F473384

General Info

Members Datasets Scaffolds Average Seq Length
661 345 1322 147

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_101307772|Ga0070665_1013077721
Length 143
Sequence MSGTERIEQLARIMDLPGFPKSAGMRIVSAEPGKVTMALAKRPELTQFFGHFHGGVITALADHAACATSAMPDGKLAVTVEIKINFLSPADGDEMIARAESIQSGSTIGVVKVEVISLKAGAERVCAFATATMRAMDIPAAMA

Samples

Sample ID Description Type Environment
1 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
57 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
61 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
62 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
67 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
68 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
69 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
70 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
81 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
82 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
158 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
162 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
164 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
165 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
166 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
167 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
168 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
169 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
170 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
171 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
172 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
173 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
174 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
175 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
176 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
177 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
178 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
179 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
180 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
181 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
182 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
183 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
184 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
185 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
186 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
187 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
188 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
189 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
190 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
191 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
192 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
193 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
194 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
195 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
196 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
197 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
198 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
199 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
200 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
201 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
202 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
203 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
204 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
205 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
206 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
207 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
208 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
209 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
210 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
211 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
212 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
213 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
214 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
215 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
216 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
217 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
218 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
219 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
220 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
221 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
222 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
223 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
224 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
225 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
226 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
227 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
228 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
229 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
230 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
231 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
232 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
233 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
234 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
235 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
236 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
237 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
238 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
239 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
240 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
241 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
242 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
243 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
244 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
245 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
246 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
247 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
248 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
249 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
250 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
251 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
252 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
253 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
254 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
255 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
256 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
257 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
258 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
259 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
260 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
261 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
262 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
263 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
264 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
265 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
266 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
267 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
268 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
269 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
270 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
271 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
272 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
273 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
274 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
275 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
276 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
277 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
278 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
279 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
280 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
281 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
282 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
283 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
284 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
285 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
286 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
287 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
288 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
289 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
290 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
291 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
292 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
293 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
294 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
295 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
296 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
297 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
298 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
299 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
300 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
302 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
303 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
304 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
306 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
307 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
308 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
309 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
310 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
311 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
312 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
313 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
314 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
315 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
316 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
317 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
318 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
319 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
320 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
321 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
322 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
323 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
324 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
325 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
326 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
327 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
328 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
329 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
330 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
331 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
332 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
333 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
334 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
335 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
336 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
337 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
338 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
339 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
340 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
341 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
342 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
343 2791355199
344 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
345 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.55
Metatranscriptomes 0.15
Isolates 0.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.11
Nodule 0
Rhizoplane 6.96
Rhizosphere 82.9
Stem 0
Stem Tuber 0
Unclassified 0.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070665_101307772 3300005548 Bacteria 735
2 JGI24744J21845_10027956 3300002077 Bacteria 1088
3 JGI25406J46586_10009219 3300003203 Bacteria 4424
4 JGI25404J52841_10011080 3300003659 Bacteria 1941
5 Ga0065712_10443935 3300005290 Bacteria 686
6 Ga0070683_100442789 3300005329 Bacteria 1240
7 Ga0070670_101728108 3300005331 Bacteria 576
8 Ga0068869_101391462 3300005334 Bacteria 621
9 Ga0070682_101533669 3300005337 Bacteria 574
10 Ga0068868_100357896 3300005338 Bacteria 1251
11 Ga0070660_100279181 3300005339 Bacteria 1366
12 Ga0070661_100098698 3300005344 Bacteria 2169
13 Ga0070668_100217099 3300005347 Bacteria 1576
14 Ga0070668_100395154 3300005347 Bacteria 1179
15 Ga0070668_100677927 3300005347 Bacteria 907
16 Ga0070669_100297755 3300005353 Bacteria 1297
17 Ga0070675_100463508 3300005354 Bacteria 1138
18 Ga0070671_100306751 3300005355 Bacteria 1352
19 Ga0070671_100327040 3300005355 Bacteria 1307
20 Ga0070671_101203713 3300005355 Bacteria 667
21 Ga0070674_100229243 3300005356 Bacteria 1449
22 Ga0070674_100432490 3300005356 Bacteria 1082
23 Ga0070673_100472506 3300005364 Bacteria 1131
24 Ga0070673_100831365 3300005364 Bacteria 854
25 Ga0070673_101072621 3300005364 Bacteria 752
26 Ga0070659_100911092 3300005366 Bacteria 769
27 Ga0070667_100590526 3300005367 Bacteria 1023
28 Ga0070709_10003288 3300005434 Bacteria 8696
29 Ga0070714_100012219 3300005435 Bacteria 6848
30 Ga0070714_100317703 3300005435 Bacteria 1455
31 Ga0070714_100767045 3300005435 Bacteria 933
32 Ga0070713_100000559 3300005436 Bacteria 23621
33 Ga0070713_100081964 3300005436 Bacteria 2754
34 Ga0070713_100165569 3300005436 Bacteria 1977
35 Ga0070710_10001962 3300005437 Bacteria 9750
36 Ga0070710_10005604 3300005437 Bacteria 5980
37 Ga0070711_100006575 3300005439 Bacteria 7017
38 Ga0070711_100016872 3300005439 Bacteria 4642
39 Ga0070711_100121150 3300005439 Bacteria 1935
40 Ga0070700_100632624 3300005441 Bacteria 843
41 Ga0070663_100009634 3300005455 Bacteria 5990
42 Ga0070663_100162818 3300005455 Bacteria 1718
43 Ga0070663_100216067 3300005455 Bacteria 1503
44 Ga0070663_100224652 3300005455 Bacteria 1476
45 Ga0070663_100271374 3300005455 Bacteria 1349
46 Ga0070663_100901906 3300005455 Bacteria 763
47 Ga0070678_100287551 3300005456 Bacteria 1392
48 Ga0070678_101183780 3300005456 Bacteria 708
49 Ga0070662_100258339 3300005457 Bacteria 1403
50 Ga0070662_101317759 3300005457 Bacteria 621
51 Ga0070681_10905256 3300005458 Bacteria 801
52 Ga0068867_100463363 3300005459 Bacteria 1082
53 Ga0068867_100626509 3300005459 Bacteria 941
54 Ga0070698_100439462 3300005471 Bacteria 1240
55 Ga0070679_101587380 3300005530 Bacteria 602
56 Ga0070684_100114507 3300005535 Bacteria 2421
57 Ga0068853_100349657 3300005539 Bacteria 1375
58 Ga0068853_100872162 3300005539 Bacteria 864
59 Ga0070672_100762776 3300005543 Bacteria 849
60 Ga0070686_100121873 3300005544 Bacteria 1791
61 Ga0070693_100137937 3300005547 Bacteria 1532
62 Ga0070665_100043962 3300005548 Bacteria 4487
63 Ga0070665_100095074 3300005548 Bacteria 2984
64 Ga0070665_100759727 3300005548 Bacteria 982
65 Ga0070665_100791118 3300005548 Bacteria 961
66 Ga0070665_100855510 3300005548 Bacteria 922
67 Ga0070665_101499728 3300005548 Bacteria 683
68 Ga0068855_100236368 3300005563 Bacteria 2043
69 Ga0068855_101483882 3300005563 Bacteria 697
70 Ga0070664_100064803 3300005564 Bacteria 3117
71 Ga0068857_100091654 3300005577 Bacteria 2721
72 Ga0068854_100336763 3300005578 Bacteria 1231
73 Ga0068856_100001511 3300005614 Bacteria 24373
74 Ga0068856_100503106 3300005614 Bacteria 1233
75 Ga0070702_101320414 3300005615 Bacteria 586
76 Ga0068852_100265922 3300005616 Bacteria 1648
77 Ga0068852_100367922 3300005616 Bacteria 1408
78 Ga0068852_100386592 3300005616 Bacteria 1374
79 Ga0068852_101127599 3300005616 Bacteria 805
80 Ga0068859_100199849 3300005617 Bacteria 2084
81 Ga0068859_100701859 3300005617 Bacteria 1102
82 Ga0068864_100027456 3300005618 Bacteria 4808
83 Ga0068864_100759332 3300005618 Bacteria 951
84 Ga0068866_10184255 3300005718 Bacteria 1235
85 Ga0068861_101128994 3300005719 Bacteria 755
86 Ga0068870_11301095 3300005840 Bacteria 530
87 Ga0068863_100440562 3300005841 Bacteria 1278
88 Ga0068863_101526022 3300005841 Bacteria 677
89 Ga0068858_100764614 3300005842 Bacteria 942
90 Ga0068860_101008730 3300005843 Bacteria 850
91 Ga0068860_101215717 3300005843 Bacteria 774
92 Ga0068862_101083376 3300005844 Bacteria 796
93 Ga0068862_101263432 3300005844 Bacteria 739
94 Ga0081455_10004636 3300005937 Bacteria 15315
95 Ga0081455_10009128 3300005937 Bacteria 10230
96 Ga0081455_10058921 3300005937 Bacteria 3245
97 Ga0081455_10080191 3300005937 Bacteria 2677
98 Ga0081455_10619947 3300005937 Bacteria 702
99 Ga0081455_10938475 3300005937 Bacteria 537
100 Ga0081538_10040596 3300005981 Bacteria 2965
101 Ga0081540_1003043 3300005983 Bacteria 13431
102 Ga0081540_1003206 3300005983 Bacteria 13034
103 Ga0081540_1003514 3300005983 Bacteria 12369
104 Ga0081540_1004587 3300005983 Bacteria 10460
105 Ga0081540_1014352 3300005983 Bacteria 5078
106 Ga0081540_1031606 3300005983 Bacteria 2908
107 Ga0081540_1049286 3300005983 Bacteria 2102
108 Ga0081540_1125469 3300005983 Bacteria 1057
109 Ga0081539_10000948 3300005985 Bacteria 54410
110 Ga0081539_10139083 3300005985 Bacteria 1182
111 Ga0070717_10012804 3300006028 Bacteria 6405
112 Ga0070717_10018603 3300006028 Bacteria 5429
113 Ga0070717_11334129 3300006028 Bacteria 652
114 Ga0075365_10027833 3300006038 Bacteria 3600
115 Ga0075365_10914148 3300006038 Bacteria 619
116 Ga0075365_11012876 3300006038 Bacteria 585
117 Ga0075368_10328209 3300006042 Bacteria 663
118 Ga0075363_100003369 3300006048 Bacteria 6788
119 Ga0075364_10044950 3300006051 Bacteria 2873
120 Ga0070715_10006704 3300006163 Bacteria 3932
121 Ga0070715_10232821 3300006163 Bacteria 954
122 Ga0070716_100007828 3300006173 Bacteria 5281
123 Ga0070716_100807930 3300006173 Bacteria 727
124 Ga0070712_100020660 3300006175 Bacteria 4312
125 Ga0070712_100808012 3300006175 Bacteria 805
126 Ga0075362_10095065 3300006177 Bacteria 1387
127 Ga0075367_10001853 3300006178 Bacteria 9339
128 Ga0075369_10029442 3300006186 Bacteria 2306
129 Ga0075366_10088071 3300006195 Bacteria 1859
130 Ga0075366_10106290 3300006195 Bacteria 1687
131 Ga0097621_101282010 3300006237 Bacteria 692
132 Ga0075370_10262397 3300006353 Bacteria 1024
133 Ga0075428_100083453 3300006844 Bacteria 3486
134 Ga0075434_101615545 3300006871 Bacteria 657
135 Ga0075429_100262628 3300006880 Bacteria 1512
136 Ga0068865_100582292 3300006881 Bacteria 944
137 Ga0075436_100244424 3300006914 Bacteria 1277
138 Ga0075436_100454719 3300006914 Bacteria 933
139 Ga0097620_100199826 3300006931 Bacteria 2084
140 Ga0097620_100701887 3300006931 Bacteria 1102
141 Ga0075435_100732084 3300007076 Bacteria 860
142 Ga0099794_10246816 3300007265 Bacteria 920
143 Ga0099794_10396764 3300007265 Bacteria 720
144 Ga0099795_10111729 3300007788 Bacteria 1084
145 Ga0099795_10179707 3300007788 Bacteria 883
146 Ga0105250_10256512 3300009092 Bacteria 748
147 Ga0111539_10071608 3300009094 Bacteria 4090
148 Ga0105245_10158536 3300009098 Bacteria 2146
149 Ga0105245_10479206 3300009098 Bacteria 1257
150 Ga0105245_11746757 3300009098 Bacteria 675
151 Ga0105247_10036453 3300009101 Bacteria 2998
152 Ga0105247_10212734 3300009101 Bacteria 1305
153 Ga0105247_10302891 3300009101 Bacteria 1109
154 Ga0114129_10148417 3300009147 Bacteria 3211
155 Ga0105243_10961775 3300009148 Bacteria 854
156 Ga0105241_10119979 3300009174 Bacteria 2116
157 Ga0105241_10198664 3300009174 Bacteria 1673
158 Ga0105241_11089469 3300009174 Bacteria 752
159 Ga0105242_10191072 3300009176 Bacteria 1813
160 Ga0105242_10392353 3300009176 Bacteria 1293
161 Ga0105242_10914643 3300009176 Bacteria 878
162 Ga0105248_10385555 3300009177 Bacteria 1578
163 Ga0105248_10441557 3300009177 Bacteria 1466
164 Ga0105248_10543828 3300009177 Bacteria 1310
165 Ga0105248_11143817 3300009177 Bacteria 880
166 Ga0105248_11416527 3300009177 Bacteria 786
167 Ga0105237_10426390 3300009545 Bacteria 1332
168 Ga0105237_10544892 3300009545 Bacteria 1167
169 Ga0105237_10798177 3300009545 Bacteria 951
170 Ga0105237_11060079 3300009545 Bacteria 817
171 Ga0105238_11507552 3300009551 Bacteria 701
172 Ga0099796_10016728 3300010159 Bacteria 2171
173 Ga0099796_10102704 3300010159 Bacteria 1078
174 Ga0105239_10093006 3300010375 Bacteria 3329
175 Ga0105239_10288129 3300010375 Bacteria 1849
176 Ga0105239_10616642 3300010375 Bacteria 1238
177 Ga0105239_10747676 3300010375 Bacteria 1119
178 Ga0105246_10146283 3300011119 Bacteria 1783
179 Ga0157374_10486225 3300013296 Bacteria 1238
180 Ga0157374_10735039 3300013296 Bacteria 1001
181 Ga0157378_10375299 3300013297 Bacteria 1395
182 Ga0157378_11286090 3300013297 Bacteria 772
183 Ga0163162_10022557 3300013306 Bacteria 6205
184 Ga0163162_10728167 3300013306 Bacteria 1112
185 Ga0163162_10788803 3300013306 Bacteria 1068
186 Ga0163162_10836367 3300013306 Bacteria 1036
187 Ga0157375_10007139 3300013308 Bacteria 9762
188 Ga0157375_10269005 3300013308 Bacteria 1866
189 Ga0157375_10558804 3300013308 Bacteria 1306
190 Ga0157375_10584222 3300013308 Bacteria 1277
191 Ga0157375_10673533 3300013308 Bacteria 1189
192 Ga0157375_11343915 3300013308 Bacteria 841
193 Ga0163163_10042132 3300014325 Bacteria 4469
194 Ga0163163_10132509 3300014325 Bacteria 2533
195 Ga0163163_10862228 3300014325 Bacteria 969
196 Ga0157380_12352652 3300014326 Bacteria 598
197 Ga0182008_10249207 3300014497 Bacteria 916
198 Ga0157377_10601640 3300014745 Bacteria 784
199 Ga0157379_10215644 3300014968 Bacteria 1738
200 Ga0157379_10496239 3300014968 Bacteria 1131
201 Ga0157379_10678655 3300014968 Bacteria 966
202 Ga0157379_10880650 3300014968 Bacteria 848
203 Ga0157376_10002794 3300014969 Bacteria 11912
204 Ga0157376_10613398 3300014969 Bacteria 1084
205 Ga0157376_12874095 3300014969 Bacteria 521
206 Ga0163161_10308225 3300017792 Bacteria 1248
207 Ga0207697_10125364 3300025315 Bacteria 1107
208 Ga0207697_10150210 3300025315 Bacteria 1013
209 Ga0207692_10017380 3300025898 Bacteria 3207
210 Ga0207642_10122546 3300025899 Bacteria 1344
211 Ga0207642_10652636 3300025899 Bacteria 659
212 Ga0207710_10271449 3300025900 Bacteria 852
213 Ga0207688_10115910 3300025901 Bacteria 1559
214 Ga0207688_10158515 3300025901 Bacteria 1340
215 Ga0207685_10000869 3300025905 Bacteria 5697
216 Ga0207699_10017041 3300025906 Bacteria 3814
217 Ga0207645_10706632 3300025907 Bacteria 685
218 Ga0207654_10129814 3300025911 Bacteria 1594
219 Ga0207654_10153712 3300025911 Bacteria 1479
220 Ga0207654_10997209 3300025911 Unclassified 609
221 Ga0207707_10662820 3300025912 Bacteria 879
222 Ga0207671_10422475 3300025914 Bacteria 1060
223 Ga0207693_10000290 3300025915 Bacteria 46501
224 Ga0207693_10431663 3300025915 Bacteria 1030
225 Ga0207663_10000089 3300025916 Bacteria 43605
226 Ga0207663_10017567 3300025916 Bacteria 3989
227 Ga0207663_10265312 3300025916 Bacteria 1270
228 Ga0207681_10238287 3300025923 Bacteria 1415
229 Ga0207650_11241878 3300025925 Bacteria 634
230 Ga0207659_10758856 3300025926 Bacteria 832
231 Ga0207687_10020129 3300025927 Bacteria 4425
232 Ga0207687_10192440 3300025927 Bacteria 1589
233 Ga0207700_10003172 3300025928 Bacteria 9493
234 Ga0207700_10407542 3300025928 Bacteria 1192
235 Ga0207664_10163643 3300025929 Bacteria 1899
236 Ga0207664_10360489 3300025929 Bacteria 1288
237 Ga0207664_11433834 3300025929 Bacteria 611
238 Ga0207644_10416890 3300025931 Bacteria 1099
239 Ga0207644_11200479 3300025931 Bacteria 638
240 Ga0207706_10664742 3300025933 Bacteria 892
241 Ga0207686_10165297 3300025934 Bacteria 1555
242 Ga0207686_10226125 3300025934 Bacteria 1354
243 Ga0207709_10170820 3300025935 Bacteria 1526
244 Ga0207669_10099905 3300025937 Bacteria 1915
245 Ga0207669_10426063 3300025937 Bacteria 1045
246 Ga0207704_10470414 3300025938 Bacteria 1007
247 Ga0207704_10964246 3300025938 Bacteria 720
248 Ga0207665_10023671 3300025939 Bacteria 4045
249 Ga0207665_10209540 3300025939 Bacteria 1423
250 Ga0207665_10363473 3300025939 Bacteria 1095
251 Ga0207665_10584361 3300025939 Bacteria 871
252 Ga0207665_10725179 3300025939 Bacteria 782
253 Ga0207691_10487368 3300025940 Bacteria 1047
254 Ga0207711_10129793 3300025941 Bacteria 2259
255 Ga0207711_10169216 3300025941 Bacteria 1982
256 Ga0207689_10852801 3300025942 Bacteria 769
257 Ga0207661_10171144 3300025944 Bacteria 1891
258 Ga0207667_10672048 3300025949 Bacteria 1040
259 Ga0207651_10508386 3300025960 Bacteria 1042
260 Ga0207651_10557990 3300025960 Bacteria 997
261 Ga0207712_10021770 3300025961 Bacteria 4213
262 Ga0207668_10092230 3300025972 Bacteria 2228
263 Ga0207668_10214166 3300025972 Bacteria 1542
264 Ga0207668_10425651 3300025972 Bacteria 1128
265 Ga0207668_10519170 3300025972 Bacteria 1027
266 Ga0207668_10566185 3300025972 Bacteria 986
267 Ga0207668_10687860 3300025972 Bacteria 898
268 Ga0207668_11247758 3300025972 Bacteria 668
269 Ga0207640_10488261 3300025981 Bacteria 1023
270 Ga0207640_10647970 3300025981 Bacteria 900
271 Ga0207640_10743984 3300025981 Bacteria 845
272 Ga0207658_11159559 3300025986 Bacteria 706
273 Ga0207677_10848693 3300026023 Bacteria 820
274 Ga0207703_11016670 3300026035 Bacteria 795
275 Ga0207639_10067145 3300026041 Bacteria 2790
276 Ga0207639_10246117 3300026041 Bacteria 1557
277 Ga0207639_10360478 3300026041 Bacteria 1301
278 Ga0207639_11769089 3300026041 Bacteria 579
279 Ga0207678_10003578 3300026067 Bacteria 13971
280 Ga0207678_10039743 3300026067 Bacteria 4081
281 Ga0207678_10081360 3300026067 Bacteria 2772
282 Ga0207678_10178806 3300026067 Bacteria 1812
283 Ga0207678_10256813 3300026067 Bacteria 1497
284 Ga0207678_10400799 3300026067 Bacteria 1188
285 Ga0207708_10189964 3300026075 Bacteria 1634
286 Ga0207702_10001149 3300026078 Bacteria 27090
287 Ga0207702_10264923 3300026078 Bacteria 1619
288 Ga0207702_10436333 3300026078 Bacteria 1268
289 Ga0207641_11019477 3300026088 Bacteria 825
290 Ga0207648_10645945 3300026089 Bacteria 978
291 Ga0207674_10082404 3300026116 Bacteria 3218
292 Ga0207675_100345329 3300026118 Bacteria 1457
293 Ga0207675_100353346 3300026118 Bacteria 1441
294 Ga0207675_100677555 3300026118 Bacteria 1039
295 Ga0207675_101232807 3300026118 Bacteria 768
296 Ga0207683_10108406 3300026121 Bacteria 2485
297 Ga0207683_10152215 3300026121 Bacteria 2088
298 Ga0207683_10336722 3300026121 Bacteria 1383
299 Ga0207683_10399534 3300026121 Bacteria 1264
300 Ga0207683_11605960 3300026121 Bacteria 599
301 Ga0207698_11773591 3300026142 Bacteria 632
302 Ga0209179_1033524 3300027512 Bacteria 1062
303 Ga0209588_1013230 3300027671 Bacteria 2516
304 Ga0209813_10202967 3300027866 Bacteria 735
305 Ga0268266_10002294 3300028379 Bacteria 20753
306 Ga0268266_10033263 3300028379 Bacteria 4383
307 Ga0268266_10035022 3300028379 Bacteria 4270
308 Ga0268266_10095785 3300028379 Bacteria 2607
309 Ga0268266_11065426 3300028379 Bacteria 782
310 Ga0268266_12112362 3300028379 Unclassified 536
311 Ga0268265_10969826 3300028380 Bacteria 838
312 Ga0268265_11007018 3300028380 Bacteria 823
313 Ga0268264_10538517 3300028381 Bacteria 1144
314 Ga0307515_10548562 3300028794 Bacteria 766
315 Ga0265770_1031086 3300030878 Bacteria 894
316 Ga0265329_10154484 3300031242 Bacteria 744
317 Ga0307513_10256102 3300031456 Bacteria 1543
318 Ga0307509_10536944 3300031507 Bacteria 849
319 Ga0265342_10029539 3300031712 Bacteria 3403
320 Ga0307405_10057725 3300031731 Bacteria 2440
321 Ga0307405_10355187 3300031731 Bacteria 1132
322 Ga0307405_10538818 3300031731 Bacteria 942
323 Ga0307413_10498370 3300031824 Bacteria 977
324 Ga0307406_10317109 3300031901 Bacteria 1204
325 Ga0307406_11046660 3300031901 Bacteria 702
326 Ga0307412_10434153 3300031911 Bacteria 1078
327 Ga0307416_100847093 3300032002 Bacteria 1012
328 Ga0307415_100295770 3300032126 Bacteria 1339
329 Ga0307415_100530362 3300032126 Bacteria 1035
330 Ga0307510_10019455 3300033180 Bacteria 7967
331 Ga0373930_0191067 3300034816 Unclassified 529
332 Ga0373958_0030228 3300034819 Bacteria 1058
333 Ga0373926_0010355 3300035083 Bacteria 3124
334 Ga0373929_0044747 3300035085 Bacteria 995
335 Ga0373934_0006801 3300035086 Bacteria 4246
336 Ga0373934_0063300 3300035086 Bacteria 1475
337 Ga0373944_0022691 3300035089 Bacteria 1826
338 Ga0373949_0086033 3300035090 Bacteria 844
339 Ga0373923_0005122 3300035111 Bacteria 4426
340 Ga0373923_0017178 3300035111 Bacteria 2763
341 Ga0373923_0242534 3300035111 Bacteria 842
342 Ga0373932_0010637 3300035112 Bacteria 2231
343 Ga0373936_0011917 3300035113 Bacteria 3299
344 Ga0373936_0014808 3300035113 Bacteria 2985
345 Ga0373936_0176020 3300035113 Bacteria 937
346 Ga0373945_0003417 3300035116 Bacteria 4996
347 Ga0373953_0001917 3300035117 Bacteria 6171
348 Ga0373953_0003968 3300035117 Bacteria 4667
349 Ga0373954_0002155 3300035118 Bacteria 8173
350 Ga0373954_0013955 3300035118 Bacteria 3581
351 Ga0373954_0248142 3300035118 Bacteria 876
352 Ga0373956_0022295 3300035119 Bacteria 2709
353 Ga0373956_0034755 3300035119 Bacteria 2220
354 Ga0373957_0002756 3300035120 Bacteria 5054
355 Ga0373957_0108733 3300035120 Bacteria 1115
356 Ga0373957_0197088 3300035120 Bacteria 838
357 Ga0373943_0025901 3300035170 Bacteria 2743
358 Ga0373943_0045346 3300035170 Bacteria 2142
359 Ga0373946_0013616 3300035171 Bacteria 3059
360 Ga0373946_0043353 3300035171 Bacteria 1853
361 Ga0373955_0005073 3300035172 Bacteria 5890
362 Ga0373955_0021702 3300035172 Bacteria 3245
363 Ga0373955_0050028 3300035172 Bacteria 2271
364 Ga0373955_0918504 3300035172 Bacteria 539
365 Ga0373924_0023230 3300035410 Bacteria 2430
366 Ga0373924_0050821 3300035410 Bacteria 1717
367 Ga0373931_0005083 3300035691 Bacteria 6052
368 Ga0373935_0003860 3300035692 Bacteria 8747
369 Ga0373935_0013600 3300035692 Bacteria 4913
370 Ga0373935_0219652 3300035692 Bacteria 1320
371 Ga0373935_0477542 3300035692 Bacteria 903
372 Ga0373927_0001215 3300035695 Bacteria 19550
373 Ga0373927_0034424 3300035695 Bacteria 3294
374 Ga0373927_0352051 3300035695 Bacteria 970
375 Ga0373933_0010219 3300035724 Bacteria 5142
376 Ga0373933_0117008 3300035724 Bacteria 1666
377 Ga0373933_0197107 3300035724 Bacteria 1288
378 Ga0373947_0005027 3300035725 Bacteria 7744
379 Ga0373947_0071119 3300035725 Bacteria 2133
380 Ga0373937_0037593 3300036401 Bacteria 4412
381 Ga0373937_0065675 3300036401 Bacteria 3340
382 Ga0373937_0083546 3300036401 Bacteria 2954
383 Ga0373925_0004666 3300037068 Bacteria 10342
384 Ga0373925_0077130 3300037068 Bacteria 2528
385 Ga0373925_0523999 3300037068 Bacteria 974
386 Ga0373925_1612525 3300037068 Bacteria 530
387 Ga0436364_1004930 3300037853 Bacteria 1746
388 Ga0395901_0090589 3300038443 Bacteria 3201
389 Ga0436363_0706446 3300039450 Bacteria 1853
390 Ga0439466_0154291 3300041411 Bacteria 703
391 Ga0451793_1109345 3300041452 Bacteria 1591
392 Ga0451795_0238134 3300041456 Bacteria 547
393 Ga0451807_0824687 3300041486 Bacteria 704
394 Ga0439459_0181292 3300042438 Bacteria 566
395 Ga0466967_0424368 3300045976 Bacteria 1296
396 Ga0495592_0015219 3300046454 Bacteria 5841
397 Ga0495592_0055793 3300046454 Bacteria 2921
398 Ga0495592_0200463 3300046454 Bacteria 1347
399 Ga0495603_0002990 3300046455 Bacteria 10003
400 Ga0495603_0024004 3300046455 Bacteria 3689
401 Ga0495603_0043099 3300046455 Bacteria 2696
402 Ga0495603_0069785 3300046455 Bacteria 2067
403 Ga0495603_0422689 3300046455 Bacteria 763
404 Ga0495603_0455404 3300046455 Bacteria 733
405 Ga0495590_0354891 3300046457 Bacteria 558
406 Ga0495629_0000314 3300046459 Bacteria 41394
407 Ga0495629_0018707 3300046459 Bacteria 4951
408 Ga0495629_0127759 3300046459 Bacteria 1771
409 Ga0495629_0178014 3300046459 Bacteria 1474
410 Ga0495629_0871138 3300046459 Bacteria 591
411 Ga0495641_0050914 3300046461 Bacteria 1892
412 Ga0495651_0042082 3300046462 Bacteria 3547
413 Ga0495651_0547981 3300046462 Bacteria 735
414 Ga0495653_0007654 3300046463 Bacteria 8838
415 Ga0495653_0020112 3300046463 Bacteria 5411
416 Ga0495653_0410763 3300046463 Bacteria 858
417 Ga0495580_0017491 3300046472 Bacteria 5361
418 Ga0495580_0104589 3300046472 Bacteria 1967
419 Ga0495582_0000482 3300046473 Bacteria 21808
420 Ga0495582_0015117 3300046473 Bacteria 4245
421 Ga0495582_0035102 3300046473 Bacteria 2757
422 Ga0495605_0188210 3300046474 Bacteria 905
423 Ga0495639_0000223 3300046475 Bacteria 29083
424 Ga0495639_0013478 3300046475 Bacteria 3531
425 Ga0495639_0044727 3300046475 Bacteria 2002
426 Ga0495639_0052325 3300046475 Bacteria 1859
427 Ga0495639_0340520 3300046475 Bacteria 752
428 Ga0495662_0000991 3300046476 Bacteria 13895
429 Ga0495664_0014902 3300046477 Bacteria 4413
430 Ga0495664_0044331 3300046477 Bacteria 2636
431 Ga0495594_0001065 3300046499 Bacteria 14299
432 Ga0495594_0248485 3300046499 Bacteria 1013
433 Ga0495594_0637805 3300046499 Bacteria 603
434 Ga0495607_0351754 3300046501 Bacteria 680
435 Ga0495606_0065555 3300046507 Bacteria 2307
436 Ga0495606_0145324 3300046507 Bacteria 1397
437 Ga0495606_0312256 3300046507 Bacteria 848
438 Ga0495608_0011431 3300046511 Bacteria 6178
439 Ga0495616_0298599 3300046513 Bacteria 680
440 Ga0495616_0341397 3300046513 Bacteria 625
441 Ga0495618_0027642 3300046514 Bacteria 3531
442 Ga0495618_0080473 3300046514 Bacteria 2079
443 Ga0495628_0021488 3300046516 Bacteria 5307
444 Ga0495628_0147612 3300046516 Bacteria 1792
445 Ga0495630_0001168 3300046517 Bacteria 18138
446 Ga0495630_0038545 3300046517 Bacteria 3574
447 Ga0495631_0488648 3300046518 Bacteria 524
448 Ga0495644_0226807 3300046523 Bacteria 723
449 Ga0495666_0483661 3300046526 Bacteria 554
450 Ga0495652_0030194 3300046529 Bacteria 4755
451 Ga0495652_0041955 3300046529 Bacteria 3946
452 Ga0495665_0007947 3300046531 Bacteria 5751
453 Ga0495665_0009855 3300046531 Bacteria 5171
454 Ga0495640_0000308 3300046533 Bacteria 33750
455 Ga0495640_0020969 3300046533 Bacteria 4804
456 Ga0495640_0110421 3300046533 Bacteria 1797
457 Ga0495640_0446884 3300046533 Bacteria 790
458 Ga0495640_0692501 3300046533 Bacteria 612
459 Ga0495587_0025168 3300046536 Bacteria 3638
460 Ga0495587_0144465 3300046536 Bacteria 1357
461 Ga0495598_0175976 3300046537 Bacteria 761
462 Ga0495609_0350359 3300046538 Bacteria 596
463 Ga0495645_0052696 3300046543 Bacteria 2959
464 Ga0495645_0186855 3300046543 Bacteria 1415
465 Ga0495622_0007739 3300046557 Bacteria 4989
466 Ga0495622_0251338 3300046557 Bacteria 778
467 Ga0495633_0110944 3300046558 Bacteria 1272
468 Ga0495667_0024970 3300046559 Bacteria 4026
469 Ga0495667_0127485 3300046559 Bacteria 1642
470 Ga0495656_0356174 3300046615 Bacteria 759
471 Ga0495656_0404777 3300046615 Bacteria 714
472 Ga0495668_0167082 3300046616 Bacteria 1205
473 Ga0495668_0171025 3300046616 Bacteria 1190
474 Ga0495668_0452869 3300046616 Bacteria 706
475 Ga0495668_0570410 3300046616 Bacteria 625
476 Ga0495634_0001222 3300046642 Bacteria 23699
477 Ga0495634_0018370 3300046642 Bacteria 4978
478 Ga0495634_0036350 3300046642 Bacteria 3368
479 Ga0495634_0382336 3300046642 Bacteria 839
480 Ga0495611_0050998 3300046648 Bacteria 1864
481 Ga0495611_0252613 3300046648 Bacteria 817
482 Ga0495625_0259890 3300046660 Bacteria 1124
483 Ga0495625_0392101 3300046660 Bacteria 869
484 Ga0495625_0400816 3300046660 Bacteria 857
485 Ga0495635_0005711 3300046663 Bacteria 8669
486 Ga0495635_0014560 3300046663 Bacteria 5501
487 Ga0495635_0022622 3300046663 Bacteria 4380
488 Ga0495661_0250201 3300046665 Bacteria 905
489 Ga0495588_0174239 3300046674 Bacteria 1137
490 Ga0495588_0713005 3300046674 Bacteria 525
491 Ga0495657_0013294 3300046675 Bacteria 6077
492 Ga0495657_0101340 3300046675 Bacteria 1835
493 Ga0495599_0001492 3300046678 Bacteria 13445
494 Ga0495599_0267329 3300046678 Bacteria 1038
495 Ga0495623_0027390 3300046679 Bacteria 3666
496 Ga0495623_0315165 3300046679 Bacteria 860
497 Ga0495646_0021249 3300046680 Bacteria 4103
498 Ga0495646_0113789 3300046680 Bacteria 1538
499 Ga0495647_0000504 3300046681 Bacteria 11369
500 Ga0495647_0005407 3300046681 Bacteria 4183
501 Ga0495647_0142693 3300046681 Bacteria 1022
502 Ga0495658_0009399 3300046683 Bacteria 4872
503 Ga0495658_0129324 3300046683 Bacteria 1535
504 Ga0495658_0190269 3300046683 Bacteria 1276
505 Ga0495669_0083745 3300046684 Bacteria 1466
506 Ga0495669_0182441 3300046684 Bacteria 1001
507 Ga0495613_0015377 3300046689 Bacteria 5690
508 Ga0495613_0374745 3300046689 Bacteria 974
509 Ga0495624_0021505 3300046690 Bacteria 4276
510 Ga0495624_0085887 3300046690 Bacteria 1943
511 Ga0495624_0250712 3300046690 Bacteria 1071
512 Ga0495671_0542987 3300046692 Bacteria 554
513 Ga0495600_0015455 3300046809 Bacteria 4824
514 Ga0495600_0570216 3300046809 Bacteria 690
515 Ga0495581_0004876 3300047315 Bacteria 7761
516 Ga0495581_0008943 3300047315 Bacteria 5797
517 Ga0495581_0180597 3300047315 Bacteria 1234
518 Ga0495604_0132474 3300047317 Bacteria 1790
519 Ga0495604_0412005 3300047317 Bacteria 888
520 Ga0495674_0000375 3300047319 Bacteria 39876
521 Ga0495674_0007946 3300047319 Bacteria 10125
522 Ga0495674_0125598 3300047319 Bacteria 2165
523 Ga0495672_0024629 3300047320 Bacteria 3872
524 Ga0495672_0093855 3300047320 Bacteria 1642
525 Ga0495676_0045439 3300047321 Bacteria 3575
526 Ga0495676_0121331 3300047321 Bacteria 1901
527 Ga0495680_0022383 3300047322 Bacteria 5267
528 Ga0495680_0286394 3300047322 Bacteria 1160
529 Ga0495675_0040108 3300047444 Bacteria 2982
530 Ga0495677_0296059 3300047445 Bacteria 636
531 Ga0495685_058032 3300047447 Bacteria 1307
532 Ga0495673_0026085 3300047469 Bacteria 2799
533 Ga0495684_0004280 3300047471 Bacteria 11138
534 Ga0495684_0104622 3300047471 Bacteria 2139
535 Ga0495684_0140283 3300047471 Bacteria 1812
536 Ga0495686_0434653 3300047472 Bacteria 700
537 Ga0495593_0000375 3300047673 Bacteria 24653
538 Ga0495593_0010972 3300047673 Bacteria 5215
539 Ga0495593_0017032 3300047673 Bacteria 4090
540 Ga0495593_0102756 3300047673 Bacteria 1465
541 Ga0495593_0116555 3300047673 Bacteria 1361
542 Ga0495593_0544787 3300047673 Bacteria 582
543 Ga0495602_0041274 3300048088 Bacteria 4216
544 Ga0495602_0365427 3300048088 Bacteria 1038
545 Ga0495614_0007344 3300048089 Bacteria 4907
546 Ga0495614_0248688 3300048089 Bacteria 813
547 Ga0495615_0082702 3300048090 Bacteria 883
548 Ga0496100_0041105 3300048903 Bacteria 2945
549 Ga0496100_0736129 3300048903 Bacteria 771
550 Ga0496101_0118890 3300048904 Bacteria 1996
551 Ga0496102_0009041 3300048905 Bacteria 8549
552 Ga0496102_0032201 3300048905 Bacteria 4710
553 Ga0496102_0061528 3300048905 Bacteria 3436
554 Ga0496102_0397844 3300048905 Bacteria 1295
555 Ga0496102_0546708 3300048905 Bacteria 1081
556 Ga0496103_0021384 3300048906 Bacteria 3892
557 Ga0496103_0077436 3300048906 Bacteria 2087
558 Ga0496104_0062704 3300048907 Bacteria 3525
559 Ga0496104_0066685 3300048907 Bacteria 3417
560 Ga0496104_0133332 3300048907 Bacteria 2386
561 Ga0496105_0006307 3300048908 Bacteria 9112
562 Ga0496105_0043012 3300048908 Bacteria 3725
563 Ga0496105_0185391 3300048908 Bacteria 1703
564 Ga0496105_0630452 3300048908 Bacteria 829
565 Ga0496106_0037091 3300048909 Bacteria 3646
566 Ga0496106_0259918 3300048909 Bacteria 1389
567 Ga0496106_0405597 3300048909 Bacteria 1095
568 Ga0496107_0061439 3300048910 Bacteria 2720
569 Ga0496107_0099577 3300048910 Bacteria 2130
570 Ga0496107_0582170 3300048910 Bacteria 828
571 Ga0496107_0785087 3300048910 Bacteria 698
572 Ga0496108_0014189 3300048911 Bacteria 6500
573 Ga0496108_0288034 3300048911 Bacteria 1430
574 Ga0496108_0567950 3300048911 Bacteria 989
575 Ga0496109_0007007 3300048912 Bacteria 9510
576 Ga0496109_0190270 3300048912 Bacteria 1928
577 Ga0496110_0018228 3300048913 Bacteria 5883
578 Ga0496110_0919203 3300048913 Bacteria 781
579 Ga0496111_0135287 3300048914 Bacteria 1825
580 Ga0496111_0258381 3300048914 Bacteria 1292
581 Ga0496112_0046740 3300048915 Bacteria 4246
582 Ga0496112_0295226 3300048915 Bacteria 1566
583 Ga0496113_0006817 3300048916 Bacteria 7282
584 Ga0496113_0278828 3300048916 Bacteria 1336
585 Ga0496114_0186193 3300048917 Bacteria 1814
586 Ga0496114_0267689 3300048917 Bacteria 1505
587 Ga0496115_0002054 3300048918 Bacteria 14410
588 Ga0496115_0057455 3300048918 Bacteria 3130
589 Ga0496115_0118124 3300048918 Bacteria 2181
590 Ga0496115_0130616 3300048918 Bacteria 2070
591 Ga0496118_0064335 3300048921 Bacteria 2692
592 Ga0496118_0245390 3300048921 Bacteria 1022
593 Ga0496119_0184005 3300048922 Bacteria 1094
594 Ga0496121_0007070 3300048924 Bacteria 13627
595 Ga0496121_0376199 3300048924 Bacteria 938
596 Ga0496121_0615719 3300048924 Bacteria 667
597 Ga0496124_0582355 3300048927 Bacteria 732
598 Ga0496126_0060205 3300048929 Bacteria 3416
599 Ga0496126_0200338 3300048929 Bacteria 1686
600 Ga0496126_0663712 3300048929 Bacteria 814
601 Ga0496126_1019435 3300048929 Bacteria 620
602 Ga0501036_0525708 3300049572 Bacteria 984
603 Ga0501040_0373435 3300049576 Bacteria 1023
604 Ga0501042_0760191 3300049578 Bacteria 705
605 Ga0501069_0799912 3300049585 Bacteria 571
606 Ga0501080_1161561 3300049742 Bacteria 665
607 Ga0501035_0260937 3300049822 Bacteria 1469
608 Ga0501045_1316296 3300049824 Bacteria 526
609 nmdc:mga03683_9890_c1 3300050489 Bacteria 3406
610 nmdc:mga03n38_1250_c1 3300050490 Bacteria 7146
611 nmdc:mga03n38_289871_c1 3300050490 Bacteria 876
612 nmdc:mga00v17_214787_c1 3300050491 Bacteria 1245
613 nmdc:mga0yw44_328428_c1 3300050492 Bacteria 1028
614 nmdc:mga0yw44_369714_c1 3300050492 Bacteria 967
615 nmdc:mga0k408_161661_c1 3300050493 Bacteria 1334
616 nmdc:mga0k408_37711_c1 3300050493 Bacteria 2775
617 nmdc:mga06z11_134238_c1 3300050494 Bacteria 1393
618 nmdc:mga06z11_27688_c1 3300050494 Bacteria 2711
619 nmdc:mga04h51_293783_c1 3300050495 Bacteria 661
620 nmdc:mga07m45_18959_c1 3300050496 Bacteria 3723
621 nmdc:mga05p37_212372_c1 3300050507 Bacteria 2339
622 nmdc:mga09592_107698_c1 3300050508 Bacteria 2390
623 nmdc:mga0qj67_541062_c1 3300050509 Bacteria 934
624 nmdc:mga08y16_51663_c1 3300050511 Bacteria 4301
625 nmdc:mga0n895_489987_c1 3300050512 Bacteria 1239
626 nmdc:mga0rr50_1201578_c1 3300050513 Bacteria 644
627 nmdc:mga08x19_1022533_c1 3300050514 Unclassified 587
628 nmdc:mga0sz30_59536_c1 3300050516 Bacteria 1630
629 Ga0495601_0010984 3300053077 Bacteria 5408
630 Ga0495601_0056625 3300053077 Bacteria 2483
631 Ga0495601_0331013 3300053077 Bacteria 991
632 Ga0495612_0052847 3300053078 Bacteria 1672
633 Ga0495612_0334872 3300053078 Bacteria 682
634 Ga0500635_0019966 3300053080 Bacteria 2045
635 Ga0495595_0010022 3300053084 Bacteria 3930
636 Ga0495619_0007001 3300053085 Bacteria 7137
637 Ga0495619_0079927 3300053085 Bacteria 2200
638 Ga0495619_0309426 3300053085 Bacteria 1094
639 Ga0500578_0480812 3300053086 Bacteria 702
640 Ga0500646_0102967 3300053090 Bacteria 899
641 Ga0500651_0002491 3300053093 Bacteria 9753
642 Ga0500566_0057454 3300053094 Bacteria 2210
643 Ga0500641_0033424 3300053096 Bacteria 2041
644 Ga0500650_0147336 3300053098 Bacteria 1090
645 Ga0500554_001981 3300053102 Bacteria 3975
646 Ga0500595_002075 3300053119 Bacteria 10241
647 Ga0500595_013248 3300053119 Bacteria 3162
648 Ga0500595_082295 3300053119 Bacteria 940
649 Ga0500589_063593 3300053147 Bacteria 1685
650 Ga0500590_137584 3300053148 Bacteria 1121
651 Ga0500603_001021 3300053150 Bacteria 6589
652 Ga0500603_116110 3300053150 Bacteria 808
653 Ga0500616_0000028 3300053153 Bacteria 435722
654 Ga0500627_0145394 3300053158 Bacteria 1071
655 Ga0500636_0429533 3300053177 Bacteria 604
656 Ga0500637_0005466 3300053178 Bacteria 6151
657 Ga0500637_0248077 3300053178 Bacteria 994
658 Ga0500661_010598 3300055283 Bacteria 1677
659 2793077636
660 2889036934 2889033259 Bacteria 9099371
661 8006991572 8006984368 Bacteria 9651211
662 Ga0070665_101307772
663 JGI24744J21845_10027956
664 JGI25406J46586_10009219
665 JGI25404J52841_10011080
666 Ga0065712_10443935
667 Ga0070683_100442789
668 Ga0070670_101728108
669 Ga0068869_101391462
670 Ga0070682_101533669
671 Ga0068868_100357896
672 Ga0070660_100279181
673 Ga0070661_100098698
674 Ga0070668_100217099
675 Ga0070668_100395154
676 Ga0070668_100677927
677 Ga0070669_100297755
678 Ga0070675_100463508
679 Ga0070671_100306751
680 Ga0070671_100327040
681 Ga0070671_101203713
682 Ga0070674_100229243
683 Ga0070674_100432490
684 Ga0070673_100472506
685 Ga0070673_100831365
686 Ga0070673_101072621
687 Ga0070659_100911092
688 Ga0070667_100590526
689 Ga0070709_10003288
690 Ga0070714_100012219
691 Ga0070714_100317703
692 Ga0070714_100767045
693 Ga0070713_100000559
694 Ga0070713_100081964
695 Ga0070713_100165569
696 Ga0070710_10001962
697 Ga0070710_10005604
698 Ga0070711_100006575
699 Ga0070711_100016872
700 Ga0070711_100121150
701 Ga0070700_100632624
702 Ga0070663_100009634
703 Ga0070663_100162818
704 Ga0070663_100216067
705 Ga0070663_100224652
706 Ga0070663_100271374
707 Ga0070663_100901906
708 Ga0070678_100287551
709 Ga0070678_101183780
710 Ga0070662_100258339
711 Ga0070662_101317759
712 Ga0070681_10905256
713 Ga0068867_100463363
714 Ga0068867_100626509
715 Ga0070698_100439462
716 Ga0070679_101587380
717 Ga0070684_100114507
718 Ga0068853_100349657
719 Ga0068853_100872162
720 Ga0070672_100762776
721 Ga0070686_100121873
722 Ga0070693_100137937
723 Ga0070665_100043962
724 Ga0070665_100095074
725 Ga0070665_100759727
726 Ga0070665_100791118
727 Ga0070665_100855510
728 Ga0070665_101499728
729 Ga0068855_100236368
730 Ga0068855_101483882
731 Ga0070664_100064803
732 Ga0068857_100091654
733 Ga0068854_100336763
734 Ga0068856_100001511
735 Ga0068856_100503106
736 Ga0070702_101320414
737 Ga0068852_100265922
738 Ga0068852_100367922
739 Ga0068852_100386592
740 Ga0068852_101127599
741 Ga0068859_100199849
742 Ga0068859_100701859
743 Ga0068864_100027456
744 Ga0068864_100759332
745 Ga0068866_10184255
746 Ga0068861_101128994
747 Ga0068870_11301095
748 Ga0068863_100440562
749 Ga0068863_101526022
750 Ga0068858_100764614
751 Ga0068860_101008730
752 Ga0068860_101215717
753 Ga0068862_101083376
754 Ga0068862_101263432
755 Ga0081455_10004636
756 Ga0081455_10009128
757 Ga0081455_10058921
758 Ga0081455_10080191
759 Ga0081455_10619947
760 Ga0081455_10938475
761 Ga0081538_10040596
762 Ga0081540_1003043
763 Ga0081540_1003206
764 Ga0081540_1003514
765 Ga0081540_1004587
766 Ga0081540_1014352
767 Ga0081540_1031606
768 Ga0081540_1049286
769 Ga0081540_1125469
770 Ga0081539_10000948
771 Ga0081539_10139083
772 Ga0070717_10012804
773 Ga0070717_10018603
774 Ga0070717_11334129
775 Ga0075365_10027833
776 Ga0075365_10914148
777 Ga0075365_11012876
778 Ga0075368_10328209
779 Ga0075363_100003369
780 Ga0075364_10044950
781 Ga0070715_10006704
782 Ga0070715_10232821
783 Ga0070716_100007828
784 Ga0070716_100807930
785 Ga0070712_100020660
786 Ga0070712_100808012
787 Ga0075362_10095065
788 Ga0075367_10001853
789 Ga0075369_10029442
790 Ga0075366_10088071
791 Ga0075366_10106290
792 Ga0097621_101282010
793 Ga0075370_10262397
794 Ga0075428_100083453
795 Ga0075434_101615545
796 Ga0075429_100262628
797 Ga0068865_100582292
798 Ga0075436_100244424
799 Ga0075436_100454719
800 Ga0097620_100199826
801 Ga0097620_100701887
802 Ga0075435_100732084
803 Ga0099794_10246816
804 Ga0099794_10396764
805 Ga0099795_10111729
806 Ga0099795_10179707
807 Ga0105250_10256512
808 Ga0111539_10071608
809 Ga0105245_10158536
810 Ga0105245_10479206
811 Ga0105245_11746757
812 Ga0105247_10036453
813 Ga0105247_10212734
814 Ga0105247_10302891
815 Ga0114129_10148417
816 Ga0105243_10961775
817 Ga0105241_10119979
818 Ga0105241_10198664
819 Ga0105241_11089469
820 Ga0105242_10191072
821 Ga0105242_10392353
822 Ga0105242_10914643
823 Ga0105248_10385555
824 Ga0105248_10441557
825 Ga0105248_10543828
826 Ga0105248_11143817
827 Ga0105248_11416527
828 Ga0105237_10426390
829 Ga0105237_10544892
830 Ga0105237_10798177
831 Ga0105237_11060079
832 Ga0105238_11507552
833 Ga0099796_10016728
834 Ga0099796_10102704
835 Ga0105239_10093006
836 Ga0105239_10288129
837 Ga0105239_10616642
838 Ga0105239_10747676
839 Ga0105246_10146283
840 Ga0157374_10486225
841 Ga0157374_10735039
842 Ga0157378_10375299
843 Ga0157378_11286090
844 Ga0163162_10022557
845 Ga0163162_10728167
846 Ga0163162_10788803
847 Ga0163162_10836367
848 Ga0157375_10007139
849 Ga0157375_10269005
850 Ga0157375_10558804
851 Ga0157375_10584222
852 Ga0157375_10673533
853 Ga0157375_11343915
854 Ga0163163_10042132
855 Ga0163163_10132509
856 Ga0163163_10862228
857 Ga0157380_12352652
858 Ga0182008_10249207
859 Ga0157377_10601640
860 Ga0157379_10215644
861 Ga0157379_10496239
862 Ga0157379_10678655
863 Ga0157379_10880650
864 Ga0157376_10002794
865 Ga0157376_10613398
866 Ga0157376_12874095
867 Ga0163161_10308225
868 Ga0207697_10125364
869 Ga0207697_10150210
870 Ga0207692_10017380
871 Ga0207642_10122546
872 Ga0207642_10652636
873 Ga0207710_10271449
874 Ga0207688_10115910
875 Ga0207688_10158515
876 Ga0207685_10000869
877 Ga0207699_10017041
878 Ga0207645_10706632
879 Ga0207654_10129814
880 Ga0207654_10153712
881 Ga0207654_10997209
882 Ga0207707_10662820
883 Ga0207671_10422475
884 Ga0207693_10000290
885 Ga0207693_10431663
886 Ga0207663_10000089
887 Ga0207663_10017567
888 Ga0207663_10265312
889 Ga0207681_10238287
890 Ga0207650_11241878
891 Ga0207659_10758856
892 Ga0207687_10020129
893 Ga0207687_10192440
894 Ga0207700_10003172
895 Ga0207700_10407542
896 Ga0207664_10163643
897 Ga0207664_10360489
898 Ga0207664_11433834
899 Ga0207644_10416890
900 Ga0207644_11200479
901 Ga0207706_10664742
902 Ga0207686_10165297
903 Ga0207686_10226125
904 Ga0207709_10170820
905 Ga0207669_10099905
906 Ga0207669_10426063
907 Ga0207704_10470414
908 Ga0207704_10964246
909 Ga0207665_10023671
910 Ga0207665_10209540
911 Ga0207665_10363473
912 Ga0207665_10584361
913 Ga0207665_10725179
914 Ga0207691_10487368
915 Ga0207711_10129793
916 Ga0207711_10169216
917 Ga0207689_10852801
918 Ga0207661_10171144
919 Ga0207667_10672048
920 Ga0207651_10508386
921 Ga0207651_10557990
922 Ga0207712_10021770
923 Ga0207668_10092230
924 Ga0207668_10214166
925 Ga0207668_10425651
926 Ga0207668_10519170
927 Ga0207668_10566185
928 Ga0207668_10687860
929 Ga0207668_11247758
930 Ga0207640_10488261
931 Ga0207640_10647970
932 Ga0207640_10743984
933 Ga0207658_11159559
934 Ga0207677_10848693
935 Ga0207703_11016670
936 Ga0207639_10067145
937 Ga0207639_10246117
938 Ga0207639_10360478
939 Ga0207639_11769089
940 Ga0207678_10003578
941 Ga0207678_10039743
942 Ga0207678_10081360
943 Ga0207678_10178806
944 Ga0207678_10256813
945 Ga0207678_10400799
946 Ga0207708_10189964
947 Ga0207702_10001149
948 Ga0207702_10264923
949 Ga0207702_10436333
950 Ga0207641_11019477
951 Ga0207648_10645945
952 Ga0207674_10082404
953 Ga0207675_100345329
954 Ga0207675_100353346
955 Ga0207675_100677555
956 Ga0207675_101232807
957 Ga0207683_10108406
958 Ga0207683_10152215
959 Ga0207683_10336722
960 Ga0207683_10399534
961 Ga0207683_11605960
962 Ga0207698_11773591
963 Ga0209179_1033524
964 Ga0209588_1013230
965 Ga0209813_10202967
966 Ga0268266_10002294
967 Ga0268266_10033263
968 Ga0268266_10035022
969 Ga0268266_10095785
970 Ga0268266_11065426
971 Ga0268266_12112362
972 Ga0268265_10969826
973 Ga0268265_11007018
974 Ga0268264_10538517
975 Ga0307515_10548562
976 Ga0265770_1031086
977 Ga0265329_10154484
978 Ga0307513_10256102
979 Ga0307509_10536944
980 Ga0265342_10029539
981 Ga0307405_10057725
982 Ga0307405_10355187
983 Ga0307405_10538818
984 Ga0307413_10498370
985 Ga0307406_10317109
986 Ga0307406_11046660
987 Ga0307412_10434153
988 Ga0307416_100847093
989 Ga0307415_100295770
990 Ga0307415_100530362
991 Ga0307510_10019455
992 Ga0373930_0191067
993 Ga0373958_0030228
994 Ga0373926_0010355
995 Ga0373929_0044747
996 Ga0373934_0006801
997 Ga0373934_0063300
998 Ga0373944_0022691
999 Ga0373949_0086033
1000 Ga0373923_0005122
1001 Ga0373923_0017178
1002 Ga0373923_0242534
1003 Ga0373932_0010637
1004 Ga0373936_0011917
1005 Ga0373936_0014808
1006 Ga0373936_0176020
1007 Ga0373945_0003417
1008 Ga0373953_0001917
1009 Ga0373953_0003968
1010 Ga0373954_0002155
1011 Ga0373954_0013955
1012 Ga0373954_0248142
1013 Ga0373956_0022295
1014 Ga0373956_0034755
1015 Ga0373957_0002756
1016 Ga0373957_0108733
1017 Ga0373957_0197088
1018 Ga0373943_0025901
1019 Ga0373943_0045346
1020 Ga0373946_0013616
1021 Ga0373946_0043353
1022 Ga0373955_0005073
1023 Ga0373955_0021702
1024 Ga0373955_0050028
1025 Ga0373955_0918504
1026 Ga0373924_0023230
1027 Ga0373924_0050821
1028 Ga0373931_0005083
1029 Ga0373935_0003860
1030 Ga0373935_0013600
1031 Ga0373935_0219652
1032 Ga0373935_0477542
1033 Ga0373927_0001215
1034 Ga0373927_0034424
1035 Ga0373927_0352051
1036 Ga0373933_0010219
1037 Ga0373933_0117008
1038 Ga0373933_0197107
1039 Ga0373947_0005027
1040 Ga0373947_0071119
1041 Ga0373937_0037593
1042 Ga0373937_0065675
1043 Ga0373937_0083546
1044 Ga0373925_0004666
1045 Ga0373925_0077130
1046 Ga0373925_0523999
1047 Ga0373925_1612525
1048 Ga0436364_1004930
1049 Ga0395901_0090589
1050 Ga0436363_0706446
1051 Ga0439466_0154291
1052 Ga0451793_1109345
1053 Ga0451795_0238134
1054 Ga0451807_0824687
1055 Ga0439459_0181292
1056 Ga0466967_0424368
1057 Ga0495592_0015219
1058 Ga0495592_0055793
1059 Ga0495592_0200463
1060 Ga0495603_0002990
1061 Ga0495603_0024004
1062 Ga0495603_0043099
1063 Ga0495603_0069785
1064 Ga0495603_0422689
1065 Ga0495603_0455404
1066 Ga0495590_0354891
1067 Ga0495629_0000314
1068 Ga0495629_0018707
1069 Ga0495629_0127759
1070 Ga0495629_0178014
1071 Ga0495629_0871138
1072 Ga0495641_0050914
1073 Ga0495651_0042082
1074 Ga0495651_0547981
1075 Ga0495653_0007654
1076 Ga0495653_0020112
1077 Ga0495653_0410763
1078 Ga0495580_0017491
1079 Ga0495580_0104589
1080 Ga0495582_0000482
1081 Ga0495582_0015117
1082 Ga0495582_0035102
1083 Ga0495605_0188210
1084 Ga0495639_0000223
1085 Ga0495639_0013478
1086 Ga0495639_0044727
1087 Ga0495639_0052325
1088 Ga0495639_0340520
1089 Ga0495662_0000991
1090 Ga0495664_0014902
1091 Ga0495664_0044331
1092 Ga0495594_0001065
1093 Ga0495594_0248485
1094 Ga0495594_0637805
1095 Ga0495607_0351754
1096 Ga0495606_0065555
1097 Ga0495606_0145324
1098 Ga0495606_0312256
1099 Ga0495608_0011431
1100 Ga0495616_0298599
1101 Ga0495616_0341397
1102 Ga0495618_0027642
1103 Ga0495618_0080473
1104 Ga0495628_0021488
1105 Ga0495628_0147612
1106 Ga0495630_0001168
1107 Ga0495630_0038545
1108 Ga0495631_0488648
1109 Ga0495644_0226807
1110 Ga0495666_0483661
1111 Ga0495652_0030194
1112 Ga0495652_0041955
1113 Ga0495665_0007947
1114 Ga0495665_0009855
1115 Ga0495640_0000308
1116 Ga0495640_0020969
1117 Ga0495640_0110421
1118 Ga0495640_0446884
1119 Ga0495640_0692501
1120 Ga0495587_0025168
1121 Ga0495587_0144465
1122 Ga0495598_0175976
1123 Ga0495609_0350359
1124 Ga0495645_0052696
1125 Ga0495645_0186855
1126 Ga0495622_0007739
1127 Ga0495622_0251338
1128 Ga0495633_0110944
1129 Ga0495667_0024970
1130 Ga0495667_0127485
1131 Ga0495656_0356174
1132 Ga0495656_0404777
1133 Ga0495668_0167082
1134 Ga0495668_0171025
1135 Ga0495668_0452869
1136 Ga0495668_0570410
1137 Ga0495634_0001222
1138 Ga0495634_0018370
1139 Ga0495634_0036350
1140 Ga0495634_0382336
1141 Ga0495611_0050998
1142 Ga0495611_0252613
1143 Ga0495625_0259890
1144 Ga0495625_0392101
1145 Ga0495625_0400816
1146 Ga0495635_0005711
1147 Ga0495635_0014560
1148 Ga0495635_0022622
1149 Ga0495661_0250201
1150 Ga0495588_0174239
1151 Ga0495588_0713005
1152 Ga0495657_0013294
1153 Ga0495657_0101340
1154 Ga0495599_0001492
1155 Ga0495599_0267329
1156 Ga0495623_0027390
1157 Ga0495623_0315165
1158 Ga0495646_0021249
1159 Ga0495646_0113789
1160 Ga0495647_0000504
1161 Ga0495647_0005407
1162 Ga0495647_0142693
1163 Ga0495658_0009399
1164 Ga0495658_0129324
1165 Ga0495658_0190269
1166 Ga0495669_0083745
1167 Ga0495669_0182441
1168 Ga0495613_0015377
1169 Ga0495613_0374745
1170 Ga0495624_0021505
1171 Ga0495624_0085887
1172 Ga0495624_0250712
1173 Ga0495671_0542987
1174 Ga0495600_0015455
1175 Ga0495600_0570216
1176 Ga0495581_0004876
1177 Ga0495581_0008943
1178 Ga0495581_0180597
1179 Ga0495604_0132474
1180 Ga0495604_0412005
1181 Ga0495674_0000375
1182 Ga0495674_0007946
1183 Ga0495674_0125598
1184 Ga0495672_0024629
1185 Ga0495672_0093855
1186 Ga0495676_0045439
1187 Ga0495676_0121331
1188 Ga0495680_0022383
1189 Ga0495680_0286394
1190 Ga0495675_0040108
1191 Ga0495677_0296059
1192 Ga0495685_058032
1193 Ga0495673_0026085
1194 Ga0495684_0004280
1195 Ga0495684_0104622
1196 Ga0495684_0140283
1197 Ga0495686_0434653
1198 Ga0495593_0000375
1199 Ga0495593_0010972
1200 Ga0495593_0017032
1201 Ga0495593_0102756
1202 Ga0495593_0116555
1203 Ga0495593_0544787
1204 Ga0495602_0041274
1205 Ga0495602_0365427
1206 Ga0495614_0007344
1207 Ga0495614_0248688
1208 Ga0495615_0082702
1209 Ga0496100_0041105
1210 Ga0496100_0736129
1211 Ga0496101_0118890
1212 Ga0496102_0009041
1213 Ga0496102_0032201
1214 Ga0496102_0061528
1215 Ga0496102_0397844
1216 Ga0496102_0546708
1217 Ga0496103_0021384
1218 Ga0496103_0077436
1219 Ga0496104_0062704
1220 Ga0496104_0066685
1221 Ga0496104_0133332
1222 Ga0496105_0006307
1223 Ga0496105_0043012
1224 Ga0496105_0185391
1225 Ga0496105_0630452
1226 Ga0496106_0037091
1227 Ga0496106_0259918
1228 Ga0496106_0405597
1229 Ga0496107_0061439
1230 Ga0496107_0099577
1231 Ga0496107_0582170
1232 Ga0496107_0785087
1233 Ga0496108_0014189
1234 Ga0496108_0288034
1235 Ga0496108_0567950
1236 Ga0496109_0007007
1237 Ga0496109_0190270
1238 Ga0496110_0018228
1239 Ga0496110_0919203
1240 Ga0496111_0135287
1241 Ga0496111_0258381
1242 Ga0496112_0046740
1243 Ga0496112_0295226
1244 Ga0496113_0006817
1245 Ga0496113_0278828
1246 Ga0496114_0186193
1247 Ga0496114_0267689
1248 Ga0496115_0002054
1249 Ga0496115_0057455
1250 Ga0496115_0118124
1251 Ga0496115_0130616
1252 Ga0496118_0064335
1253 Ga0496118_0245390
1254 Ga0496119_0184005
1255 Ga0496121_0007070
1256 Ga0496121_0376199
1257 Ga0496121_0615719
1258 Ga0496124_0582355
1259 Ga0496126_0060205
1260 Ga0496126_0200338
1261 Ga0496126_0663712
1262 Ga0496126_1019435
1263 Ga0501036_0525708
1264 Ga0501040_0373435
1265 Ga0501042_0760191
1266 Ga0501069_0799912
1267 Ga0501080_1161561
1268 Ga0501035_0260937
1269 Ga0501045_1316296
1270 nmdc:mga03683_9890_c1
1271 nmdc:mga03n38_1250_c1
1272 nmdc:mga03n38_289871_c1
1273 nmdc:mga00v17_214787_c1
1274 nmdc:mga0yw44_328428_c1
1275 nmdc:mga0yw44_369714_c1
1276 nmdc:mga0k408_161661_c1
1277 nmdc:mga0k408_37711_c1
1278 nmdc:mga06z11_134238_c1
1279 nmdc:mga06z11_27688_c1
1280 nmdc:mga04h51_293783_c1
1281 nmdc:mga07m45_18959_c1
1282 nmdc:mga05p37_212372_c1
1283 nmdc:mga09592_107698_c1
1284 nmdc:mga0qj67_541062_c1
1285 nmdc:mga08y16_51663_c1
1286 nmdc:mga0n895_489987_c1
1287 nmdc:mga0rr50_1201578_c1
1288 nmdc:mga08x19_1022533_c1
1289 nmdc:mga0sz30_59536_c1
1290 Ga0495601_0010984
1291 Ga0495601_0056625
1292 Ga0495601_0331013
1293 Ga0495612_0052847
1294 Ga0495612_0334872
1295 Ga0500635_0019966
1296 Ga0495595_0010022
1297 Ga0495619_0007001
1298 Ga0495619_0079927
1299 Ga0495619_0309426
1300 Ga0500578_0480812
1301 Ga0500646_0102967
1302 Ga0500651_0002491
1303 Ga0500566_0057454
1304 Ga0500641_0033424
1305 Ga0500650_0147336
1306 Ga0500554_001981
1307 Ga0500595_002075
1308 Ga0500595_013248
1309 Ga0500595_082295
1310 Ga0500589_063593
1311 Ga0500590_137584
1312 Ga0500603_001021
1313 Ga0500603_116110
1314 Ga0500616_0000028
1315 Ga0500627_0145394
1316 Ga0500636_0429533
1317 Ga0500637_0005466
1318 Ga0500637_0248077
1319 Ga0500661_010598
1320 2793077636
1321 2889036934
1322 8006991572

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03061

4HBT

Thioesterase superfamily

49

123

0.93

PF13622

4HBT_3

Acyl-CoA thioesterase N-terminal domain

43

134

0.87

PF14539

DUF4442

Domain of unknown function (DUF4442)

5

135

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
3nwz-assembly3.cif.gz_D crystal structure of bh2602 protein from bacillus halodurans with coa, northeast structural genomics consortium target bhr199 0.952 38 139
3e1e-assembly1.cif.gz_B crystal structure of a thioesterase family protein from silicibacter pomeroyi. northeast structural genomics target sir180a 0.9465 10 141
1zki-assembly1.cif.gz_B structure of conserved protein pa5202 from pseudomonas aeruginosa 0.9357 18 139
3dkz-assembly1.cif.gz_A crystal structure of the q7w9w5_borpa protein from bordetella parapertussis. northeast structural genomics consortium target bpr208c. 0.9326 20 140
2dsl-assembly1.cif.gz_A mutant n33d structure of phenylacetic acid degradation protein paai from thermus thermophilus hb8 0.9134 20 137
ID Description Score Start End Superfamily
3e1eD00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9471 10 141 3.10.129.10
3dkzB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9145 18 139 3.10.129.10
1zkiB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9144 15 139 3.10.129.10
1wluA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9088 20 137 3.10.129.10
4m20A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9076 18 138 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A154C2X0-F1-model_v4 deleted 0.9852 20 142
AF-A0A2K9JQD3-F1-model_v4 deleted 0.9824 24 140
AF-A0A6M1UQD8-F1-model_v4 deleted 0.9813 21 140
AF-A0A7V9UPY1-F1-model_v4 Medium/long-chain acyl-CoA thioesterase YigI (EC 3.1.2.20) 0.9813 21 139 GO:0016289
AF-A0A3S0F7K9-F1-model_v4 Medium/long-chain acyl-CoA thioesterase YigI (EC 3.1.2.20) 0.9803 21 141 GO:0016289

Map