261 | 3300009098 | Ga0105245_10028695 | Ga0105245_100286954 | 91 |
| 262 | 3300009098 | Ga0105245_10516397 | Ga0105245_105163971 | 91 |
| 263 | 3300009101 | Ga0105247_11596078 | Ga0105247_115960781 | 91 |
| 264 | 3300009147 | Ga0114129_11910986 | Ga0114129_119109862 | 91 |
| 265 | 3300009148 | Ga0105243_11313044 | Ga0105243_113130441 | 91 |
| 266 | 3300009174 | Ga0105241_12207243 | Ga0105241_122072431 | 91 |
| 267 | 3300009176 | Ga0105242_11856509 | Ga0105242_118565092 | 91 |
| 268 | 3300009545 | Ga0105237_10205919 | Ga0105237_102059191 | 91 |
| 269 | 3300009545 | Ga0105237_11157419 | Ga0105237_111574192 | 91 |
| 270 | 3300009551 | Ga0105238_10389366 | Ga0105238_103893663 | 91 |
| 271 | 3300009553 | Ga0105249_12884881 | Ga0105249_128848811 | 91 |
| 272 | 3300010159 | Ga0099796_10119283 | Ga0099796_101192833 | 91 |
| 273 | 3300010375 | Ga0105239_10031478 | Ga0105239_100314784 | 91 |
| 274 | 3300010375 | Ga0105239_12199722 | Ga0105239_121997221 | 91 |
| 275 | 3300011119 | Ga0105246_10941664 | Ga0105246_109416642 | 91 |
| 276 | 3300013104 | Ga0157370_10517815 | Ga0157370_105178152 | 91 |
| 277 | 3300013105 | Ga0157369_10858116 | Ga0157369_108581162 | 91 |
| 278 | 3300013296 | Ga0157374_10030097 | Ga0157374_1003009711 | 91 |
| 279 | 3300013296 | Ga0157374_10393549 | Ga0157374_103935493 | 91 |
| 280 | 3300013297 | Ga0157378_10437009 | Ga0157378_104370094 | 91 |
| 281 | 3300013307 | Ga0157372_10217071 | Ga0157372_102170713 | 91 |
| 282 | 3300013307 | Ga0157372_10439772 | Ga0157372_104397723 | 91 |
| 283 | 3300013307 | Ga0157372_11900388 | Ga0157372_119003881 | 91 |
| 284 | 3300013308 | Ga0157375_10289818 | Ga0157375_102898184 | 91 |
| 285 | 3300014325 | Ga0163163_10297835 | Ga0163163_102978354 | 91 |
| 286 | 3300014325 | Ga0163163_10321708 | Ga0163163_103217082 | 91 |
| 287 | 3300014325 | Ga0163163_11847124 | Ga0163163_118471242 | 91 |
| 288 | 3300014497 | Ga0182008_10084220 | Ga0182008_100842203 | 91 |
| 289 | 3300014745 | Ga0157377_11276132 | Ga0157377_112761321 | 91 |
| 290 | 3300014968 | Ga0157379_10011666 | Ga0157379_1001166614 | 91 |
| 291 | 3300014968 | Ga0157379_10420833 | Ga0157379_104208332 | 91 |
| 292 | 3300014969 | Ga0157376_11099675 | Ga0157376_110996752 | 91 |
| 293 | 3300015265 | Ga0182005_1092653 | Ga0182005_10926531 | 91 |
| 294 | 3300020069 | Ga0197907_10537378 | Ga0197907_105373782 | 91 |
| 295 | 3300020069 | Ga0197907_10950516 | Ga0197907_109505162 | 91 |
| 296 | 3300020070 | Ga0206356_11171823 | Ga0206356_111718232 | 91 |
| 297 | 3300020076 | Ga0206355_1179809 | Ga0206355_11798092 | 91 |
| 298 | 3300020080 | Ga0206350_10990969 | Ga0206350_109909693 | 91 |
| 299 | 3300020081 | Ga0206354_10110661 | Ga0206354_101106613 | 91 |
| 300 | 3300020081 | Ga0206354_11310032 | Ga0206354_113100322 | 91 |
| 301 | 3300020081 | Ga0206354_11496319 | Ga0206354_114963191 | 91 |
| 302 | 3300020082 | Ga0206353_10645923 | Ga0206353_106459231 | 91 |
| 303 | 3300020082 | Ga0206353_11155186 | Ga0206353_111551862 | 91 |
| 304 | 3300020082 | Ga0206353_11323745 | Ga0206353_113237453 | 91 |
| 305 | 3300020082 | Ga0206353_11381381 | Ga0206353_113813811 | 91 |
| 306 | 3300021358 | Ga0213873_10149280 | Ga0213873_101492802 | 91 |
| 307 | 3300021384 | Ga0213876_10522052 | Ga0213876_105220521 | 91 |
| 308 | 3300021388 | Ga0213875_10010857 | Ga0213875_100108579 | 91 |
| 309 | 3300021388 | Ga0213875_10106303 | Ga0213875_101063034 | 91 |
| 310 | 3300022467 | Ga0224712_10255346 | Ga0224712_102553461 | 91 |
| 311 | 3300022467 | Ga0224712_10338561 | Ga0224712_103385612 | 91 |
| 312 | 3300025898 | Ga0207692_10001130 | Ga0207692_1000113012 | 91 |
| 313 | 3300025898 | Ga0207692_10123800 | Ga0207692_101238004 | 91 |
| 314 | 3300025898 | Ga0207692_11182624 | Ga0207692_111826242 | 91 |
| 315 | 3300025900 | Ga0207710_10273231 | Ga0207710_102732312 | 91 |
| 316 | 3300025901 | Ga0207688_10317498 | Ga0207688_103174982 | 91 |
| 317 | 3300025901 | Ga0207688_10565290 | Ga0207688_105652902 | 91 |
| 318 | 3300025906 | Ga0207699_10000260 | Ga0207699_1000026016 | 91 |
| 319 | 3300025906 | Ga0207699_10563416 | Ga0207699_105634161 | 91 |
| 320 | 3300025910 | Ga0207684_10016512 | Ga0207684_1001651211 | 91 |
| 321 | 3300025910 | Ga0207684_10333546 | Ga0207684_103335464 | 91 |
| 322 | 3300025910 | Ga0207684_11430348 | Ga0207684_114303482 | 91 |
| 323 | 3300025912 | Ga0207707_10388364 | Ga0207707_103883643 | 91 |
| 324 | 3300025912 | Ga0207707_11040894 | Ga0207707_110408942 | 91 |
| 325 | 3300025914 | Ga0207671_10215586 | Ga0207671_102155862 | 91 |
| 326 | 3300025914 | Ga0207671_11313469 | Ga0207671_113134692 | 91 |
| 327 | 3300025915 | Ga0207693_10004081 | Ga0207693_1000408120 | 91 |
| 328 | 3300025915 | Ga0207693_10024997 | Ga0207693_1002499710 | 91 |
| 329 | 3300025915 | Ga0207693_10178908 | Ga0207693_101789084 | 91 |
| 330 | 3300025915 | Ga0207693_10765073 | Ga0207693_107650732 | 91 |
| 331 | 3300025916 | Ga0207663_10000595 | Ga0207663_1000059524 | 91 |
| 332 | 3300025916 | Ga0207663_10212114 | Ga0207663_102121144 | 91 |
| 333 | 3300025916 | Ga0207663_11522477 | Ga0207663_115224772 | 91 |
| 334 | 3300025919 | Ga0207657_10324694 | Ga0207657_103246942 | 91 |
| 335 | 3300025920 | Ga0207649_11492506 | Ga0207649_114925062 | 91 |
| 336 | 3300025922 | Ga0207646_10019054 | Ga0207646_100190544 | 91 |
| 337 | 3300025922 | Ga0207646_10091536 | Ga0207646_100915362 | 91 |
| 338 | 3300025924 | Ga0207694_10909492 | Ga0207694_109094923 | 91 |
| 339 | 3300025926 | Ga0207659_10835760 | Ga0207659_108357603 | 91 |
| 340 | 3300025927 | Ga0207687_10050704 | Ga0207687_100507044 | 91 |
| 341 | 3300025928 | Ga0207700_10000091 | Ga0207700_1000009145 | 91 |
| 342 | 3300025928 | Ga0207700_10053796 | Ga0207700_100537964 | 91 |
| 343 | 3300025928 | Ga0207700_10104512 | Ga0207700_101045123 | 91 |
| 344 | 3300025928 | Ga0207700_10600350 | Ga0207700_106003503 | 91 |
| 345 | 3300025928 | Ga0207700_11699185 | Ga0207700_116991851 | 91 |
| 346 | 3300025929 | Ga0207664_10001323 | Ga0207664_1000132324 | 91 |
| 347 | 3300025929 | Ga0207664_10409685 | Ga0207664_104096854 | 91 |
| 348 | 3300025929 | Ga0207664_10790899 | Ga0207664_107908992 | 91 |
| 349 | 3300025929 | Ga0207664_10871334 | Ga0207664_108713342 | 91 |
| 350 | 3300025931 | Ga0207644_11682359 | Ga0207644_116823591 | 91 |
| 351 | 3300025933 | Ga0207706_10776718 | Ga0207706_107767181 | 91 |
| 352 | 3300025935 | Ga0207709_10902866 | Ga0207709_109028661 | 91 |
| 353 | 3300025939 | Ga0207665_10000821 | Ga0207665_1000082124 | 91 |
| 354 | 3300025939 | Ga0207665_10012079 | Ga0207665_100120792 | 91 |
| 355 | 3300025941 | Ga0207711_10216871 | Ga0207711_102168713 | 91 |
| 356 | 3300025944 | Ga0207661_10689520 | Ga0207661_106895203 | 91 |
| 357 | 3300025944 | Ga0207661_11163908 | Ga0207661_111639082 | 91 |
| 358 | 3300026023 | Ga0207677_10102410 | Ga0207677_101024102 | 91 |
| 359 | 3300026035 | Ga0207703_10089913 | Ga0207703_100899132 | 91 |
| 360 | 3300026035 | Ga0207703_10317468 | Ga0207703_103174682 | 91 |
| 361 | 3300026075 | Ga0207708_10254560 | Ga0207708_102545603 | 91 |
| 362 | 3300026075 | Ga0207708_10804487 | Ga0207708_108044873 | 91 |
| 363 | 3300026078 | Ga0207702_10958647 | Ga0207702_109586472 | 91 |
| 364 | 3300026088 | Ga0207641_10337316 | Ga0207641_103373164 | 91 |
| 365 | 3300026095 | Ga0207676_11547644 | Ga0207676_115476442 | 91 |
| 366 | 3300026116 | Ga0207674_10014845 | Ga0207674_1001484515 | 91 |
| 367 | 3300026116 | Ga0207674_10282848 | Ga0207674_102828483 | 91 |
| 368 | 3300026118 | Ga0207675_100010883 | Ga0207675_10001088311 | 91 |
| 369 | 3300026142 | Ga0207698_11021238 | Ga0207698_110212382 | 91 |
| 370 | 3300028379 | Ga0268266_10057547 | Ga0268266_100575473 | 91 |
| 371 | 3300030760 | Ga0265762_1005987 | Ga0265762_10059872 | 91 |
| 372 | 3300031901 | Ga0307406_10162975 | Ga0307406_101629753 | 91 |
| 373 | 3300032002 | Ga0307416_102032414 | Ga0307416_1020324141 | 91 |
| 374 | 3300032126 | Ga0307415_100681042 | Ga0307415_1006810422 | 91 |
| 375 | 3300034816 | Ga0373930_0130636 | Ga0373930_0130636_230_514 | 91 |
| 376 | 3300034818 | Ga0373950_0062232 | Ga0373950_0062232_218_502 | 91 |
| 377 | 3300034819 | Ga0373958_0071457 | Ga0373958_0071457_334_624 | 91 |
| 378 | 3300034957 | Ga0373938_0113643 | Ga0373938_0113643_204_515 | 91 |
| 379 | 3300035083 | Ga0373926_0001795 | Ga0373926_0001795_6225_6509 | 91 |
| 380 | 3300035083 | Ga0373926_0398212 | Ga0373926_0398212_107_403 | 91 |
| 381 | 3300035086 | Ga0373934_0030274 | Ga0373934_0030274_874_1158 | 91 |
| 382 | 3300035086 | Ga0373934_0508346 | Ga0373934_0508346_143_430 | 91 |
| 383 | 3300035089 | Ga0373944_0005972 | Ga0373944_0005972_1217_1501 | 91 |
| 384 | 3300035090 | Ga0373949_0090156 | Ga0373949_0090156_109_393 | 91 |
| 385 | 3300035111 | Ga0373923_0012347 | Ga0373923_0012347_1135_1431 | 91 |
| 386 | 3300035111 | Ga0373923_0029180 | Ga0373923_0029180_1455_1739 | 91 |
| 387 | 3300035113 | Ga0373936_0090925 | Ga0373936_0090925_227_511 | 91 |
| 388 | 3300035116 | Ga0373945_0006856 | Ga0373945_0006856_2181_2465 | 91 |
| 389 | 3300035116 | Ga0373945_0071172 | Ga0373945_0071172_491_787 | 91 |
| 390 | 3300035116 | Ga0373945_0129528 | Ga0373945_0129528_38_316 | 91 |
| 391 | 3300035117 | Ga0373953_0010766 | Ga0373953_0010766_1258_1542 | 91 |
| 392 | 3300035118 | Ga0373954_0021194 | Ga0373954_0021194_883_1167 | 91 |
| 393 | 3300035118 | Ga0373954_0032674 | Ga0373954_0032674_1360_1656 | 91 |
| 394 | 3300035118 | Ga0373954_0258067 | Ga0373954_0258067_422_706 | 91 |
| 395 | 3300035119 | Ga0373956_0064292 | Ga0373956_0064292_91_387 | 91 |
| 396 | 3300035119 | Ga0373956_0091360 | Ga0373956_0091360_13_297 | 91 |
| 397 | 3300035120 | Ga0373957_0001041 | Ga0373957_0001041_5730_6026 | 91 |
| 398 | 3300035120 | Ga0373957_0007693 | Ga0373957_0007693_2127_2411 | 91 |
| 399 | 3300035170 | Ga0373943_0011419 | Ga0373943_0011419_1098_1382 | 91 |
| 400 | 3300035170 | Ga0373943_0583776 | Ga0373943_0583776_258_536 | 91 |
| 401 | 3300035172 | Ga0373955_0002432 | Ga0373955_0002432_5836_6132 | 91 |
| 402 | 3300035172 | Ga0373955_0028721 | Ga0373955_0028721_864_1148 | 91 |
| 403 | 3300035410 | Ga0373924_0028077 | Ga0373924_0028077_265_561 | 91 |
| 404 | 3300035691 | Ga0373931_0018524 | Ga0373931_0018524_164_475 | 91 |
| 405 | 3300035692 | Ga0373935_0089335 | Ga0373935_0089335_690_986 | 91 |
| 406 | 3300035692 | Ga0373935_0090005 | Ga0373935_0090005_1117_1401 | 91 |
| 407 | 3300035695 | Ga0373927_0052651 | Ga0373927_0052651_1015_1299 | 91 |
| 408 | 3300035695 | Ga0373927_0588458 | Ga0373927_0588458_105_401 | 91 |
| 409 | 3300035724 | Ga0373933_0126906 | Ga0373933_0126906_773_1057 | 91 |
| 410 | 3300035724 | Ga0373933_0498813 | Ga0373933_0498813_415_711 | 91 |
| 411 | 3300035725 | Ga0373947_0036657 | Ga0373947_0036657_143_439 | 91 |
| 412 | 3300035725 | Ga0373947_0175004 | Ga0373947_0175004_600_884 | 91 |
| 413 | 3300035725 | Ga0373947_0259543 | Ga0373947_0259543_398_676 | 91 |
| 414 | 3300036401 | Ga0373937_0145982 | Ga0373937_0145982_964_1248 | 91 |
| 415 | 3300036401 | Ga0373937_0762235 | Ga0373937_0762235_579_857 | 91 |
| 416 | 3300036401 | Ga0373937_2055101 | Ga0373937_2055101_36_323 | 91 |
| 417 | 3300037068 | Ga0373925_0146321 | Ga0373925_0146321_1010_1294 | 91 |
| 418 | 3300037068 | Ga0373925_1072513 | Ga0373925_1072513_19_306 | 91 |
| 419 | 3300037312 | Ga0395899_0320952 | Ga0395899_0320952_165_458 | 91 |
| 420 | 3300037418 | Ga0395900_0367318 | Ga0395900_0367318_629_922 | 91 |
| 421 | 3300037418 | Ga0395900_1155716 | Ga0395900_1155716_55_366 | 91 |
| 422 | 3300037466 | Ga0395898_1401769 | Ga0395898_1401769_39_332 | 91 |
| 423 | 3300037853 | Ga0436364_0435690 | Ga0436364_0435690_97_381 | 91 |
| 424 | 3300037853 | Ga0436364_0572882 | Ga0436364_0572882_261_560 | 91 |
| 425 | 3300037853 | Ga0436364_1354648 | Ga0436364_1354648_50146_50436 | 91 |
| 426 | 3300037853 | Ga0436364_1385979 | Ga0436364_1385979_42_320 | 91 |
| 427 | 3300038443 | Ga0395901_0013538 | Ga0395901_0013538_4449_4760 | 91 |
| 428 | 3300038443 | Ga0395901_0042762 | Ga0395901_0042762_2473_2766 | 91 |
| 429 | 3300039437 | Ga0436365_0140149 | Ga0436365_0140149_211_495 | 91 |
| 430 | 3300039437 | Ga0436365_0323587 | Ga0436365_0323587_619_909 | 91 |
| 431 | 3300039437 | Ga0436365_0480233 | Ga0436365_0480233_361_660 | 91 |
| 432 | 3300039437 | Ga0436365_1206898 | Ga0436365_1206898_205_498 | 91 |
| 433 | 3300039438 | Ga0436360_0896384 | Ga0436360_0896384_372_647 | 91 |
| 434 | 3300039450 | Ga0436363_0420441 | Ga0436363_0420441_121_408 | 91 |
| 435 | 3300039450 | Ga0436363_0608057 | Ga0436363_0608057_560_853 | 91 |
| 436 | 3300039450 | Ga0436363_0984261 | Ga0436363_0984261_486_785 | 91 |
| 437 | 3300039450 | Ga0436363_1244160 | Ga0436363_1244160_867_1166 | 91 |
| 438 | 3300039453 | Ga0436362_0108632 | Ga0436362_0108632_266_568 | 91 |
| 439 | 3300041456 | Ga0451795_0116542 | Ga0451795_0116542_85_387 | 91 |
| 440 | 3300041462 | Ga0451806_416377 | Ga0451806_416377_253_537 | 91 |
| 441 | 3300041486 | Ga0451807_0540349 | Ga0451807_0540349_241_525 | 91 |
| 442 | 3300041491 | Ga0451833_0714288 | Ga0451833_0714288_1442_1744 | 91 |
| 443 | 3300041492 | Ga0451835_0428021 | Ga0451835_0428021_299_601 | 91 |
| 444 | 3300041496 | Ga0451839_0404311 | Ga0451839_0404311_716_1000 | 91 |
| 445 | 3300041502 | Ga0451846_22992 | Ga0451846_22992_17_301 | 91 |
| 446 | 3300041507 | Ga0451851_0106851 | Ga0451851_0106851_143_445 | 91 |
| 447 | 3300044656 | Ga0466969_0133478 | Ga0466969_0133478_131_415 | 91 |
| 448 | 3300044706 | Ga0466964_0401321 | Ga0466964_0401321_56_367 | 91 |
| 449 | 3300044706 | Ga0466964_0456857 | Ga0466964_0456857_90_389 | 91 |
| 450 | 3300044735 | Ga0466968_0174414 | Ga0466968_0174414_420_704 | 91 |
| 451 | 3300044735 | Ga0466968_0399061 | Ga0466968_0399061_327_614 | 91 |
| 452 | 3300044765 | Ga0466970_0019956 | Ga0466970_0019956_3062_3346 | 91 |
| 453 | 3300044842 | Ga0466957_0480171 | Ga0466957_0480171_42_353 | 91 |
| 454 | 3300044842 | Ga0466957_0687294 | Ga0466957_0687294_165_464 | 91 |
| 455 | 3300044842 | Ga0466957_1376465 | Ga0466957_1376465_154_465 | 91 |
| 456 | 3300044901 | Ga0466960_0783069 | Ga0466960_0783069_167_451 | 91 |
| 457 | 3300044901 | Ga0466960_0930207 | Ga0466960_0930207_63_377 | 91 |
| 458 | 3300045049 | Ga0466959_0500242 | Ga0466959_0500242_190_501 | 91 |
| 459 | 3300045836 | Ga0466958_0572110 | Ga0466958_0572110_264_563 | 91 |
| 460 | 3300045976 | Ga0466967_0304013 | Ga0466967_0304013_756_1049 | 91 |
| 461 | 3300045976 | Ga0466967_0374083 | Ga0466967_0374083_400_687 | 91 |
| 462 | 3300045976 | Ga0466967_1299720 | Ga0466967_1299720_115_405 | 91 |
| 463 | 3300046454 | Ga0495592_0252251 | Ga0495592_0252251_747_1031 | 91 |
| 464 | 3300046454 | Ga0495592_0296858 | Ga0495592_0296858_282_578 | 91 |
| 465 | 3300046455 | Ga0495603_0012499 | Ga0495603_0012499_3194_3478 | 91 |
| 466 | 3300046455 | Ga0495603_0287114 | Ga0495603_0287114_73_369 | 91 |
| 467 | 3300046459 | Ga0495629_0004222 | Ga0495629_0004222_9515_9799 | 91 |
| 468 | 3300046459 | Ga0495629_0029225 | Ga0495629_0029225_1709_1987 | 91 |
| 469 | 3300046459 | Ga0495629_0030557 | Ga0495629_0030557_3045_3341 | 91 |
| 470 | 3300046461 | Ga0495641_0009678 | Ga0495641_0009678_20_304 | 91 |
| 471 | 3300046461 | Ga0495641_0197520 | Ga0495641_0197520_546_842 | 91 |
| 472 | 3300046462 | Ga0495651_0029293 | Ga0495651_0029293_1999_2295 | 91 |
| 473 | 3300046462 | Ga0495651_0400254 | Ga0495651_0400254_472_756 | 91 |
| 474 | 3300046463 | Ga0495653_0035050 | Ga0495653_0035050_3045_3341 | 91 |
| 475 | 3300046463 | Ga0495653_0497819 | Ga0495653_0497819_192_479 | 91 |
| 476 | 3300046472 | Ga0495580_0035177 | Ga0495580_0035177_1648_1932 | 91 |
| 477 | 3300046473 | Ga0495582_0060469 | Ga0495582_0060469_571_855 | 91 |
| 478 | 3300046475 | Ga0495639_0042296 | Ga0495639_0042296_980_1264 | 91 |
| 479 | 3300046476 | Ga0495662_0027414 | Ga0495662_0027414_1814_2110 | 91 |
| 480 | 3300046476 | Ga0495662_0096283 | Ga0495662_0096283_384_668 | 91 |
| 481 | 3300046477 | Ga0495664_0030772 | Ga0495664_0030772_1189_1473 | 91 |
| 482 | 3300046477 | Ga0495664_0054637 | Ga0495664_0054637_142_432 | 91 |
| 483 | 3300046499 | Ga0495594_0018870 | Ga0495594_0018870_886_1170 | 91 |
| 484 | 3300046511 | Ga0495608_0054573 | Ga0495608_0054573_269_565 | 91 |
| 485 | 3300046514 | Ga0495618_0219548 | Ga0495618_0219548_282_578 | 91 |
| 486 | 3300046514 | Ga0495618_0309312 | Ga0495618_0309312_222_515 | 91 |
| 487 | 3300046516 | Ga0495628_0006081 | Ga0495628_0006081_227_511 | 91 |
| 488 | 3300046516 | Ga0495628_0055025 | Ga0495628_0055025_295_591 | 91 |
| 489 | 3300046517 | Ga0495630_0068032 | Ga0495630_0068032_1527_1811 | 91 |
| 490 | 3300046517 | Ga0495630_0071972 | Ga0495630_0071972_2196_2492 | 91 |
| 491 | 3300046517 | Ga0495630_0076460 | Ga0495630_0076460_1741_2019 | 91 |
| 492 | 3300046517 | Ga0495630_0469106 | Ga0495630_0469106_203_490 | 91 |
| 493 | 3300046517 | Ga0495630_1304177 | Ga0495630_1304177_215_511 | 91 |
| 494 | 3300046526 | Ga0495666_0018448 | Ga0495666_0018448_1701_1985 | 91 |
| 495 | 3300046526 | Ga0495666_0055478 | Ga0495666_0055478_1363_1659 | 91 |
| 496 | 3300046529 | Ga0495652_0071875 | Ga0495652_0071875_1462_1746 | 91 |
| 497 | 3300046529 | Ga0495652_0385050 | Ga0495652_0385050_347_640 | 91 |
| 498 | 3300046529 | Ga0495652_0405197 | Ga0495652_0405197_97_393 | 91 |
| 499 | 3300046530 | Ga0495654_0038516 | Ga0495654_0038516_136_420 | 91 |
| 500 | 3300046531 | Ga0495665_0003597 | Ga0495665_0003597_550_834 | 91 |
| 501 | 3300046531 | Ga0495665_0013245 | Ga0495665_0013245_1693_1989 | 91 |
| 502 | 3300046531 | Ga0495665_0221432 | Ga0495665_0221432_683_961 | 91 |
| 503 | 3300046533 | Ga0495640_0017469 | Ga0495640_0017469_597_893 | 91 |
| 504 | 3300046533 | Ga0495640_0035704 | Ga0495640_0035704_1714_1998 | 91 |
| 505 | 3300046533 | Ga0495640_0332618 | Ga0495640_0332618_236_529 | 91 |
| 506 | 3300046535 | Ga0495586_0048616 | Ga0495586_0048616_1306_1596 | 91 |
| 507 | 3300046535 | Ga0495586_0075382 | Ga0495586_0075382_686_970 | 91 |
| 508 | 3300046535 | Ga0495586_0312129 | Ga0495586_0312129_148_441 | 91 |
| 509 | 3300046536 | Ga0495587_0003443 | Ga0495587_0003443_5902_6198 | 91 |
| 510 | 3300046536 | Ga0495587_0062187 | Ga0495587_0062187_188_472 | 91 |
| 511 | 3300046538 | Ga0495609_0064473 | Ga0495609_0064473_1210_1494 | 91 |
| 512 | 3300046538 | Ga0495609_0409771 | Ga0495609_0409771_80_370 | 91 |
| 513 | 3300046543 | Ga0495645_0014290 | Ga0495645_0014290_5326_5610 | 91 |
| 514 | 3300046543 | Ga0495645_0086808 | Ga0495645_0086808_802_1098 | 91 |
| 515 | 3300046543 | Ga0495645_0362974 | Ga0495645_0362974_153_446 | 91 |
| 516 | 3300046557 | Ga0495622_0086097 | Ga0495622_0086097_663_947 | 91 |
| 517 | 3300046559 | Ga0495667_0070366 | Ga0495667_0070366_1527_1811 | 91 |
| 518 | 3300046559 | Ga0495667_0538953 | Ga0495667_0538953_269_565 | 91 |
| 519 | 3300046642 | Ga0495634_0005879 | Ga0495634_0005879_7824_8108 | 91 |
| 520 | 3300046663 | Ga0495635_0011012 | Ga0495635_0011012_5901_6197 | 91 |
| 521 | 3300046663 | Ga0495635_0077571 | Ga0495635_0077571_1520_1804 | 91 |
| 522 | 3300046663 | Ga0495635_0228522 | Ga0495635_0228522_175_462 | 91 |
| 523 | 3300046674 | Ga0495588_0021306 | Ga0495588_0021306_404_688 | 91 |
| 524 | 3300046674 | Ga0495588_0328147 | Ga0495588_0328147_489_785 | 91 |
| 525 | 3300046675 | Ga0495657_0041781 | Ga0495657_0041781_1349_1645 | 91 |
| 526 | 3300046675 | Ga0495657_0077614 | Ga0495657_0077614_994_1278 | 91 |
| 527 | 3300046678 | Ga0495599_0047758 | Ga0495599_0047758_1652_1936 | 91 |
| 528 | 3300046679 | Ga0495623_0012759 | Ga0495623_0012759_4877_5173 | 91 |
| 529 | 3300046679 | Ga0495623_0149018 | Ga0495623_0149018_227_511 | 91 |
| 530 | 3300046680 | Ga0495646_0038695 | Ga0495646_0038695_1140_1424 | 91 |
| 531 | 3300046680 | Ga0495646_0384343 | Ga0495646_0384343_295_591 | 91 |
| 532 | 3300046681 | Ga0495647_0005262 | Ga0495647_0005262_1038_1322 | 91 |
| 533 | 3300046683 | Ga0495658_0005793 | Ga0495658_0005793_511_795 | 91 |
| 534 | 3300046689 | Ga0495613_0017693 | Ga0495613_0017693_3635_3919 | 91 |
| 535 | 3300046689 | Ga0495613_0740839 | Ga0495613_0740839_269_565 | 91 |
| 536 | 3300046690 | Ga0495624_0109904 | Ga0495624_0109904_1262_1552 | 91 |
| 537 | 3300046690 | Ga0495624_0254591 | Ga0495624_0254591_758_1042 | 91 |
| 538 | 3300046809 | Ga0495600_0014591 | Ga0495600_0014591_950_1246 | 91 |
| 539 | 3300046809 | Ga0495600_0073987 | Ga0495600_0073987_227_511 | 91 |
| 540 | 3300046810 | Ga0495660_0466038 | Ga0495660_0466038_105_389 | 91 |
| 541 | 3300047315 | Ga0495581_0004893 | Ga0495581_0004893_3195_3479 | 91 |
| 542 | 3300047315 | Ga0495581_0031164 | Ga0495581_0031164_1980_2276 | 91 |
| 543 | 3300047317 | Ga0495604_0020620 | Ga0495604_0020620_2439_2735 | 91 |
| 544 | 3300047317 | Ga0495604_0064253 | Ga0495604_0064253_994_1278 | 91 |
| 545 | 3300047317 | Ga0495604_0495633 | Ga0495604_0495633_482_769 | 91 |
| 546 | 3300047319 | Ga0495674_0094452 | Ga0495674_0094452_747_1031 | 91 |
| 547 | 3300047319 | Ga0495674_0135270 | Ga0495674_0135270_111_407 | 91 |
| 548 | 3300047319 | Ga0495674_0443917 | Ga0495674_0443917_549_836 | 91 |
| 549 | 3300047321 | Ga0495676_0024236 | Ga0495676_0024236_2616_2900 | 91 |
| 550 | 3300047322 | Ga0495680_0070920 | Ga0495680_0070920_244_540 | 91 |
| 551 | 3300047322 | Ga0495680_0104622 | Ga0495680_0104622_1595_1879 | 91 |
| 552 | 3300047444 | Ga0495675_0029568 | Ga0495675_0029568_1326_1622 | 91 |
| 553 | 3300047471 | Ga0495684_0006411 | Ga0495684_0006411_1268_1552 | 91 |
| 554 | 3300047471 | Ga0495684_0099936 | Ga0495684_0099936_1326_1622 | 91 |
| 555 | 3300047471 | Ga0495684_0356971 | Ga0495684_0356971_560_847 | 91 |
| 556 | 3300047673 | Ga0495593_0003319 | Ga0495593_0003319_8613_8897 | 91 |
| 557 | 3300047673 | Ga0495593_0052222 | Ga0495593_0052222_1092_1388 | 91 |
| 558 | 3300048088 | Ga0495602_0024963 | Ga0495602_0024963_110_406 | 91 |
| 559 | 3300048088 | Ga0495602_0315327 | Ga0495602_0315327_109_393 | 91 |
| 560 | 3300048089 | Ga0495614_0013559 | Ga0495614_0013559_610_894 | 91 |
| 561 | 3300048089 | Ga0495614_0086727 | Ga0495614_0086727_1023_1319 | 91 |
| 562 | 3300048904 | Ga0496101_0123183 | Ga0496101_0123183_1255_1539 | 91 |
| 563 | 3300048904 | Ga0496101_0470043 | Ga0496101_0470043_626_937 | 91 |
| 564 | 3300048904 | Ga0496101_1448456 | Ga0496101_1448456_30_329 | 91 |
| 565 | 3300048905 | Ga0496102_0032510 | Ga0496102_0032510_984_1268 | 91 |
| 566 | 3300048905 | Ga0496102_0704893 | Ga0496102_0704893_290_583 | 91 |
| 567 | 3300048906 | Ga0496103_0114239 | Ga0496103_0114239_917_1201 | 91 |
| 568 | 3300048906 | Ga0496103_0448818 | Ga0496103_0448818_254_553 | 91 |
| 569 | 3300048907 | Ga0496104_0002018 | Ga0496104_0002018_15442_15735 | 91 |
| 570 | 3300048907 | Ga0496104_0189600 | Ga0496104_0189600_1251_1535 | 91 |
| 571 | 3300048908 | Ga0496105_0039800 | Ga0496105_0039800_1682_1975 | 91 |
| 572 | 3300048908 | Ga0496105_0182716 | Ga0496105_0182716_1372_1656 | 91 |
| 573 | 3300048909 | Ga0496106_0367768 | Ga0496106_0367768_110_403 | 91 |
| 574 | 3300048910 | Ga0496107_0715960 | Ga0496107_0715960_262_540 | 91 |
| 575 | 3300048911 | Ga0496108_0004105 | Ga0496108_0004105_5698_5997 | 91 |
| 576 | 3300048911 | Ga0496108_0546535 | Ga0496108_0546535_384_695 | 91 |
| 577 | 3300048912 | Ga0496109_0021226 | Ga0496109_0021226_37_330 | 91 |
| 578 | 3300048912 | Ga0496109_0853838 | Ga0496109_0853838_170_481 | 91 |
| 579 | 3300048913 | Ga0496110_0012736 | Ga0496110_0012736_4337_4636 | 91 |
| 580 | 3300048914 | Ga0496111_0089264 | Ga0496111_0089264_969_1268 | 91 |
| 581 | 3300048915 | Ga0496112_0421206 | Ga0496112_0421206_219_530 | 91 |
| 582 | 3300048915 | Ga0496112_1606780 | Ga0496112_1606780_232_510 | 91 |
| 583 | 3300048916 | Ga0496113_0078786 | Ga0496113_0078786_476_769 | 91 |
| 584 | 3300048916 | Ga0496113_0409731 | Ga0496113_0409731_272_556 | 91 |
| 585 | 3300048918 | Ga0496115_0215335 | Ga0496115_0215335_929_1207 | 91 |
| 586 | 3300048918 | Ga0496115_0418141 | Ga0496115_0418141_776_1057 | 91 |
| 587 | 3300048920 | Ga0496117_0004445 | Ga0496117_0004445_5020_5304 | 91 |
| 588 | 3300048921 | Ga0496118_0000116 | Ga0496118_0000116_140428_140712 | 91 |
| 589 | 3300048922 | Ga0496119_0037894 | Ga0496119_0037894_735_1019 | 91 |
| 590 | 3300048924 | Ga0496121_0161163 | Ga0496121_0161163_343_627 | 91 |
| 591 | 3300048925 | Ga0496122_0341832 | Ga0496122_0341832_29_313 | 91 |
| 592 | 3300048927 | Ga0496124_0000135 | Ga0496124_0000135_966_1250 | 91 |
| 593 | 3300048929 | Ga0496126_0243116 | Ga0496126_0243116_295_579 | 91 |
| 594 | 3300048929 | Ga0496126_0541537 | Ga0496126_0541537_317_598 | 91 |
| 595 | 3300049127 | Ga0501306_017897 | Ga0501306_017897_343_633 | 91 |
| 596 | 3300049130 | Ga0501310_018138 | Ga0501310_018138_181_477 | 91 |
| 597 | 3300049527 | Ga0501311_039132 | Ga0501311_039132_198_500 | 91 |
| 598 | 3300049527 | Ga0501311_097687 | Ga0501311_097687_219_494 | 91 |
| 599 | 3300049536 | Ga0501320_068869 | Ga0501320_068869_65_376 | 91 |
| 600 | 3300049539 | Ga0501323_027111 | Ga0501323_027111_372_662 | 91 |
| 601 | 3300049541 | Ga0501325_007622 | Ga0501325_007622_183_497 | 91 |
| 602 | 3300049585 | Ga0501069_0424064 | Ga0501069_0424064_141_437 | 91 |
| 603 | 3300050511 | nmdc:mga08y16_1932564_c1 | nmdc:mga08y16_1932564_c1_162_461 | 91 |
| 604 | 3300050512 | nmdc:mga0n895_156854_c1 | nmdc:mga0n895_156854_c1_213_506 | 91 |
| 605 | 3300050514 | nmdc:mga08x19_927337_c1 | nmdc:mga08x19_927337_c1_275_559 | 91 |
| 606 | 3300053077 | Ga0495601_0009796 | Ga0495601_0009796_4913_5197 | 91 |
| 607 | 3300053077 | Ga0495601_0803111 | Ga0495601_0803111_265_552 | 91 |
| 608 | 3300053078 | Ga0495612_0070859 | Ga0495612_0070859_461_757 | 91 |
| 609 | 3300053078 | Ga0495612_0082946 | Ga0495612_0082946_466_750 | 91 |
| 610 | 3300053084 | Ga0495595_0085328 | Ga0495595_0085328_1027_1311 | 91 |
| 611 | 3300053084 | Ga0495595_0100639 | Ga0495595_0100639_879_1175 | 91 |
| 612 | 3300053085 | Ga0495619_0012355 | Ga0495619_0012355_1486_1782 | 91 |
| 613 | 3300053085 | Ga0495619_0531700 | Ga0495619_0531700_78_356 | 91 |
| 614 | 3300053090 | Ga0500646_0075296 | Ga0500646_0075296_343_621 | 91 |
| 615 | 3300059477 | Ga0587084_019424 | Ga0587084_019424_698_982 | 91 |
| 616 | 3300059490 | Ga0587066_002515 | Ga0587066_002515_1090_1368 | 91 |
| 617 | 3300059490 | Ga0587066_077675 | Ga0587066_077675_159_494 | 91 |
| 618 | 3300059490 | Ga0587066_112134 | Ga0587066_112134_289_573 | 91 |
| 619 | 3300059492 | Ga0587073_0023027 | Ga0587073_0023027_664_948 | 91 |
| 620 | 3300059492 | Ga0587073_0032566 | Ga0587073_0032566_141_419 | 91 |
| 621 | 3300059493 | Ga0587077_001970 | Ga0587077_001970_715_993 | 91 |
| 622 | 3300059493 | Ga0587077_064514 | Ga0587077_064514_135_419 | 91 |
| 623 | 3300059503 | Ga0587080_001892 | Ga0587080_001892_1432_1710 | 91 |
| 624 | 3300059503 | Ga0587080_131587 | Ga0587080_131587_148_426 | 91 |
| 625 | 3300059504 | Ga0587082_003161 | Ga0587082_003161_1268_1546 | 91 |
| 626 | 3300059504 | Ga0587082_007851 | Ga0587082_007851_510_803 | 91 |
| 627 | 3300059504 | Ga0587082_094628 | Ga0587082_094628_330_623 | 91 |
| 628 | 3300059505 | Ga0587083_0002399 | Ga0587083_0002399_1610_1888 | 91 |
| 629 | 3300059506 | Ga0587085_149358 | Ga0587085_149358_214_507 | 91 |
| 630 | 3300059509 | Ga0587089_009457 | Ga0587089_009457_209_487 | 91 |
| 631 | 3300059509 | Ga0587089_111823 | Ga0587089_111823_155_439 | 91 |
| 632 | 3300059510 | Ga0587090_029027 | Ga0587090_029027_496_780 | 91 |
| 633 | 3300059511 | Ga0587091_002709 | Ga0587091_002709_1331_1609 | 91 |
| 634 | 3300059513 | Ga0587094_070829 | Ga0587094_070829_106_381 | 91 |
| 635 | 3300059604 | Ga0587098_000853 | Ga0587098_000853_703_981 | 91 |
| 636 | 3300059605 | Ga0587106_013260 | Ga0587106_013260_700_978 | 91 |
| 637 | 3300059622 | Ga0587099_000830 | Ga0587099_000830_1371_1649 | 91 |
| 638 | 3300059622 | Ga0587099_057804 | Ga0587099_057804_75_359 | 91 |
| 639 | 3300059626 | Ga0587115_012190 | Ga0587115_012190_70_348 | 91 |
| 640 | 3300059627 | Ga0587117_054093 | Ga0587117_054093_40_324 | 91 |
| 641 | 3300059628 | Ga0587122_001445 | Ga0587122_001445_181_459 | 91 |
| 642 | 3300059630 | Ga0587128_005236 | Ga0587128_005236_1118_1396 | 91 |
| 643 | 3300059630 | Ga0587128_043241 | Ga0587128_043241_75_356 | 91 |
| 644 | 3300059639 | Ga0587062_050706 | Ga0587062_050706_24_299 | 91 |
| 645 | 3300059640 | Ga0587067_002165 | Ga0587067_002165_261_539 | 91 |
| 646 | 3300059640 | Ga0587067_059736 | Ga0587067_059736_33_317 | 91 |
| 647 | 3300059641 | Ga0587068_004670 | Ga0587068_004670_643_921 | 91 |
| 648 | 3300059642 | Ga0587069_130416 | Ga0587069_130416_207_500 | 91 |
| 649 | 3300059643 | Ga0587072_006669 | Ga0587072_006669_548_826 | 91 |
| 650 | 3300059643 | Ga0587072_016702 | Ga0587072_016702_259_543 | 91 |
| 651 | 3300059644 | Ga0587075_018172 | Ga0587075_018172_690_974 | 91 |
| 652 | 3300059645 | Ga0587076_020339 | Ga0587076_020339_141_419 | 91 |
| 653 | 3300059646 | Ga0587078_034720 | Ga0587078_034720_342_635 | 91 |
| 654 | 3300059650 | Ga0587104_024499 | Ga0587104_024499_46_330 | 91 |
| 655 | 3300059652 | Ga0587107_001080 | Ga0587107_001080_803_1081 | 91 |
| 656 | 3300059654 | Ga0587110_030486 | Ga0587110_030486_199_483 | 91 |
| 657 | 3300059655 | Ga0587114_009012 | Ga0587114_009012_362_646 | 91 |
| 658 | 3300059659 | Ga0587120_020535 | Ga0587120_020535_230_508 | 91 |
| 659 | 3300060344 | Ga0587071_003160 | Ga0587071_003160_633_911 | 91 |
| 660 | 3300061719 | Ga0466962_0029867 | Ga0466962_0029867_1275_1586 | 91 |
| 661 | 3300061719 | Ga0466962_0167900 | Ga0466962_0167900_336_650 | 91 |
| 662 | iso_pu_bacteria | 2857733635 | 2857734538 | 91 |
| 663 | iso_pu_bacteria | 2932431166 | 2932432198 | 91 |
| 664 | iso_pu_bacteria | 2966924647 | 2966926529 | 91 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4v4b-assembly1.cif.gz_AQ | structure of the ribosomal 80s-eef2-sordarin complex from yeast obtained by docking atomic models for rna and protein components into a 11.7 a cryo-em map. | 0.8567 | 14 | 87 |
| 7pkq-assembly1.cif.gz_q | small subunit of the chlamydomonas reinhardtii mitoribosome | 0.832 | 16 | 91 |
| 7ane-assembly1.cif.gz_k | leishmania major mitochondrial ribosome | 0.8293 | 15 | 88 |
| 6z1p-assembly1.cif.gz_Bq | structure of the mitochondrial ribosome from tetrahymena thermophila | 0.8258 | 15 | 91 |
| 4v4b-assembly1.cif.gz_AQ | structure of the ribosomal 80s-eef2-sordarin complex from yeast obtained by docking atomic models for rna and protein components into a 11.7 a cryo-em map. | 0.8258 | 14 | 87 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q8ID56_26_114_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8713 | 15 | 91 | 2.40.50.140 |
| af_C6T0V9_1_79_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8322 | 14 | 91 | 2.40.50.140 |
| af_Q4E4R7_93_168_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8215 | 16 | 90 | 2.40.50.140 |
| af_Q9LHN1_1_100_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8163 | 14 | 91 | 2.40.50.140 |
| 5xyuQ00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8137 | 13 | 90 | 2.40.50.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7E4S8B2-F1-model_v4 | deleted | 0.8552 | 13 | 91 |
|
| AF-A0A496RHA2-F1-model_v4 | Small ribosomal subunit protein uS17 | 0.8533 | 13 | 91 |
GO:0003735
GO:0006412 GO:0019843 GO:0022627 |
| AF-A0A0F2J2M8-F1-model_v4 | deleted | 0.8516 | 13 | 90 |
|
| AF-A0A535DPF9-F1-model_v4 | Small ribosomal subunit protein uS17 | 0.8511 | 12 | 91 |
GO:0003735
GO:0006412 GO:0019843 GO:0022627 |
| AF-A0A1G8TMN1-F1-model_v4 | Small ribosomal subunit protein uS17 | 0.8463 | 12 | 91 |
GO:0003735
GO:0006412 GO:0019843 GO:0022627 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar