F473382
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 661 | 391 | 630 | 328 |
Family's Representative Sequence
| Representative Sequence | 3300005518|Ga0070699_100168679|Ga0070699_1001686792 |
| Length | 384 |
| Sequence | MIVPLIERAEASESFDGSQEDWRNSRRGGVQPLRCRRHCCTNVSLNMTARFDMASSMRAMVLERARDPLRQRTDIVVREPAPHEVLVRVHACGVCRTDLHIVDGELSGAKRDLVPGHEIVGAVSAVGKDVSRLAVGDRVGVPWLGWTCGNCKYCLSGRENLCDRARFTGYDLDGGYAEFTLADERYCFKLPAAYSDAEAAPLLCAGLIGFRALSMAGSGKRLGLYGFGAAAHIAIQIARYRGQEVFAFTQRNDKEGQDFARSLGAAWAGGSDEMPPEQLDGAILFAPVGALVPAALAATAKGGTVVCAGIHMSDIPAFPYRLLWGERSLCSVANLTRRDGDDFLDIAQKANVRTTVERFPLADANLALNRLRHGLIEGAAVLVP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 3 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 4 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 5 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 6 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 7 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 8 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 9 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 10 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 11 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 12 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 13 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 14 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 15 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 16 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 17 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 18 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 19 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 20 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 21 | 2808606395 | Achromobacter sp. SLBN-14 | Isolate | Unclassified |
| 22 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 23 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 24 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 25 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 26 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 27 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 28 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 29 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 30 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 31 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 32 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 33 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 34 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 35 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 36 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 37 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 38 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 39 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 40 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 41 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 42 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 43 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 44 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 49 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 52 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 60 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 67 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 68 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 73 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 75 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 81 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 83 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 84 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 85 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 86 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 87 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 88 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 89 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 90 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 91 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 92 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 93 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 95 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 96 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 97 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 98 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 99 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 100 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 101 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 102 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 103 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 104 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 105 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 106 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 107 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 109 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 133 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 136 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 137 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 138 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 139 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 141 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 142 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 190 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 191 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 192 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 193 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 194 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 195 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 196 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 197 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 198 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 199 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 200 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 201 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 202 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 203 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 204 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 205 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 206 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 207 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 208 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 209 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 210 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 211 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 212 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 213 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 214 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 215 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 216 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 217 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 218 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 219 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 220 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 221 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 222 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 223 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 224 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 225 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 226 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 227 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 228 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 229 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 230 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 231 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 232 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 233 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 234 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 235 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 236 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 237 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 238 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 239 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 240 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 241 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 242 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 243 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 244 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 245 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 246 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 247 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 248 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 249 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 250 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 251 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 252 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 253 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 254 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 255 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 256 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 257 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 320 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 321 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 322 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 323 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 324 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 325 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 326 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 327 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 328 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 329 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 330 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 331 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 332 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 333 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 334 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 335 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 336 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 337 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 338 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 339 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 340 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 341 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 342 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 354 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 360 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 363 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 366 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 369 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 374 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 375 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 376 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 377 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 378 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 379 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 380 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 381 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 382 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 383 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 384 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 386 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 387 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 388 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 389 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 390 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 391 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.31 |
| Metatranscriptomes | 0 |
| Isolates | 4.69 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.48 |
| Nodule | 0.15 |
| Rhizoplane | 4.54 |
| Rhizosphere | 86.54 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.3 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS1b_contig_9156956 | 2162886011 | Bacteria | 1627 |
| 2 | JGI25163J39215_1000029 | 3300002771 | Bacteria | 66589 |
| 3 | JGI25164J39214_1000096 | 3300002772 | Bacteria | 87444 |
| 4 | JGI25165J46597_1000143 | 3300003214 | Bacteria | 118216 |
| 5 | rootH1_10012394 | 3300003316 | Bacteria | 31437 |
| 6 | rootL2_10010090 | 3300003322 | Bacteria | 35147 |
| 7 | rootL2_10018488 | 3300003322 | Bacteria | 43748 |
| 8 | rootH1_10128101 | 3300003323 | Bacteria | 3359 |
| 9 | Ga0055536_1000037 | 3300003781 | Bacteria | 138437 |
| 10 | Ga0055530_10000320 | 3300003791 | Bacteria | 43510 |
| 11 | Ga0055540_1000025 | 3300003792 | Bacteria | 197801 |
| 12 | Ga0055531_10000585 | 3300003794 | Bacteria | 31831 |
| 13 | Ga0065714_10002258 | 3300005288 | Bacteria | 36899 |
| 14 | Ga0065714_10002901 | 3300005288 | Bacteria | 23244 |
| 15 | Ga0065704_10070482 | 3300005289 | Bacteria | 23009 |
| 16 | Ga0065712_10068215 | 3300005290 | Bacteria | 12855 |
| 17 | Ga0065712_10069208 | 3300005290 | Bacteria | 7732 |
| 18 | Ga0065715_10003077 | 3300005293 | Bacteria | 6366 |
| 19 | Ga0065715_10224438 | 3300005293 | Bacteria | 1258 |
| 20 | Ga0070658_10052631 | 3300005327 | Bacteria | 3302 |
| 21 | Ga0070683_100011978 | 3300005329 | Bacteria | 7524 |
| 22 | Ga0070670_100051581 | 3300005331 | Bacteria | 3532 |
| 23 | Ga0070670_100249923 | 3300005331 | Bacteria | 1545 |
| 24 | Ga0070677_10009694 | 3300005333 | Bacteria | 3272 |
| 25 | Ga0068869_100051352 | 3300005334 | Bacteria | 2992 |
| 26 | Ga0068869_100207090 | 3300005334 | Bacteria | 1549 |
| 27 | Ga0070666_10022333 | 3300005335 | Bacteria | 4109 |
| 28 | Ga0070666_10027040 | 3300005335 | Bacteria | 3754 |
| 29 | Ga0070680_100141305 | 3300005336 | Bacteria | 2019 |
| 30 | Ga0070689_100032071 | 3300005340 | Bacteria | 3995 |
| 31 | Ga0070689_100044183 | 3300005340 | Bacteria | 3427 |
| 32 | Ga0070691_10003139 | 3300005341 | Bacteria | 7397 |
| 33 | Ga0070687_100049937 | 3300005343 | Bacteria | 2159 |
| 34 | Ga0070661_100000062 | 3300005344 | Bacteria | 85485 |
| 35 | Ga0070661_100022191 | 3300005344 | Bacteria | 4543 |
| 36 | Ga0070661_100043394 | 3300005344 | Bacteria | 3284 |
| 37 | Ga0070668_100207848 | 3300005347 | Bacteria | 1609 |
| 38 | Ga0070668_100427026 | 3300005347 | Bacteria | 1135 |
| 39 | Ga0070669_100020230 | 3300005353 | Bacteria | 4754 |
| 40 | Ga0070675_100062092 | 3300005354 | Bacteria | 3086 |
| 41 | Ga0070675_100120440 | 3300005354 | Bacteria | 2229 |
| 42 | Ga0070671_100121957 | 3300005355 | Bacteria | 2194 |
| 43 | Ga0070688_100275666 | 3300005365 | Bacteria | 1206 |
| 44 | Ga0070667_100274968 | 3300005367 | Bacteria | 1511 |
| 45 | Ga0070709_10007786 | 3300005434 | Bacteria | 5883 |
| 46 | Ga0070709_10037836 | 3300005434 | Bacteria | 2950 |
| 47 | Ga0070714_100104923 | 3300005435 | Bacteria | 2494 |
| 48 | Ga0070714_100428916 | 3300005435 | Bacteria | 1253 |
| 49 | Ga0070710_10043611 | 3300005437 | Bacteria | 2485 |
| 50 | Ga0070711_100085944 | 3300005439 | Bacteria | 2254 |
| 51 | Ga0070711_100202443 | 3300005439 | Bacteria | 1533 |
| 52 | Ga0070708_100002248 | 3300005445 | Bacteria | 14929 |
| 53 | Ga0070708_100099061 | 3300005445 | Bacteria | 2666 |
| 54 | Ga0070708_100194035 | 3300005445 | Bacteria | 1900 |
| 55 | Ga0070681_10001886 | 3300005458 | Bacteria | 18915 |
| 56 | Ga0070681_10033626 | 3300005458 | Bacteria | 5147 |
| 57 | Ga0068867_100163777 | 3300005459 | Bacteria | 1756 |
| 58 | Ga0070706_100000124 | 3300005467 | Bacteria | 94753 |
| 59 | Ga0070706_100033891 | 3300005467 | Bacteria | 4714 |
| 60 | Ga0070706_100320959 | 3300005467 | Bacteria | 1444 |
| 61 | Ga0070707_100005141 | 3300005468 | Bacteria | 12257 |
| 62 | Ga0070707_100019507 | 3300005468 | Bacteria | 6388 |
| 63 | Ga0070698_100247966 | 3300005471 | Bacteria | 1714 |
| 64 | Ga0070699_100168679 | 3300005518 | Bacteria | 1939 |
| 65 | Ga0070684_100317949 | 3300005535 | Bacteria | 1430 |
| 66 | Ga0070697_100032629 | 3300005536 | Bacteria | 4192 |
| 67 | Ga0068853_100001820 | 3300005539 | Bacteria | 15690 |
| 68 | Ga0070695_100004211 | 3300005545 | Bacteria | 8418 |
| 69 | Ga0070696_100001810 | 3300005546 | Bacteria | 14033 |
| 70 | Ga0070693_100005727 | 3300005547 | Bacteria | 6000 |
| 71 | Ga0070665_100069746 | 3300005548 | Bacteria | 3523 |
| 72 | Ga0070704_100145746 | 3300005549 | Bacteria | 1855 |
| 73 | Ga0068855_100013092 | 3300005563 | Bacteria | 10002 |
| 74 | Ga0068855_100067973 | 3300005563 | Bacteria | 4149 |
| 75 | Ga0070664_100000035 | 3300005564 | Bacteria | 81750 |
| 76 | Ga0068857_100000802 | 3300005577 | Bacteria | 23509 |
| 77 | Ga0068856_100003713 | 3300005614 | Bacteria | 15318 |
| 78 | Ga0068856_100374366 | 3300005614 | Bacteria | 1443 |
| 79 | Ga0068852_100041502 | 3300005616 | Bacteria | 3888 |
| 80 | Ga0068859_100120565 | 3300005617 | Bacteria | 2690 |
| 81 | Ga0068861_100026817 | 3300005719 | Bacteria | 4192 |
| 82 | Ga0068851_10177225 | 3300005834 | Bacteria | 1179 |
| 83 | Ga0068870_10202694 | 3300005840 | Bacteria | 1204 |
| 84 | Ga0068860_100004545 | 3300005843 | Bacteria | 14161 |
| 85 | Ga0068862_100143065 | 3300005844 | Bacteria | 2124 |
| 86 | Ga0081538_10006701 | 3300005981 | Bacteria | 10083 |
| 87 | Ga0081538_10020776 | 3300005981 | Bacteria | 4819 |
| 88 | Ga0081540_1001134 | 3300005983 | Bacteria | 23542 |
| 89 | Ga0070717_10003024 | 3300006028 | Bacteria | 11981 |
| 90 | Ga0075365_10081952 | 3300006038 | Bacteria | 2187 |
| 91 | Ga0075368_10010670 | 3300006042 | Bacteria | 3325 |
| 92 | Ga0070715_10034504 | 3300006163 | Bacteria | 2074 |
| 93 | Ga0075367_10009558 | 3300006178 | Bacteria | 5073 |
| 94 | Ga0068871_100106942 | 3300006358 | Bacteria | 2349 |
| 95 | Ga0075428_100001345 | 3300006844 | Bacteria | 26076 |
| 96 | Ga0075428_100037201 | 3300006844 | Bacteria | 5359 |
| 97 | Ga0075428_100193095 | 3300006844 | Bacteria | 2202 |
| 98 | Ga0075428_100338854 | 3300006844 | Bacteria | 1615 |
| 99 | Ga0075430_100168245 | 3300006846 | Bacteria | 1823 |
| 100 | Ga0075431_100000499 | 3300006847 | Bacteria | 32706 |
| 101 | Ga0075431_100065561 | 3300006847 | Bacteria | 3750 |
| 102 | Ga0075431_100237076 | 3300006847 | Bacteria | 1857 |
| 103 | Ga0075433_10008240 | 3300006852 | Bacteria | 8306 |
| 104 | Ga0075433_10014903 | 3300006852 | Bacteria | 6362 |
| 105 | Ga0075433_10071796 | 3300006852 | Bacteria | 3043 |
| 106 | Ga0075434_100008516 | 3300006871 | Bacteria | 9538 |
| 107 | Ga0075434_100037518 | 3300006871 | Bacteria | 4797 |
| 108 | Ga0075434_100038555 | 3300006871 | Bacteria | 4732 |
| 109 | Ga0075434_100043629 | 3300006871 | Bacteria | 4448 |
| 110 | Ga0075434_100056629 | 3300006871 | Bacteria | 3896 |
| 111 | Ga0075434_100094167 | 3300006871 | Bacteria | 3000 |
| 112 | Ga0075434_100110310 | 3300006871 | Bacteria | 2762 |
| 113 | Ga0075429_100000711 | 3300006880 | Bacteria | 26042 |
| 114 | Ga0075429_100067834 | 3300006880 | Bacteria | 3105 |
| 115 | Ga0068865_100133990 | 3300006881 | Bacteria | 1859 |
| 116 | Ga0075436_100002130 | 3300006914 | Bacteria | 13640 |
| 117 | Ga0075436_100025640 | 3300006914 | Bacteria | 4057 |
| 118 | Ga0075436_100045933 | 3300006914 | Bacteria | 3013 |
| 119 | Ga0097620_100120560 | 3300006931 | Bacteria | 2690 |
| 120 | Ga0075435_100022510 | 3300007076 | Bacteria | 4863 |
| 121 | Ga0075435_100055666 | 3300007076 | Bacteria | 3195 |
| 122 | Ga0075435_100058427 | 3300007076 | Bacteria | 3124 |
| 123 | Ga0075435_100079957 | 3300007076 | Bacteria | 2683 |
| 124 | Ga0105251_10004128 | 3300009011 | Bacteria | 10140 |
| 125 | Ga0105251_10004663 | 3300009011 | Bacteria | 9225 |
| 126 | Ga0105244_10000457 | 3300009036 | Bacteria | 37377 |
| 127 | Ga0105244_10000938 | 3300009036 | Bacteria | 24575 |
| 128 | Ga0105244_10001727 | 3300009036 | Bacteria | 17208 |
| 129 | Ga0105244_10002982 | 3300009036 | Bacteria | 12459 |
| 130 | Ga0105244_10003222 | 3300009036 | Bacteria | 11821 |
| 131 | Ga0105250_10012347 | 3300009092 | Bacteria | 3527 |
| 132 | Ga0105240_10001960 | 3300009093 | Bacteria | 34026 |
| 133 | Ga0111539_10000313 | 3300009094 | Bacteria | 59049 |
| 134 | Ga0111539_10034521 | 3300009094 | Bacteria | 6132 |
| 135 | Ga0111539_10451315 | 3300009094 | Bacteria | 1497 |
| 136 | Ga0114129_10000066 | 3300009147 | Bacteria | 93802 |
| 137 | Ga0114129_10012927 | 3300009147 | Bacteria | 11880 |
| 138 | Ga0114129_10143210 | 3300009147 | Bacteria | 3275 |
| 139 | Ga0114129_10366876 | 3300009147 | Bacteria | 1904 |
| 140 | Ga0105243_10000026 | 3300009148 | Bacteria | 191522 |
| 141 | Ga0105241_10001630 | 3300009174 | Bacteria | 17123 |
| 142 | Ga0105242_10157559 | 3300009176 | Bacteria | 1985 |
| 143 | Ga0105237_10000042 | 3300009545 | Bacteria | 181280 |
| 144 | Ga0105237_10001963 | 3300009545 | Bacteria | 26185 |
| 145 | Ga0105238_10001275 | 3300009551 | Bacteria | 25338 |
| 146 | Ga0105249_10276482 | 3300009553 | Bacteria | 1675 |
| 147 | Ga0105239_10011225 | 3300010375 | Bacteria | 9998 |
| 148 | Ga0105246_10019156 | 3300011119 | Bacteria | 4368 |
| 149 | Ga0157373_10000796 | 3300013100 | Bacteria | 24360 |
| 150 | Ga0157373_10000854 | 3300013100 | Bacteria | 23667 |
| 151 | Ga0157373_10254401 | 3300013100 | Bacteria | 1242 |
| 152 | Ga0157371_10000559 | 3300013102 | Bacteria | 44129 |
| 153 | Ga0157370_10000803 | 3300013104 | Bacteria | 39592 |
| 154 | Ga0157370_10027969 | 3300013104 | Bacteria | 5552 |
| 155 | Ga0157370_10048208 | 3300013104 | Bacteria | 4081 |
| 156 | Ga0157370_10086960 | 3300013104 | Bacteria | 2936 |
| 157 | Ga0157369_10000251 | 3300013105 | Bacteria | 73814 |
| 158 | Ga0157369_10011775 | 3300013105 | Bacteria | 9933 |
| 159 | Ga0157374_10000777 | 3300013296 | Bacteria | 27941 |
| 160 | Ga0157372_10003383 | 3300013307 | Bacteria | 17209 |
| 161 | Ga0157372_10007744 | 3300013307 | Bacteria | 11411 |
| 162 | Ga0157372_10038285 | 3300013307 | Bacteria | 5292 |
| 163 | Ga0157372_10051324 | 3300013307 | Bacteria | 4590 |
| 164 | Ga0157375_10005653 | 3300013308 | Bacteria | 10882 |
| 165 | Ga0157375_10010826 | 3300013308 | Bacteria | 8035 |
| 166 | Ga0157375_10092155 | 3300013308 | Bacteria | 3093 |
| 167 | Ga0163163_10031805 | 3300014325 | Bacteria | 5096 |
| 168 | Ga0163163_10221202 | 3300014325 | Bacteria | 1942 |
| 169 | Ga0157380_10004218 | 3300014326 | Bacteria | 9942 |
| 170 | Ga0182008_10000496 | 3300014497 | Bacteria | 29685 |
| 171 | Ga0182008_10002573 | 3300014497 | Bacteria | 11282 |
| 172 | Ga0157377_10003910 | 3300014745 | Bacteria | 6791 |
| 173 | Ga0157379_10016139 | 3300014968 | Bacteria | 6569 |
| 174 | Ga0182006_1000083 | 3300015261 | Bacteria | 118727 |
| 175 | Ga0182006_1004951 | 3300015261 | Bacteria | 6435 |
| 176 | Ga0182007_10000086 | 3300015262 | Bacteria | 69920 |
| 177 | Ga0182005_1000675 | 3300015265 | Bacteria | 16002 |
| 178 | Ga0182005_1000920 | 3300015265 | Bacteria | 12860 |
| 179 | Ga0182005_1013655 | 3300015265 | Bacteria | 2283 |
| 180 | Ga0183362_10002 | 3300015683 | Bacteria | 1432711 |
| 181 | Ga0163161_10020254 | 3300017792 | Bacteria | 4666 |
| 182 | Ga0163161_10123250 | 3300017792 | Bacteria | 1949 |
| 183 | Ga0163161_10398898 | 3300017792 | Bacteria | 1103 |
| 184 | Ga0213872_10018004 | 3300021361 | Bacteria | 3259 |
| 185 | Ga0213876_10001446 | 3300021384 | Bacteria | 14768 |
| 186 | Ga0209760_100049 | 3300025207 | Bacteria | 107275 |
| 187 | Ga0207427_100048 | 3300025231 | Bacteria | 238464 |
| 188 | Ga0209437_100094 | 3300025233 | Bacteria | 238465 |
| 189 | Ga0209233_1000106 | 3300025261 | Bacteria | 268795 |
| 190 | Ga0209676_1000002 | 3300025292 | Bacteria | 1732948 |
| 191 | Ga0209050_1000006 | 3300025298 | Bacteria | 1359702 |
| 192 | Ga0209051_1000001 | 3300025303 | Bacteria | 1732974 |
| 193 | Ga0209257_1000056 | 3300025304 | Bacteria | 403132 |
| 194 | Ga0207696_1005135 | 3300025711 | Bacteria | 5500 |
| 195 | Ga0207655_1000070 | 3300025728 | Bacteria | 239196 |
| 196 | Ga0207655_1000076 | 3300025728 | Bacteria | 226359 |
| 197 | Ga0207655_1000481 | 3300025728 | Bacteria | 51474 |
| 198 | Ga0207655_1001371 | 3300025728 | Bacteria | 22824 |
| 199 | Ga0207655_1001394 | 3300025728 | Bacteria | 22565 |
| 200 | Ga0207655_1001956 | 3300025728 | Bacteria | 17604 |
| 201 | Ga0207655_1002348 | 3300025728 | Bacteria | 15475 |
| 202 | Ga0207713_1000777 | 3300025735 | Bacteria | 29481 |
| 203 | Ga0207713_1006522 | 3300025735 | Bacteria | 7093 |
| 204 | Ga0207680_10029395 | 3300025903 | Bacteria | 3086 |
| 205 | Ga0207699_10007119 | 3300025906 | Bacteria | 5454 |
| 206 | Ga0207699_10075934 | 3300025906 | Bacteria | 2068 |
| 207 | Ga0207699_10212184 | 3300025906 | Bacteria | 1317 |
| 208 | Ga0207645_10020213 | 3300025907 | Bacteria | 4361 |
| 209 | Ga0207643_10146556 | 3300025908 | Bacteria | 1413 |
| 210 | Ga0207705_10034907 | 3300025909 | Bacteria | 3597 |
| 211 | Ga0207705_10116121 | 3300025909 | Bacteria | 1981 |
| 212 | Ga0207684_10000045 | 3300025910 | Bacteria | 253128 |
| 213 | Ga0207684_10055983 | 3300025910 | Bacteria | 3345 |
| 214 | Ga0207707_10003369 | 3300025912 | Bacteria | 14184 |
| 215 | Ga0207707_10010161 | 3300025912 | Bacteria | 8168 |
| 216 | Ga0207707_10103149 | 3300025912 | Bacteria | 2493 |
| 217 | Ga0207695_10015247 | 3300025913 | Bacteria | 9061 |
| 218 | Ga0207671_10000847 | 3300025914 | Bacteria | 38847 |
| 219 | Ga0207671_10005589 | 3300025914 | Bacteria | 11549 |
| 220 | Ga0207663_10090967 | 3300025916 | Bacteria | 2025 |
| 221 | Ga0207662_10078463 | 3300025918 | Bacteria | 2010 |
| 222 | Ga0207657_10124599 | 3300025919 | Bacteria | 2117 |
| 223 | Ga0207649_10000010 | 3300025920 | Bacteria | 284354 |
| 224 | Ga0207649_10014298 | 3300025920 | Bacteria | 4440 |
| 225 | Ga0207649_10151345 | 3300025920 | Bacteria | 1598 |
| 226 | Ga0207646_10019447 | 3300025922 | Bacteria | 6312 |
| 227 | Ga0207646_10093779 | 3300025922 | Bacteria | 2688 |
| 228 | Ga0207681_10064076 | 3300025923 | Bacteria | 2536 |
| 229 | Ga0207694_10027462 | 3300025924 | Bacteria | 4335 |
| 230 | Ga0207659_10290877 | 3300025926 | Bacteria | 1339 |
| 231 | Ga0207664_10144690 | 3300025929 | Bacteria | 2015 |
| 232 | Ga0207706_10324295 | 3300025933 | Bacteria | 1340 |
| 233 | Ga0207709_10000004 | 3300025935 | Bacteria | 825156 |
| 234 | Ga0207709_10122816 | 3300025935 | Bacteria | 1756 |
| 235 | Ga0207670_10121556 | 3300025936 | Bacteria | 1899 |
| 236 | Ga0207704_10107453 | 3300025938 | Bacteria | 1877 |
| 237 | Ga0207665_10000939 | 3300025939 | Bacteria | 19702 |
| 238 | Ga0207665_10042830 | 3300025939 | Bacteria | 3026 |
| 239 | Ga0207691_10046572 | 3300025940 | Bacteria | 3983 |
| 240 | Ga0207691_10061544 | 3300025940 | Bacteria | 3409 |
| 241 | Ga0207689_10112881 | 3300025942 | Bacteria | 2234 |
| 242 | Ga0207689_10130345 | 3300025942 | Bacteria | 2069 |
| 243 | Ga0207689_10223473 | 3300025942 | Bacteria | 1556 |
| 244 | Ga0207679_10000022 | 3300025945 | Bacteria | 219036 |
| 245 | Ga0207679_10121748 | 3300025945 | Bacteria | 2078 |
| 246 | Ga0207667_10003761 | 3300025949 | Bacteria | 18701 |
| 247 | Ga0207667_10075639 | 3300025949 | Bacteria | 3496 |
| 248 | Ga0207651_10193904 | 3300025960 | Bacteria | 1623 |
| 249 | Ga0207712_10207661 | 3300025961 | Bacteria | 1557 |
| 250 | Ga0207708_10084885 | 3300026075 | Bacteria | 2435 |
| 251 | Ga0207702_10003125 | 3300026078 | Bacteria | 15355 |
| 252 | Ga0207702_10421275 | 3300026078 | Bacteria | 1291 |
| 253 | Ga0207648_10048665 | 3300026089 | Bacteria | 3711 |
| 254 | Ga0207674_10001713 | 3300026116 | Bacteria | 28060 |
| 255 | Ga0207675_100152288 | 3300026118 | Bacteria | 2202 |
| 256 | Ga0207675_100248288 | 3300026118 | Bacteria | 1722 |
| 257 | Ga0207683_10145286 | 3300026121 | Bacteria | 2139 |
| 258 | Ga0207698_10101910 | 3300026142 | Bacteria | 2382 |
| 259 | Ga0207698_10285915 | 3300026142 | Bacteria | 1528 |
| 260 | Ga0209813_10041349 | 3300027866 | Bacteria | 1405 |
| 261 | Ga0207428_10002687 | 3300027907 | Bacteria | 17719 |
| 262 | Ga0207428_10003264 | 3300027907 | Bacteria | 15804 |
| 263 | Ga0207428_10042671 | 3300027907 | Bacteria | 3667 |
| 264 | Ga0207428_10059996 | 3300027907 | Bacteria | 3014 |
| 265 | Ga0265326_10001140 | 3300028558 | Bacteria | 9482 |
| 266 | Ga0265319_1002341 | 3300028563 | Bacteria | 10431 |
| 267 | Ga0265334_10001262 | 3300028573 | Bacteria | 12312 |
| 268 | Ga0265334_10022241 | 3300028573 | Bacteria | 2585 |
| 269 | Ga0265318_10002005 | 3300028577 | Bacteria | 11283 |
| 270 | Ga0265338_10005997 | 3300028800 | Bacteria | 15628 |
| 271 | Ga0265338_10017707 | 3300028800 | Bacteria | 7662 |
| 272 | Ga0265338_10049605 | 3300028800 | Bacteria | 3803 |
| 273 | Ga0265338_10282045 | 3300028800 | Bacteria | 1213 |
| 274 | Ga0316181_1227316 | 3300030744 | Bacteria | 1909 |
| 275 | Ga0265330_10000322 | 3300031235 | Bacteria | 34393 |
| 276 | Ga0265330_10006673 | 3300031235 | Bacteria | 5694 |
| 277 | Ga0265332_10001221 | 3300031238 | Bacteria | 14855 |
| 278 | Ga0265332_10016511 | 3300031238 | Bacteria | 3257 |
| 279 | Ga0265332_10031950 | 3300031238 | Bacteria | 2295 |
| 280 | Ga0265332_10110890 | 3300031238 | Bacteria | 1156 |
| 281 | Ga0265328_10004455 | 3300031239 | Bacteria | 6085 |
| 282 | Ga0265320_10044421 | 3300031240 | Bacteria | 2189 |
| 283 | Ga0265325_10000525 | 3300031241 | Bacteria | 27638 |
| 284 | Ga0265340_10090297 | 3300031247 | Bacteria | 1433 |
| 285 | Ga0265339_10000889 | 3300031249 | Bacteria | 22952 |
| 286 | Ga0265339_10004715 | 3300031249 | Bacteria | 9247 |
| 287 | Ga0265339_10118736 | 3300031249 | Bacteria | 1361 |
| 288 | Ga0265331_10000252 | 3300031250 | Bacteria | 63468 |
| 289 | Ga0265331_10000502 | 3300031250 | Bacteria | 36921 |
| 290 | Ga0265331_10005406 | 3300031250 | Bacteria | 7721 |
| 291 | Ga0265316_10000397 | 3300031344 | Bacteria | 49700 |
| 292 | Ga0265313_10001208 | 3300031595 | Bacteria | 24677 |
| 293 | Ga0265313_10095359 | 3300031595 | Bacteria | 1328 |
| 294 | Ga0307508_10094678 | 3300031616 | Bacteria | 2577 |
| 295 | Ga0316579_10109100 | 3300031691 | Bacteria | 1328 |
| 296 | Ga0265314_10000303 | 3300031711 | Bacteria | 70486 |
| 297 | Ga0265314_10001687 | 3300031711 | Bacteria | 24037 |
| 298 | Ga0265314_10001701 | 3300031711 | Bacteria | 23896 |
| 299 | Ga0265314_10002139 | 3300031711 | Bacteria | 20716 |
| 300 | Ga0265342_10002593 | 3300031712 | Bacteria | 15480 |
| 301 | Ga0265342_10012477 | 3300031712 | Bacteria | 5753 |
| 302 | Ga0307405_10012674 | 3300031731 | Bacteria | 4474 |
| 303 | Ga0316577_10046809 | 3300031733 | Bacteria | 2415 |
| 304 | Ga0307414_10260026 | 3300032004 | Unclassified | 1448 |
| 305 | Ga0373923_0045074 | 3300035111 | Bacteria | 1831 |
| 306 | Ga0373939_0010780 | 3300035114 | Bacteria | 2295 |
| 307 | Ga0373945_0096715 | 3300035116 | Bacteria | 1151 |
| 308 | Ga0373956_0077554 | 3300035119 | Bacteria | 1521 |
| 309 | Ga0373955_0121393 | 3300035172 | Bacteria | 1519 |
| 310 | Ga0373955_0124613 | 3300035172 | Bacteria | 1500 |
| 311 | Ga0316574_0142450 | 3300035398 | Bacteria | 1545 |
| 312 | Ga0373924_0003730 | 3300035410 | Bacteria | 5264 |
| 313 | Ga0373924_0067353 | 3300035410 | Bacteria | 1506 |
| 314 | Ga0373933_0019008 | 3300035724 | Bacteria | 3873 |
| 315 | Ga0373933_0214506 | 3300035724 | Bacteria | 1234 |
| 316 | Ga0373933_0249473 | 3300035724 | Bacteria | 1143 |
| 317 | Ga0373937_0035560 | 3300036401 | Bacteria | 4535 |
| 318 | Ga0373937_0060910 | 3300036401 | Bacteria | 3469 |
| 319 | Ga0373937_0061901 | 3300036401 | Bacteria | 3440 |
| 320 | Ga0373937_0154564 | 3300036401 | Bacteria | 2150 |
| 321 | Ga0373937_0253348 | 3300036401 | Bacteria | 1659 |
| 322 | Ga0373937_0459976 | 3300036401 | Bacteria | 1209 |
| 323 | Ga0316582_0130492 | 3300036647 | Bacteria | 1687 |
| 324 | Ga0395899_0000743 | 3300037312 | Bacteria | 32540 |
| 325 | Ga0395899_0035413 | 3300037312 | Bacteria | 3747 |
| 326 | Ga0395900_0004846 | 3300037418 | Bacteria | 14174 |
| 327 | Ga0395900_0070047 | 3300037418 | Bacteria | 3605 |
| 328 | Ga0395900_0266109 | 3300037418 | Bacteria | 1710 |
| 329 | Ga0395898_0001561 | 3300037466 | Bacteria | 31392 |
| 330 | Ga0395898_0002530 | 3300037466 | Bacteria | 21459 |
| 331 | Ga0395898_0090994 | 3300037466 | Bacteria | 2935 |
| 332 | Ga0395905_0083949 | 3300037471 | Bacteria | 2984 |
| 333 | Ga0436364_0728550 | 3300037853 | Bacteria | 1185 |
| 334 | Ga0436364_0769865 | 3300037853 | Bacteria | 23589 |
| 335 | Ga0436364_1276281 | 3300037853 | Bacteria | 15092 |
| 336 | Ga0395901_0000646 | 3300038443 | Bacteria | 40293 |
| 337 | Ga0395901_0005139 | 3300038443 | Bacteria | 13211 |
| 338 | Ga0395901_0007147 | 3300038443 | Bacteria | 11269 |
| 339 | Ga0395901_0092621 | 3300038443 | Bacteria | 3163 |
| 340 | Ga0395901_0367565 | 3300038443 | Bacteria | 1482 |
| 341 | Ga0436365_1387122 | 3300039437 | Bacteria | 30710 |
| 342 | Ga0436361_1100786 | 3300039447 | Bacteria | 11720 |
| 343 | Ga0436362_1065128 | 3300039453 | Bacteria | 1230 |
| 344 | Ga0439438_000672 | 3300041405 | Bacteria | 15338 |
| 345 | Ga0439438_003319 | 3300041405 | Bacteria | 6549 |
| 346 | Ga0439447_000020 | 3300041407 | Bacteria | 58031 |
| 347 | Ga0439447_006525 | 3300041407 | Bacteria | 3777 |
| 348 | Ga0439466_0000031 | 3300041411 | Bacteria | 61194 |
| 349 | Ga0439466_0000658 | 3300041411 | Bacteria | 12990 |
| 350 | Ga0439466_0002398 | 3300041411 | Bacteria | 7347 |
| 351 | Ga0439466_0006795 | 3300041411 | Bacteria | 4339 |
| 352 | Ga0439466_0037725 | 3300041411 | Bacteria | 1626 |
| 353 | Ga0439465_0009278 | 3300041413 | Bacteria | 3100 |
| 354 | Ga0439432_000447 | 3300042006 | Bacteria | 15337 |
| 355 | Ga0439451_000525 | 3300042009 | Bacteria | 7298 |
| 356 | Ga0439451_005874 | 3300042009 | Bacteria | 2507 |
| 357 | Ga0439452_000124 | 3300042010 | Bacteria | 59201 |
| 358 | Ga0439452_016281 | 3300042010 | Bacteria | 2021 |
| 359 | Ga0439452_028649 | 3300042010 | Bacteria | 1388 |
| 360 | Ga0439456_004007 | 3300042013 | Bacteria | 2985 |
| 361 | Ga0439456_030807 | 3300042013 | Bacteria | 1148 |
| 362 | Ga0439463_018749 | 3300042016 | Bacteria | 1722 |
| 363 | Ga0450911_000551 | 3300042115 | Bacteria | 11644 |
| 364 | Ga0450919_000050 | 3300042121 | Bacteria | 10419 |
| 365 | Ga0450890_000057 | 3300042127 | Bacteria | 21630 |
| 366 | Ga0450898_001491 | 3300042134 | Bacteria | 3096 |
| 367 | Ga0450903_004903 | 3300042138 | Bacteria | 2257 |
| 368 | Ga0450910_004080 | 3300042147 | Bacteria | 1964 |
| 369 | Ga0439446_0000293 | 3300042156 | Bacteria | 9464 |
| 370 | Ga0450908_000297 | 3300042184 | Bacteria | 9847 |
| 371 | Ga0439460_0000026 | 3300042461 | Bacteria | 21156 |
| 372 | Ga0439460_0003892 | 3300042461 | Bacteria | 3624 |
| 373 | Ga0450893_0000432 | 3300042532 | Bacteria | 5919 |
| 374 | Ga0451577_0079170 | 3300042876 | Bacteria | 2930 |
| 375 | Ga0451577_0336187 | 3300042876 | Bacteria | 1370 |
| 376 | Ga0439440_0003033 | 3300042993 | Bacteria | 3201 |
| 377 | Ga0439440_0003557 | 3300042993 | Bacteria | 3012 |
| 378 | Ga0466961_0019820 | 3300044693 | Bacteria | 4327 |
| 379 | Ga0451576_0017935 | 3300045051 | Bacteria | 7770 |
| 380 | Ga0466967_0184002 | 3300045976 | Bacteria | 1972 |
| 381 | Ga0466967_0590907 | 3300045976 | Bacteria | 1095 |
| 382 | Ga0495592_0106998 | 3300046454 | Bacteria | 1984 |
| 383 | Ga0495603_0156743 | 3300046455 | Bacteria | 1321 |
| 384 | Ga0495590_0006914 | 3300046457 | Bacteria | 4403 |
| 385 | Ga0495591_009988 | 3300046458 | Bacteria | 3722 |
| 386 | Ga0495629_0018317 | 3300046459 | Bacteria | 5013 |
| 387 | Ga0495638_0000262 | 3300046460 | Bacteria | 70901 |
| 388 | Ga0495653_0005310 | 3300046463 | Bacteria | 10478 |
| 389 | Ga0495653_0006799 | 3300046463 | Bacteria | 9393 |
| 390 | Ga0495653_0018759 | 3300046463 | Bacteria | 5614 |
| 391 | Ga0495580_0129118 | 3300046472 | Bacteria | 1754 |
| 392 | Ga0495582_0004180 | 3300046473 | Bacteria | 8116 |
| 393 | Ga0495605_0002203 | 3300046474 | Bacteria | 12166 |
| 394 | Ga0495605_0010703 | 3300046474 | Bacteria | 5126 |
| 395 | Ga0495605_0118265 | 3300046474 | Bacteria | 1203 |
| 396 | Ga0495639_0000001 | 3300046475 | Bacteria | 204442 |
| 397 | Ga0495639_0008341 | 3300046475 | Bacteria | 4444 |
| 398 | Ga0495664_0238826 | 3300046477 | Bacteria | 1099 |
| 399 | Ga0495584_0000111 | 3300046491 | Bacteria | 56145 |
| 400 | Ga0495585_0000001 | 3300046492 | Bacteria | 609804 |
| 401 | Ga0495594_0000150 | 3300046499 | Bacteria | 33190 |
| 402 | Ga0495594_0010336 | 3300046499 | Bacteria | 4838 |
| 403 | Ga0495594_0025741 | 3300046499 | Bacteria | 3163 |
| 404 | Ga0495607_0002925 | 3300046501 | Bacteria | 13453 |
| 405 | Ga0495583_0001020 | 3300046506 | Bacteria | 31872 |
| 406 | Ga0495583_0002091 | 3300046506 | Bacteria | 18015 |
| 407 | Ga0495583_0004168 | 3300046506 | Bacteria | 10536 |
| 408 | Ga0495608_0003654 | 3300046511 | Bacteria | 11055 |
| 409 | Ga0495608_0004988 | 3300046511 | Bacteria | 9504 |
| 410 | Ga0495618_0072590 | 3300046514 | Bacteria | 2190 |
| 411 | Ga0495630_0245666 | 3300046517 | Bacteria | 1367 |
| 412 | Ga0495631_0000078 | 3300046518 | Bacteria | 63148 |
| 413 | Ga0495632_0006777 | 3300046519 | Bacteria | 7315 |
| 414 | Ga0495644_0000017 | 3300046523 | Bacteria | 85885 |
| 415 | Ga0495644_0030858 | 3300046523 | Bacteria | 2024 |
| 416 | Ga0495648_0000990 | 3300046524 | Bacteria | 29242 |
| 417 | Ga0495666_0000079 | 3300046526 | Bacteria | 38093 |
| 418 | Ga0495666_0001238 | 3300046526 | Bacteria | 12361 |
| 419 | Ga0495666_0014846 | 3300046526 | Bacteria | 3875 |
| 420 | Ga0495666_0018713 | 3300046526 | Bacteria | 3442 |
| 421 | Ga0495654_0000088 | 3300046530 | Bacteria | 104763 |
| 422 | Ga0495665_0096248 | 3300046531 | Bacteria | 1555 |
| 423 | Ga0495586_0165541 | 3300046535 | Bacteria | 1248 |
| 424 | Ga0495587_0000877 | 3300046536 | Bacteria | 19880 |
| 425 | Ga0495587_0002643 | 3300046536 | Bacteria | 11969 |
| 426 | Ga0495621_0038761 | 3300046539 | Bacteria | 1664 |
| 427 | Ga0495597_0071142 | 3300046542 | Bacteria | 1498 |
| 428 | Ga0495622_0000347 | 3300046557 | Bacteria | 33186 |
| 429 | Ga0495622_0000448 | 3300046557 | Bacteria | 26565 |
| 430 | Ga0495667_0000398 | 3300046559 | Bacteria | 27824 |
| 431 | Ga0495667_0076158 | 3300046559 | Bacteria | 2182 |
| 432 | Ga0495634_0000620 | 3300046642 | Bacteria | 34465 |
| 433 | Ga0495611_0003467 | 3300046648 | Bacteria | 6950 |
| 434 | Ga0495635_0000441 | 3300046663 | Bacteria | 26300 |
| 435 | Ga0495635_0024716 | 3300046663 | Bacteria | 4187 |
| 436 | Ga0495659_0000002 | 3300046664 | Bacteria | 176698 |
| 437 | Ga0495661_0000104 | 3300046665 | Bacteria | 101211 |
| 438 | Ga0495657_0084592 | 3300046675 | Bacteria | 2046 |
| 439 | Ga0495623_0000261 | 3300046679 | Bacteria | 34079 |
| 440 | Ga0495623_0002508 | 3300046679 | Bacteria | 12149 |
| 441 | Ga0495623_0073696 | 3300046679 | Bacteria | 2122 |
| 442 | Ga0495646_0001696 | 3300046680 | Bacteria | 13198 |
| 443 | Ga0495646_0003686 | 3300046680 | Bacteria | 9559 |
| 444 | Ga0495658_0150479 | 3300046683 | Bacteria | 1429 |
| 445 | Ga0495613_0001223 | 3300046689 | Bacteria | 19621 |
| 446 | Ga0495613_0044800 | 3300046689 | Bacteria | 3272 |
| 447 | Ga0495670_0038379 | 3300046691 | Bacteria | 2388 |
| 448 | Ga0495670_0064033 | 3300046691 | Bacteria | 1852 |
| 449 | Ga0495671_0064856 | 3300046692 | Bacteria | 1797 |
| 450 | Ga0495649_0000113 | 3300046694 | Bacteria | 71567 |
| 451 | Ga0495589_0026715 | 3300046794 | Bacteria | 2923 |
| 452 | Ga0495600_0011054 | 3300046809 | Bacteria | 5617 |
| 453 | Ga0495600_0061111 | 3300046809 | Bacteria | 2460 |
| 454 | Ga0495660_0001594 | 3300046810 | Bacteria | 15228 |
| 455 | Ga0495660_0010813 | 3300046810 | Bacteria | 5300 |
| 456 | Ga0495581_0016418 | 3300047315 | Bacteria | 4305 |
| 457 | Ga0495604_0004315 | 3300047317 | Bacteria | 11256 |
| 458 | Ga0495604_0013697 | 3300047317 | Bacteria | 6464 |
| 459 | Ga0495604_0044340 | 3300047317 | Bacteria | 3475 |
| 460 | Ga0495604_0143542 | 3300047317 | Bacteria | 1703 |
| 461 | Ga0495674_0008489 | 3300047319 | Bacteria | 9784 |
| 462 | Ga0495672_0000440 | 3300047320 | Bacteria | 49603 |
| 463 | Ga0495672_0002093 | 3300047320 | Bacteria | 18704 |
| 464 | Ga0495672_0104517 | 3300047320 | Bacteria | 1530 |
| 465 | Ga0495676_0013029 | 3300047321 | Bacteria | 7483 |
| 466 | Ga0495676_0206971 | 3300047321 | Bacteria | 1360 |
| 467 | Ga0495680_0000029 | 3300047322 | Bacteria | 112033 |
| 468 | Ga0495680_0006253 | 3300047322 | Bacteria | 11099 |
| 469 | Ga0495680_0010856 | 3300047322 | Bacteria | 8099 |
| 470 | Ga0495680_0027586 | 3300047322 | Bacteria | 4663 |
| 471 | Ga0495683_0002618 | 3300047323 | Bacteria | 10766 |
| 472 | Ga0495687_003006 | 3300047443 | Bacteria | 12736 |
| 473 | Ga0495687_028034 | 3300047443 | Bacteria | 2625 |
| 474 | Ga0495687_076272 | 3300047443 | Bacteria | 1327 |
| 475 | Ga0495675_0010528 | 3300047444 | Bacteria | 5781 |
| 476 | Ga0495673_0000261 | 3300047469 | Bacteria | 73160 |
| 477 | Ga0495684_0192412 | 3300047471 | Bacteria | 1507 |
| 478 | Ga0495593_0000441 | 3300047673 | Bacteria | 23225 |
| 479 | Ga0495593_0002452 | 3300047673 | Bacteria | 11161 |
| 480 | Ga0495626_0000031 | 3300048091 | Bacteria | 197930 |
| 481 | Ga0496101_0153798 | 3300048904 | Bacteria | 1761 |
| 482 | Ga0496102_0001084 | 3300048905 | Bacteria | 25181 |
| 483 | Ga0496103_0000690 | 3300048906 | Bacteria | 25132 |
| 484 | Ga0496104_0071740 | 3300048907 | Bacteria | 3293 |
| 485 | Ga0496105_0056075 | 3300048908 | Bacteria | 3253 |
| 486 | Ga0496106_0243336 | 3300048909 | Bacteria | 1437 |
| 487 | Ga0496108_0085981 | 3300048911 | Unclassified | 2670 |
| 488 | Ga0496109_0031625 | 3300048912 | Bacteria | 4752 |
| 489 | Ga0496109_0040556 | 3300048912 | Bacteria | 4217 |
| 490 | Ga0496109_0071421 | 3300048912 | Bacteria | 3187 |
| 491 | Ga0496110_0025914 | 3300048913 | Bacteria | 5014 |
| 492 | Ga0496110_0051355 | 3300048913 | Bacteria | 3623 |
| 493 | Ga0496110_0073253 | 3300048913 | Bacteria | 3040 |
| 494 | Ga0496110_0097921 | 3300048913 | Bacteria | 2628 |
| 495 | Ga0496111_0012974 | 3300048914 | Bacteria | 5657 |
| 496 | Ga0496111_0111911 | 3300048914 | Bacteria | 2011 |
| 497 | Ga0496112_0078286 | 3300048915 | Bacteria | 3270 |
| 498 | Ga0496112_0094681 | 3300048915 | Bacteria | 2957 |
| 499 | Ga0496113_0138174 | 3300048916 | Bacteria | 1916 |
| 500 | Ga0496115_0084929 | 3300048918 | Bacteria | 2581 |
| 501 | Ga0496116_0000475 | 3300048919 | Bacteria | 55484 |
| 502 | Ga0496116_0016061 | 3300048919 | Bacteria | 5879 |
| 503 | Ga0496116_0130658 | 3300048919 | Bacteria | 1432 |
| 504 | Ga0496117_0007397 | 3300048920 | Bacteria | 10744 |
| 505 | Ga0496117_0016634 | 3300048920 | Bacteria | 6193 |
| 506 | Ga0496117_0057344 | 3300048920 | Bacteria | 2705 |
| 507 | Ga0496118_0004367 | 3300048921 | Bacteria | 16815 |
| 508 | Ga0496118_0063330 | 3300048921 | Bacteria | 2721 |
| 509 | Ga0496119_0107050 | 3300048922 | Bacteria | 1559 |
| 510 | Ga0496121_0150036 | 3300048924 | Bacteria | 1716 |
| 511 | Ga0496122_0002729 | 3300048925 | Bacteria | 24434 |
| 512 | Ga0496122_0143699 | 3300048925 | Bacteria | 1487 |
| 513 | Ga0496123_0085455 | 3300048926 | Bacteria | 1898 |
| 514 | Ga0496123_0180927 | 3300048926 | Bacteria | 1101 |
| 515 | Ga0496124_0001409 | 3300048927 | Bacteria | 35871 |
| 516 | Ga0496124_0025547 | 3300048927 | Bacteria | 5349 |
| 517 | Ga0496124_0216886 | 3300048927 | Bacteria | 1442 |
| 518 | Ga0496125_0000410 | 3300048928 | Bacteria | 80395 |
| 519 | Ga0496126_0085316 | 3300048929 | Bacteria | 2784 |
| 520 | Ga0495678_001076 | 3300049459 | Bacteria | 23066 |
| 521 | Ga0495682_0000106 | 3300049460 | Bacteria | 74069 |
| 522 | Ga0501031_0163787 | 3300049568 | Bacteria | 1453 |
| 523 | Ga0501033_0016763 | 3300049570 | Bacteria | 5542 |
| 524 | Ga0501038_0379586 | 3300049574 | Bacteria | 1096 |
| 525 | Ga0501039_0073686 | 3300049575 | Bacteria | 2653 |
| 526 | Ga0501039_0169840 | 3300049575 | Bacteria | 1714 |
| 527 | Ga0501040_0074659 | 3300049576 | Bacteria | 2343 |
| 528 | Ga0501040_0082382 | 3300049576 | Bacteria | 2230 |
| 529 | Ga0501041_0010090 | 3300049577 | Bacteria | 5564 |
| 530 | Ga0501041_0056786 | 3300049577 | Bacteria | 2393 |
| 531 | Ga0501042_0033617 | 3300049578 | Bacteria | 3635 |
| 532 | Ga0501042_0047423 | 3300049578 | Bacteria | 3064 |
| 533 | Ga0501043_0173950 | 3300049579 | Bacteria | 1679 |
| 534 | Ga0501043_0239250 | 3300049579 | Bacteria | 1400 |
| 535 | Ga0501046_0002435 | 3300049580 | Bacteria | 17438 |
| 536 | Ga0501046_0051480 | 3300049580 | Bacteria | 3249 |
| 537 | Ga0501048_0020326 | 3300049582 | Bacteria | 4866 |
| 538 | Ga0501048_0051900 | 3300049582 | Bacteria | 2918 |
| 539 | Ga0501067_0063125 | 3300049583 | Bacteria | 2051 |
| 540 | Ga0501068_0243780 | 3300049584 | Bacteria | 1144 |
| 541 | Ga0501069_0009278 | 3300049585 | Bacteria | 5193 |
| 542 | Ga0501070_0023153 | 3300049586 | Bacteria | 5203 |
| 543 | Ga0501071_0084027 | 3300049587 | Bacteria | 2332 |
| 544 | Ga0501071_0241018 | 3300049587 | Bacteria | 1363 |
| 545 | Ga0501071_0251333 | 3300049587 | Bacteria | 1334 |
| 546 | Ga0501072_0006922 | 3300049588 | Bacteria | 8607 |
| 547 | Ga0501072_0020235 | 3300049588 | Bacteria | 5155 |
| 548 | Ga0501073_0036605 | 3300049589 | Bacteria | 3487 |
| 549 | Ga0501074_0274543 | 3300049590 | Bacteria | 1198 |
| 550 | Ga0501075_0001993 | 3300049591 | Bacteria | 13483 |
| 551 | Ga0501075_0005332 | 3300049591 | Bacteria | 8794 |
| 552 | Ga0501075_0016477 | 3300049591 | Bacteria | 5324 |
| 553 | Ga0501075_0042799 | 3300049591 | Bacteria | 3397 |
| 554 | Ga0501075_0069962 | 3300049591 | Bacteria | 2652 |
| 555 | Ga0501076_0003305 | 3300049592 | Bacteria | 11299 |
| 556 | Ga0501076_0046292 | 3300049592 | Bacteria | 3437 |
| 557 | Ga0501076_0048023 | 3300049592 | Bacteria | 3374 |
| 558 | Ga0501076_0112845 | 3300049592 | Bacteria | 2199 |
| 559 | Ga0501076_0117833 | 3300049592 | Bacteria | 2149 |
| 560 | Ga0501076_0255100 | 3300049592 | Bacteria | 1435 |
| 561 | Ga0501077_0001429 | 3300049593 | Bacteria | 14339 |
| 562 | Ga0501077_0032891 | 3300049593 | Bacteria | 3303 |
| 563 | Ga0501077_0048058 | 3300049593 | Bacteria | 2711 |
| 564 | Ga0501223_004683 | 3300049663 | Bacteria | 2910 |
| 565 | Ga0501079_0003080 | 3300049741 | Bacteria | 12207 |
| 566 | Ga0501079_0041926 | 3300049741 | Bacteria | 3534 |
| 567 | Ga0501079_0129654 | 3300049741 | Bacteria | 1962 |
| 568 | Ga0501079_0148053 | 3300049741 | Bacteria | 1830 |
| 569 | Ga0501080_0040971 | 3300049742 | Bacteria | 4317 |
| 570 | Ga0501080_0047205 | 3300049742 | Bacteria | 4009 |
| 571 | Ga0501080_0123300 | 3300049742 | Bacteria | 2400 |
| 572 | Ga0501080_0235306 | 3300049742 | Bacteria | 1674 |
| 573 | Ga0501080_0320556 | 3300049742 | Unclassified | 1403 |
| 574 | Ga0501080_0442074 | 3300049742 | Bacteria | 1167 |
| 575 | Ga0501081_0004345 | 3300049743 | Bacteria | 9087 |
| 576 | Ga0501081_0011241 | 3300049743 | Bacteria | 5855 |
| 577 | Ga0501083_0014666 | 3300049744 | Bacteria | 5479 |
| 578 | Ga0501083_0137461 | 3300049744 | Bacteria | 1600 |
| 579 | Ga0501035_0153614 | 3300049822 | Bacteria | 1996 |
| 580 | Ga0501035_0226768 | 3300049822 | Bacteria | 1593 |
| 581 | Ga0501044_0207745 | 3300049823 | Bacteria | 1914 |
| 582 | Ga0501045_0055158 | 3300049824 | Bacteria | 2907 |
| 583 | Ga0501045_0062102 | 3300049824 | Bacteria | 2741 |
| 584 | Ga0501045_0116181 | 3300049824 | Bacteria | 1985 |
| 585 | Ga0501045_0118558 | 3300049824 | Bacteria | 1964 |
| 586 | Ga0501045_0185452 | 3300049824 | Bacteria | 1550 |
| 587 | nmdc:mga0yw44_21288_c1 | 3300050492 | Bacteria | 2989 |
| 588 | nmdc:mga0k408_7762_c1 | 3300050493 | Bacteria | 5736 |
| 589 | nmdc:mga06z11_183827_c1 | 3300050494 | Bacteria | 1207 |
| 590 | nmdc:mga05p37_2991_c1 | 3300050507 | Bacteria | 19627 |
| 591 | nmdc:mga05p37_30364_c1 | 3300050507 | Bacteria | 6594 |
| 592 | nmdc:mga05p37_879_c1 | 3300050507 | Bacteria | 33833 |
| 593 | nmdc:mga09592_697_c1 | 3300050508 | Bacteria | 25685 |
| 594 | nmdc:mga09592_97874_c1 | 3300050508 | Bacteria | 2511 |
| 595 | nmdc:mga06r32_112269_c1 | 3300050510 | Bacteria | 2682 |
| 596 | nmdc:mga06r32_28617_c1 | 3300050510 | Bacteria | 5217 |
| 597 | nmdc:mga06r32_394_c1 | 3300050510 | Bacteria | 36886 |
| 598 | nmdc:mga08y16_1049_c1 | 3300050511 | Bacteria | 27130 |
| 599 | nmdc:mga08y16_17670_c1 | 3300050511 | Bacteria | 7513 |
| 600 | nmdc:mga08y16_41071_c1 | 3300050511 | Bacteria | 4846 |
| 601 | nmdc:mga0n895_113096_c1 | 3300050512 | Bacteria | 2732 |
| 602 | nmdc:mga0n895_45332_c1 | 3300050512 | Bacteria | 4291 |
| 603 | nmdc:mga0rr50_17172_c1 | 3300050513 | Bacteria | 4825 |
| 604 | nmdc:mga0rr50_205_c1 | 3300050513 | Bacteria | 31964 |
| 605 | nmdc:mga0rr50_75455_c1 | 3300050513 | Bacteria | 2584 |
| 606 | nmdc:mga08x19_14975_c1 | 3300050514 | Bacteria | 4709 |
| 607 | nmdc:mga08x19_2208_c1 | 3300050514 | Bacteria | 11900 |
| 608 | nmdc:mga08x19_3171_c1 | 3300050514 | Bacteria | 9864 |
| 609 | nmdc:mga0a205_20010_c1 | 3300050515 | Bacteria | 6315 |
| 610 | nmdc:mga0a205_271560_c1 | 3300050515 | Bacteria | 1572 |
| 611 | Ga0495595_0040572 | 3300053084 | Bacteria | 2127 |
| 612 | Ga0500645_001001 | 3300053730 | Bacteria | 15940 |
| 613 | Ga0501084_0000042 | 3300054114 | Bacteria | 100450 |
| 614 | Ga0501084_0000978 | 3300054114 | Bacteria | 22179 |
| 615 | Ga0501084_0020252 | 3300054114 | Bacteria | 5545 |
| 616 | Ga0501084_0030858 | 3300054114 | Bacteria | 4481 |
| 617 | Ga0501084_0079221 | 3300054114 | Bacteria | 2753 |
| 618 | Ga0501084_0131267 | 3300054114 | Bacteria | 2108 |
| 619 | Ga0501082_0019667 | 3300060353 | Bacteria | 5822 |
| 620 | Ga0501082_0033002 | 3300060353 | Bacteria | 4464 |
| 621 | Ga0501082_0041923 | 3300060353 | Bacteria | 3946 |
| 622 | Ga0501082_0047293 | 3300060353 | Bacteria | 3707 |
| 623 | Ga0501082_0049884 | 3300060353 | Bacteria | 3609 |
| 624 | Ga0501082_0136057 | 3300060353 | Bacteria | 2132 |
| 625 | Ga0501082_0145516 | 3300060353 | Bacteria | 2057 |
| 626 | Ga0530510_0000918 | 3300061734 | Bacteria | 19421 |
| 627 | Ga0530510_0016789 | 3300061734 | Bacteria | 5184 |
| 628 | Ga0530510_0036432 | 3300061734 | Bacteria | 3546 |
| 629 | Ga0530510_0134932 | 3300061734 | Bacteria | 1817 |
| 630 | Ga0530510_0257988 | 3300061734 | Bacteria | 1299 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005347 | Ga0070668_100207848 | Ga0070668_1002078483 | 284 |
| 2 | 3300048918 | Ga0496115_0084929 | Ga0496115_0084929_19_957 | 302 |
| 3 | 3300038443 | Ga0395901_0367565 | Ga0395901_0367565_66_1073 | 305 |
| 4 | 3300009036 | Ga0105244_10000457 | Ga0105244_1000045714 | 308 |
| 5 | 3300013100 | Ga0157373_10000854 | Ga0157373_100008543 | 308 |
| 6 | 3300036401 | Ga0373937_0035560 | Ga0373937_0035560_1306_2235 | 308 |
| 7 | 3300009147 | Ga0114129_10366876 | Ga0114129_103668762 | 309 |
| 8 | 3300013105 | Ga0157369_10000251 | Ga0157369_1000025125 | 309 |
| 9 | 3300039453 | Ga0436362_1065128 | Ga0436362_1065128_91_1062 | 309 |
| 10 | 3300021361 | Ga0213872_10018004 | Ga0213872_100180042 | 310 |
| 11 | 3300028573 | Ga0265334_10001262 | Ga0265334_1000126212 | 310 |
| 12 | 3300046535 | Ga0495586_0165541 | Ga0495586_0165541_26_958 | 310 |
| 13 | 3300003781 | Ga0055536_1000037 | Ga0055536_100003722 | 311 |
| 14 | 3300003791 | Ga0055530_10000320 | Ga0055530_1000032042 | 311 |
| 15 | 3300003792 | Ga0055540_1000025 | Ga0055540_1000025143 | 311 |
| 16 | 3300003794 | Ga0055531_10000585 | Ga0055531_1000058527 | 311 |
| 17 | 3300009011 | Ga0105251_10004663 | Ga0105251_100046633 | 311 |
| 18 | 3300009036 | Ga0105244_10000938 | Ga0105244_1000093812 | 311 |
| 19 | 3300009545 | Ga0105237_10000042 | Ga0105237_1000004213 | 311 |
| 20 | 3300015261 | Ga0182006_1004951 | Ga0182006_10049512 | 311 |
| 21 | 3300025292 | Ga0209676_1000002 | Ga0209676_1000002568 | 311 |
| 22 | 3300025298 | Ga0209050_1000006 | Ga0209050_10000061002 | 311 |
| 23 | 3300025303 | Ga0209051_1000001 | Ga0209051_1000001568 | 311 |
| 24 | 3300025304 | Ga0209257_1000056 | Ga0209257_1000056237 | 311 |
| 25 | 3300025728 | Ga0207655_1000070 | Ga0207655_1000070132 | 311 |
| 26 | 3300025728 | Ga0207655_1001371 | Ga0207655_100137114 | 311 |
| 27 | 3300025735 | Ga0207713_1006522 | Ga0207713_10065226 | 311 |
| 28 | 3300025914 | Ga0207671_10000847 | Ga0207671_1000084722 | 311 |
| 29 | 3300037418 | Ga0395900_0266109 | Ga0395900_0266109_198_1172 | 311 |
| 30 | 3300048919 | Ga0496116_0130658 | Ga0496116_0130658_158_1141 | 311 |
| 31 | 3300048920 | Ga0496117_0057344 | Ga0496117_0057344_377_1360 | 311 |
| 32 | 3300048921 | Ga0496118_0063330 | Ga0496118_0063330_394_1377 | 311 |
| 33 | 3300048922 | Ga0496119_0107050 | Ga0496119_0107050_179_1162 | 311 |
| 34 | 3300048924 | Ga0496121_0150036 | Ga0496121_0150036_375_1358 | 311 |
| 35 | 3300048925 | Ga0496122_0143699 | Ga0496122_0143699_308_1291 | 311 |
| 36 | 3300048926 | Ga0496123_0180927 | Ga0496123_0180927_45_1028 | 311 |
| 37 | 3300048927 | Ga0496124_0216886 | Ga0496124_0216886_155_1138 | 311 |
| 38 | 3300006028 | Ga0070717_10003024 | Ga0070717_100030247 | 312 |
| 39 | 3300060353 | Ga0501082_0049884 | Ga0501082_0049884_717_1655 | 312 |
| 40 | 3300005288 | Ga0065714_10002258 | Ga0065714_1000225814 | 313 |
| 41 | 3300005289 | Ga0065704_10070482 | Ga0065704_1007048218 | 313 |
| 42 | 3300005719 | Ga0068861_100026817 | Ga0068861_1000268175 | 313 |
| 43 | 3300006042 | Ga0075368_10010670 | Ga0075368_100106703 | 313 |
| 44 | 3300006178 | Ga0075367_10009558 | Ga0075367_100095584 | 313 |
| 45 | 3300013104 | Ga0157370_10027969 | Ga0157370_100279695 | 313 |
| 46 | 3300025942 | Ga0207689_10112881 | Ga0207689_101128812 | 313 |
| 47 | 3300026118 | Ga0207675_100248288 | Ga0207675_1002482881 | 313 |
| 48 | 3300027866 | Ga0209813_10041349 | Ga0209813_100413492 | 313 |
| 49 | 3300035398 | Ga0316574_0142450 | Ga0316574_0142450_316_1308 | 313 |
| 50 | 3300039447 | Ga0436361_1100786 | Ga0436361_1100786_7450_8454 | 313 |
| 51 | 3300049584 | Ga0501068_0243780 | Ga0501068_0243780_26_1018 | 313 |
| 52 | 3300050493 | nmdc:mga0k408_7762_c1 | nmdc:mga0k408_7762_c1_4458_5480 | 313 |
| 53 | 3300050494 | nmdc:mga06z11_183827_c1 | nmdc:mga06z11_183827_c1_134_1156 | 313 |
| 54 | 3300035111 | Ga0373923_0045074 | Ga0373923_0045074_489_1433 | 314 |
| 55 | 3300035116 | Ga0373945_0096715 | Ga0373945_0096715_154_1098 | 314 |
| 56 | 3300035119 | Ga0373956_0077554 | Ga0373956_0077554_301_1245 | 314 |
| 57 | 3300035172 | Ga0373955_0121393 | Ga0373955_0121393_336_1280 | 314 |
| 58 | 3300035410 | Ga0373924_0067353 | Ga0373924_0067353_50_994 | 314 |
| 59 | 3300046454 | Ga0495592_0106998 | Ga0495592_0106998_579_1523 | 314 |
| 60 | 3300046472 | Ga0495580_0129118 | Ga0495580_0129118_30_974 | 314 |
| 61 | 3300046477 | Ga0495664_0238826 | Ga0495664_0238826_83_1027 | 314 |
| 62 | 3300046514 | Ga0495618_0072590 | Ga0495618_0072590_718_1662 | 314 |
| 63 | 3300046517 | Ga0495630_0245666 | Ga0495630_0245666_390_1334 | 314 |
| 64 | 3300046531 | Ga0495665_0096248 | Ga0495665_0096248_39_983 | 314 |
| 65 | 3300046559 | Ga0495667_0076158 | Ga0495667_0076158_646_1590 | 314 |
| 66 | 3300046679 | Ga0495623_0073696 | Ga0495623_0073696_660_1604 | 314 |
| 67 | 3300046683 | Ga0495658_0150479 | Ga0495658_0150479_268_1212 | 314 |
| 68 | 3300047317 | Ga0495604_0143542 | Ga0495604_0143542_732_1676 | 314 |
| 69 | 3300047471 | Ga0495684_0192412 | Ga0495684_0192412_238_1182 | 314 |
| 70 | 3300009176 | Ga0105242_10157559 | Ga0105242_101575592 | 315 |
| 71 | 3300028800 | Ga0265338_10017707 | Ga0265338_100177074 | 315 |
| 72 | 3300035724 | Ga0373933_0214506 | Ga0373933_0214506_272_1222 | 315 |
| 73 | 3300048915 | Ga0496112_0078286 | Ga0496112_0078286_294_1241 | 315 |
| 74 | 3300049589 | Ga0501073_0036605 | Ga0501073_0036605_1904_2881 | 315 |
| 75 | 3300049741 | Ga0501079_0129654 | Ga0501079_0129654_637_1614 | 315 |
| 76 | 3300049742 | Ga0501080_0047205 | Ga0501080_0047205_391_1368 | 315 |
| 77 | 3300050511 | nmdc:mga08y16_17670_c1 | nmdc:mga08y16_17670_c1_4581_5528 | 315 |
| 78 | 3300060353 | Ga0501082_0136057 | Ga0501082_0136057_147_1124 | 315 |
| 79 | 3300009036 | Ga0105244_10003222 | Ga0105244_100032227 | 316 |
| 80 | 3300013307 | Ga0157372_10051324 | Ga0157372_100513243 | 316 |
| 81 | 3300013308 | Ga0157375_10005653 | Ga0157375_100056537 | 316 |
| 82 | 3300014325 | Ga0163163_10221202 | Ga0163163_102212022 | 316 |
| 83 | 3300025728 | Ga0207655_1001956 | Ga0207655_10019567 | 316 |
| 84 | 3300025728 | Ga0207655_1002348 | Ga0207655_10023489 | 316 |
| 85 | 3300031238 | Ga0265332_10110890 | Ga0265332_101108901 | 316 |
| 86 | 3300031711 | Ga0265314_10001687 | Ga0265314_100016872 | 316 |
| 87 | 3300049586 | Ga0501070_0023153 | Ga0501070_0023153_2709_3692 | 316 |
| 88 | 3300049585 | Ga0501069_0009278 | Ga0501069_0009278_418_1425 | 317 |
| 89 | 3300049744 | Ga0501083_0014666 | Ga0501083_0014666_4055_5062 | 317 |
| 90 | 3300060353 | Ga0501082_0019667 | Ga0501082_0019667_1194_2201 | 317 |
| 91 | 3300049824 | Ga0501045_0185452 | Ga0501045_0185452_250_1206 | 318 |
| 92 | 3300035410 | Ga0373924_0003730 | Ga0373924_0003730_800_1780 | 319 |
| 93 | 3300037471 | Ga0395905_0083949 | Ga0395905_0083949_54_1022 | 319 |
| 94 | 3300050507 | nmdc:mga05p37_2991_c1 | nmdc:mga05p37_2991_c1_1137_2102 | 320 |
| 95 | 3300050511 | nmdc:mga08y16_41071_c1 | nmdc:mga08y16_41071_c1_3593_4558 | 320 |
| 96 | 3300050513 | nmdc:mga0rr50_205_c1 | nmdc:mga0rr50_205_c1_14519_15484 | 320 |
| 97 | 3300050514 | nmdc:mga08x19_2208_c1 | nmdc:mga08x19_2208_c1_10274_11239 | 320 |
| 98 | 3300005327 | Ga0070658_10052631 | Ga0070658_100526312 | 321 |
| 99 | 3300013100 | Ga0157373_10254401 | Ga0157373_102544011 | 321 |
| 100 | 3300013104 | Ga0157370_10048208 | Ga0157370_100482083 | 321 |
| 101 | 3300025909 | Ga0207705_10116121 | Ga0207705_101161212 | 321 |
| 102 | 3300003316 | rootH1_10012394 | rootH1_100123945 | 322 |
| 103 | 3300003322 | rootL2_10018488 | rootL2_1001848845 | 322 |
| 104 | 3300036401 | Ga0373937_0459976 | Ga0373937_0459976_11_979 | 322 |
| 105 | 3300042013 | Ga0439456_030807 | Ga0439456_030807_160_1137 | 322 |
| 106 | 3300047321 | Ga0495676_0013029 | Ga0495676_0013029_1496_2509 | 322 |
| 107 | 3300048911 | Ga0496108_0085981 | Ga0496108_0085981_98_1078 | 322 |
| 108 | 3300048913 | Ga0496110_0097921 | Ga0496110_0097921_160_1140 | 322 |
| 109 | 3300049592 | Ga0501076_0112845 | Ga0501076_0112845_236_1204 | 322 |
| 110 | 3300003323 | rootH1_10128101 | rootH1_101281013 | 323 |
| 111 | 3300005340 | Ga0070689_100032071 | Ga0070689_1000320714 | 323 |
| 112 | 3300005445 | Ga0070708_100002248 | Ga0070708_10000224811 | 323 |
| 113 | 3300005614 | Ga0068856_100374366 | Ga0068856_1003743663 | 323 |
| 114 | 3300006852 | Ga0075433_10014903 | Ga0075433_100149037 | 323 |
| 115 | 3300007076 | Ga0075435_100055666 | Ga0075435_1000556665 | 323 |
| 116 | 3300025910 | Ga0207684_10055983 | Ga0207684_100559833 | 323 |
| 117 | 3300026078 | Ga0207702_10421275 | Ga0207702_104212752 | 323 |
| 118 | 3300027907 | Ga0207428_10059996 | Ga0207428_100599964 | 323 |
| 119 | 3300048929 | Ga0496126_0085316 | Ga0496126_0085316_1040_2023 | 323 |
| 120 | iso_pu_bacteria | 2511231022 | 2511364662 | 323 |
| 121 | iso_pu_bacteria | 2511231156 | 2511825091 | 323 |
| 122 | iso_pu_bacteria | 2599185248 | 2599768931 | 323 |
| 123 | iso_pu_bacteria | 2599185289 | 2599884715 | 323 |
| 124 | iso_pu_bacteria | 2599185291 | 2599896106 | 323 |
| 125 | iso_pu_bacteria | 2599185305 | 2599957992 | 323 |
| 126 | iso_pu_bacteria | 2599185313 | 2600003920 | 323 |
| 127 | iso_pu_bacteria | 2599185315 | 2600015715 | 323 |
| 128 | iso_pu_bacteria | 2599185321 | 2600050922 | 323 |
| 129 | iso_pu_bacteria | 2599185324 | 2600068992 | 323 |
| 130 | iso_pu_bacteria | 2600254931 | 2600362930 | 323 |
| 131 | iso_pu_bacteria | 2623620446 | 2624491274 | 323 |
| 132 | iso_pu_bacteria | 2643221565 | 2643844405 | 323 |
| 133 | iso_pu_bacteria | 2667528170 | 2671088800 | 323 |
| 134 | iso_pu_bacteria | 2773857670 | 2774119030 | 323 |
| 135 | iso_pu_bacteria | 2784132072 | 2784312669 | 323 |
| 136 | iso_pu_bacteria | 2808606377 | 2808931570 | 323 |
| 137 | iso_pu_bacteria | 2808606381 | 2808953655 | 323 |
| 138 | iso_pu_bacteria | 2808606382 | 2808956227 | 323 |
| 139 | iso_pu_bacteria | 2808606395 | 2809036124 | 323 |
| 140 | iso_pu_bacteria | 2818991456 | 2819654795 | 323 |
| 141 | iso_pu_bacteria | 2825651385 | 2825652128 | 323 |
| 142 | iso_pu_bacteria | 2860339153 | 2860345469 | 323 |
| 143 | iso_pu_bacteria | 2913036834 | 2913040220 | 323 |
| 144 | iso_pu_bacteria | 2919697872 | 2919701215 | 323 |
| 145 | iso_pu_bacteria | 2923586266 | 2923588287 | 323 |
| 146 | iso_pu_bacteria | 2931396565 | 2931402789 | 323 |
| 147 | iso_pu_bacteria | 2988728565 | 2988734041 | 323 |
| 148 | iso_pu_bacteria | 8015687852 | 8015690835 | 323 |
| 149 | iso_pu_bacteria | 8019775933 | 8019778172 | 323 |
| 150 | iso_pu_bacteria | 8056569372 | 8056574346 | 323 |
| 151 | 3300005329 | Ga0070683_100011978 | Ga0070683_1000119786 | 324 |
| 152 | 3300005354 | Ga0070675_100062092 | Ga0070675_1000620921 | 324 |
| 153 | 3300005365 | Ga0070688_100275666 | Ga0070688_1002756661 | 324 |
| 154 | 3300005445 | Ga0070708_100194035 | Ga0070708_1001940352 | 324 |
| 155 | 3300005458 | Ga0070681_10001886 | Ga0070681_1000188611 | 324 |
| 156 | 3300005467 | Ga0070706_100000124 | Ga0070706_10000012469 | 324 |
| 157 | 3300005467 | Ga0070706_100033891 | Ga0070706_1000338913 | 324 |
| 158 | 3300005468 | Ga0070707_100005141 | Ga0070707_1000051412 | 324 |
| 159 | 3300005468 | Ga0070707_100019507 | Ga0070707_1000195076 | 324 |
| 160 | 3300005536 | Ga0070697_100032629 | Ga0070697_1000326294 | 324 |
| 161 | 3300005617 | Ga0068859_100120565 | Ga0068859_1001205653 | 324 |
| 162 | 3300005834 | Ga0068851_10177225 | Ga0068851_101772252 | 324 |
| 163 | 3300005840 | Ga0068870_10202694 | Ga0068870_102026941 | 324 |
| 164 | 3300005981 | Ga0081538_10006701 | Ga0081538_100067018 | 324 |
| 165 | 3300006871 | Ga0075434_100008516 | Ga0075434_1000085164 | 324 |
| 166 | 3300006871 | Ga0075434_100110310 | Ga0075434_1001103102 | 324 |
| 167 | 3300006931 | Ga0097620_100120560 | Ga0097620_1001205602 | 324 |
| 168 | 3300009036 | Ga0105244_10001727 | Ga0105244_100017272 | 324 |
| 169 | 3300009148 | Ga0105243_10000026 | Ga0105243_100000268 | 324 |
| 170 | 3300009553 | Ga0105249_10276482 | Ga0105249_102764822 | 324 |
| 171 | 3300011119 | Ga0105246_10019156 | Ga0105246_100191563 | 324 |
| 172 | 3300013308 | Ga0157375_10092155 | Ga0157375_100921553 | 324 |
| 173 | 3300014497 | Ga0182008_10000496 | Ga0182008_1000049614 | 324 |
| 174 | 3300014745 | Ga0157377_10003910 | Ga0157377_100039106 | 324 |
| 175 | 3300015683 | Ga0183362_10002 | Ga0183362_10002123 | 324 |
| 176 | 3300025907 | Ga0207645_10020213 | Ga0207645_100202133 | 324 |
| 177 | 3300025908 | Ga0207643_10146556 | Ga0207643_101465562 | 324 |
| 178 | 3300025910 | Ga0207684_10000045 | Ga0207684_10000045157 | 324 |
| 179 | 3300025912 | Ga0207707_10003369 | Ga0207707_100033698 | 324 |
| 180 | 3300025922 | Ga0207646_10019447 | Ga0207646_100194472 | 324 |
| 181 | 3300025922 | Ga0207646_10093779 | Ga0207646_100937792 | 324 |
| 182 | 3300025933 | Ga0207706_10324295 | Ga0207706_103242952 | 324 |
| 183 | 3300025940 | Ga0207691_10061544 | Ga0207691_100615442 | 324 |
| 184 | 3300025960 | Ga0207651_10193904 | Ga0207651_101939041 | 324 |
| 185 | 3300025961 | Ga0207712_10207661 | Ga0207712_102076612 | 324 |
| 186 | 3300026118 | Ga0207675_100152288 | Ga0207675_1001522882 | 324 |
| 187 | 3300028800 | Ga0265338_10049605 | Ga0265338_100496054 | 324 |
| 188 | 3300035114 | Ga0373939_0010780 | Ga0373939_0010780_495_1472 | 324 |
| 189 | 3300042115 | Ga0450911_000551 | Ga0450911_000551_7887_8861 | 324 |
| 190 | 3300042876 | Ga0451577_0336187 | Ga0451577_0336187_307_1293 | 324 |
| 191 | 3300046459 | Ga0495629_0018317 | Ga0495629_0018317_1629_2603 | 324 |
| 192 | 3300046463 | Ga0495653_0018759 | Ga0495653_0018759_1438_2412 | 324 |
| 193 | 3300046474 | Ga0495605_0118265 | Ga0495605_0118265_29_1003 | 324 |
| 194 | 3300046511 | Ga0495608_0003654 | Ga0495608_0003654_775_1755 | 324 |
| 195 | 3300046523 | Ga0495644_0030858 | Ga0495644_0030858_267_1241 | 324 |
| 196 | 3300046536 | Ga0495587_0000877 | Ga0495587_0000877_17809_18783 | 324 |
| 197 | 3300046542 | Ga0495597_0071142 | Ga0495597_0071142_358_1332 | 324 |
| 198 | 3300046663 | Ga0495635_0024716 | Ga0495635_0024716_3075_4049 | 324 |
| 199 | 3300046680 | Ga0495646_0003686 | Ga0495646_0003686_3893_4867 | 324 |
| 200 | 3300047317 | Ga0495604_0013697 | Ga0495604_0013697_1598_2572 | 324 |
| 201 | 3300047320 | Ga0495672_0002093 | Ga0495672_0002093_1302_2276 | 324 |
| 202 | 3300047322 | Ga0495680_0000029 | Ga0495680_0000029_88891_89865 | 324 |
| 203 | 3300048912 | Ga0496109_0031625 | Ga0496109_0031625_3491_4477 | 324 |
| 204 | 3300049568 | Ga0501031_0163787 | Ga0501031_0163787_387_1367 | 324 |
| 205 | 3300049570 | Ga0501033_0016763 | Ga0501033_0016763_30_1010 | 324 |
| 206 | 3300049574 | Ga0501038_0379586 | Ga0501038_0379586_30_1010 | 324 |
| 207 | 3300049575 | Ga0501039_0169840 | Ga0501039_0169840_348_1328 | 324 |
| 208 | 3300049577 | Ga0501041_0056786 | Ga0501041_0056786_95_1072 | 324 |
| 209 | 3300049578 | Ga0501042_0047423 | Ga0501042_0047423_1148_2170 | 324 |
| 210 | 3300049579 | Ga0501043_0239250 | Ga0501043_0239250_78_1064 | 324 |
| 211 | 3300049580 | Ga0501046_0002435 | Ga0501046_0002435_16059_17039 | 324 |
| 212 | 3300049582 | Ga0501048_0020326 | Ga0501048_0020326_1445_2425 | 324 |
| 213 | 3300049583 | Ga0501067_0063125 | Ga0501067_0063125_1043_2023 | 324 |
| 214 | 3300049587 | Ga0501071_0084027 | Ga0501071_0084027_319_1299 | 324 |
| 215 | 3300049588 | Ga0501072_0006922 | Ga0501072_0006922_5735_6715 | 324 |
| 216 | 3300049591 | Ga0501075_0001993 | Ga0501075_0001993_11059_12039 | 324 |
| 217 | 3300049592 | Ga0501076_0048023 | Ga0501076_0048023_387_1367 | 324 |
| 218 | 3300049593 | Ga0501077_0048058 | Ga0501077_0048058_109_1083 | 324 |
| 219 | 3300049742 | Ga0501080_0123300 | Ga0501080_0123300_1034_2014 | 324 |
| 220 | 3300049743 | Ga0501081_0004345 | Ga0501081_0004345_3455_4435 | 324 |
| 221 | 3300049743 | Ga0501081_0011241 | Ga0501081_0011241_3380_4399 | 324 |
| 222 | 3300049744 | Ga0501083_0137461 | Ga0501083_0137461_30_1010 | 324 |
| 223 | 3300049822 | Ga0501035_0153614 | Ga0501035_0153614_933_1919 | 324 |
| 224 | 3300049822 | Ga0501035_0226768 | Ga0501035_0226768_87_1067 | 324 |
| 225 | 3300049824 | Ga0501045_0062102 | Ga0501045_0062102_988_1965 | 324 |
| 226 | 3300054114 | Ga0501084_0020252 | Ga0501084_0020252_1445_2425 | 324 |
| 227 | 3300054114 | Ga0501084_0131267 | Ga0501084_0131267_78_1064 | 324 |
| 228 | 3300060353 | Ga0501082_0033002 | Ga0501082_0033002_3455_4435 | 324 |
| 229 | 3300061734 | Ga0530510_0000918 | Ga0530510_0000918_7383_8363 | 324 |
| 230 | 3300061734 | Ga0530510_0257988 | Ga0530510_0257988_38_1024 | 324 |
| 231 | 3300005293 | Ga0065715_10224438 | Ga0065715_102244381 | 325 |
| 232 | 3300005333 | Ga0070677_10009694 | Ga0070677_100096941 | 325 |
| 233 | 3300005335 | Ga0070666_10027040 | Ga0070666_100270402 | 325 |
| 234 | 3300005343 | Ga0070687_100049937 | Ga0070687_1000499372 | 325 |
| 235 | 3300005344 | Ga0070661_100043394 | Ga0070661_1000433942 | 325 |
| 236 | 3300005347 | Ga0070668_100427026 | Ga0070668_1004270261 | 325 |
| 237 | 3300005548 | Ga0070665_100069746 | Ga0070665_1000697462 | 325 |
| 238 | 3300005843 | Ga0068860_100004545 | Ga0068860_1000045453 | 325 |
| 239 | 3300006038 | Ga0075365_10081952 | Ga0075365_100819522 | 325 |
| 240 | 3300006844 | Ga0075428_100193095 | Ga0075428_1001930951 | 325 |
| 241 | 3300009094 | Ga0111539_10451315 | Ga0111539_104513151 | 325 |
| 242 | 3300013308 | Ga0157375_10010826 | Ga0157375_100108265 | 325 |
| 243 | 3300014326 | Ga0157380_10004218 | Ga0157380_100042185 | 325 |
| 244 | 3300025918 | Ga0207662_10078463 | Ga0207662_100784632 | 325 |
| 245 | 3300025920 | Ga0207649_10151345 | Ga0207649_101513452 | 325 |
| 246 | 3300025923 | Ga0207681_10064076 | Ga0207681_100640763 | 325 |
| 247 | 3300026089 | Ga0207648_10048665 | Ga0207648_100486652 | 325 |
| 248 | 3300026121 | Ga0207683_10145286 | Ga0207683_101452862 | 325 |
| 249 | 3300050492 | nmdc:mga0yw44_21288_c1 | nmdc:mga0yw44_21288_c1_1186_2217 | 325 |
| 250 | 3300005434 | Ga0070709_10037836 | Ga0070709_100378362 | 326 |
| 251 | 3300005435 | Ga0070714_100428916 | Ga0070714_1004289161 | 326 |
| 252 | 3300005439 | Ga0070711_100202443 | Ga0070711_1002024431 | 326 |
| 253 | 3300006844 | Ga0075428_100338854 | Ga0075428_1003388542 | 326 |
| 254 | 3300013296 | Ga0157374_10000777 | Ga0157374_100007779 | 326 |
| 255 | 3300025906 | Ga0207699_10007119 | Ga0207699_100071194 | 326 |
| 256 | 3300025916 | Ga0207663_10090967 | Ga0207663_100909672 | 326 |
| 257 | 3300025929 | Ga0207664_10144690 | Ga0207664_101446902 | 326 |
| 258 | 3300030744 | Ga0316181_1227316 | Ga0316181_12273162 | 326 |
| 259 | 3300031731 | Ga0307405_10012674 | Ga0307405_100126742 | 326 |
| 260 | 3300032004 | Ga0307414_10260026 | Ga0307414_102600262 | 326 |
| 261 | 3300035724 | Ga0373933_0249473 | Ga0373933_0249473_109_1104 | 326 |
| 262 | 3300036401 | Ga0373937_0061901 | Ga0373937_0061901_186_1181 | 326 |
| 263 | 3300037853 | Ga0436364_1276281 | Ga0436364_1276281_5263_6249 | 326 |
| 264 | 3300046675 | Ga0495657_0084592 | Ga0495657_0084592_359_1354 | 326 |
| 265 | 3300049576 | Ga0501040_0082382 | Ga0501040_0082382_77_1069 | 326 |
| 266 | 3300049578 | Ga0501042_0033617 | Ga0501042_0033617_1363_2355 | 326 |
| 267 | 3300049591 | Ga0501075_0005332 | Ga0501075_0005332_2251_3243 | 326 |
| 268 | 3300049592 | Ga0501076_0003305 | Ga0501076_0003305_2543_3535 | 326 |
| 269 | 3300049593 | Ga0501077_0032891 | Ga0501077_0032891_2264_3256 | 326 |
| 270 | 3300049663 | Ga0501223_004683 | Ga0501223_004683_1621_2661 | 326 |
| 271 | 3300049741 | Ga0501079_0003080 | Ga0501079_0003080_139_1131 | 326 |
| 272 | 3300049742 | Ga0501080_0040971 | Ga0501080_0040971_899_1891 | 326 |
| 273 | 3300049823 | Ga0501044_0207745 | Ga0501044_0207745_253_1707 | 326 |
| 274 | 3300054114 | Ga0501084_0079221 | Ga0501084_0079221_247_1239 | 326 |
| 275 | 3300060353 | Ga0501082_0041923 | Ga0501082_0041923_327_1319 | 326 |
| 276 | 3300061734 | Ga0530510_0016789 | Ga0530510_0016789_2674_3666 | 326 |
| 277 | 3300002771 | JGI25163J39215_1000029 | JGI25163J39215_10000293 | 327 |
| 278 | 3300002772 | JGI25164J39214_1000096 | JGI25164J39214_100009659 | 327 |
| 279 | 3300003214 | JGI25165J46597_1000143 | JGI25165J46597_100014346 | 327 |
| 280 | 3300003322 | rootL2_10010090 | rootL2_100100909 | 327 |
| 281 | 3300005288 | Ga0065714_10002901 | Ga0065714_1000290112 | 327 |
| 282 | 3300005290 | Ga0065712_10069208 | Ga0065712_100692084 | 327 |
| 283 | 3300005293 | Ga0065715_10003077 | Ga0065715_100030774 | 327 |
| 284 | 3300005334 | Ga0068869_100051352 | Ga0068869_1000513523 | 327 |
| 285 | 3300005341 | Ga0070691_10003139 | Ga0070691_100031393 | 327 |
| 286 | 3300005344 | Ga0070661_100000062 | Ga0070661_10000006264 | 327 |
| 287 | 3300005344 | Ga0070661_100022191 | Ga0070661_1000221912 | 327 |
| 288 | 3300005434 | Ga0070709_10007786 | Ga0070709_100077863 | 327 |
| 289 | 3300005435 | Ga0070714_100104923 | Ga0070714_1001049232 | 327 |
| 290 | 3300005437 | Ga0070710_10043611 | Ga0070710_100436112 | 327 |
| 291 | 3300005439 | Ga0070711_100085944 | Ga0070711_1000859442 | 327 |
| 292 | 3300005445 | Ga0070708_100099061 | Ga0070708_1000990612 | 327 |
| 293 | 3300005458 | Ga0070681_10033626 | Ga0070681_100336263 | 327 |
| 294 | 3300005467 | Ga0070706_100320959 | Ga0070706_1003209592 | 327 |
| 295 | 3300005518 | Ga0070699_100168679 | Ga0070699_1001686792 | 327 |
| 296 | 3300005535 | Ga0070684_100317949 | Ga0070684_1003179492 | 327 |
| 297 | 3300005539 | Ga0068853_100001820 | Ga0068853_10000182012 | 327 |
| 298 | 3300005545 | Ga0070695_100004211 | Ga0070695_1000042115 | 327 |
| 299 | 3300005546 | Ga0070696_100001810 | Ga0070696_1000018109 | 327 |
| 300 | 3300005547 | Ga0070693_100005727 | Ga0070693_1000057271 | 327 |
| 301 | 3300005563 | Ga0068855_100013092 | Ga0068855_1000130923 | 327 |
| 302 | 3300005563 | Ga0068855_100067973 | Ga0068855_1000679733 | 327 |
| 303 | 3300005564 | Ga0070664_100000035 | Ga0070664_10000003565 | 327 |
| 304 | 3300005577 | Ga0068857_100000802 | Ga0068857_10000080210 | 327 |
| 305 | 3300005614 | Ga0068856_100003713 | Ga0068856_1000037137 | 327 |
| 306 | 3300005616 | Ga0068852_100041502 | Ga0068852_1000415022 | 327 |
| 307 | 3300005981 | Ga0081538_10020776 | Ga0081538_100207763 | 327 |
| 308 | 3300005983 | Ga0081540_1001134 | Ga0081540_100113410 | 327 |
| 309 | 3300006163 | Ga0070715_10034504 | Ga0070715_100345042 | 327 |
| 310 | 3300006844 | Ga0075428_100001345 | Ga0075428_10000134510 | 327 |
| 311 | 3300006844 | Ga0075428_100037201 | Ga0075428_1000372011 | 327 |
| 312 | 3300006846 | Ga0075430_100168245 | Ga0075430_1001682452 | 327 |
| 313 | 3300006847 | Ga0075431_100000499 | Ga0075431_10000049919 | 327 |
| 314 | 3300006847 | Ga0075431_100065561 | Ga0075431_1000655612 | 327 |
| 315 | 3300006852 | Ga0075433_10008240 | Ga0075433_100082403 | 327 |
| 316 | 3300006871 | Ga0075434_100043629 | Ga0075434_1000436292 | 327 |
| 317 | 3300006871 | Ga0075434_100056629 | Ga0075434_1000566291 | 327 |
| 318 | 3300006871 | Ga0075434_100094167 | Ga0075434_1000941672 | 327 |
| 319 | 3300006880 | Ga0075429_100000711 | Ga0075429_10000071115 | 327 |
| 320 | 3300006880 | Ga0075429_100067834 | Ga0075429_1000678342 | 327 |
| 321 | 3300006914 | Ga0075436_100002130 | Ga0075436_10000213014 | 327 |
| 322 | 3300006914 | Ga0075436_100025640 | Ga0075436_1000256403 | 327 |
| 323 | 3300006914 | Ga0075436_100045933 | Ga0075436_1000459333 | 327 |
| 324 | 3300007076 | Ga0075435_100022510 | Ga0075435_1000225105 | 327 |
| 325 | 3300007076 | Ga0075435_100058427 | Ga0075435_1000584273 | 327 |
| 326 | 3300007076 | Ga0075435_100079957 | Ga0075435_1000799572 | 327 |
| 327 | 3300009011 | Ga0105251_10004128 | Ga0105251_100041288 | 327 |
| 328 | 3300009036 | Ga0105244_10002982 | Ga0105244_1000298212 | 327 |
| 329 | 3300009092 | Ga0105250_10012347 | Ga0105250_100123473 | 327 |
| 330 | 3300009093 | Ga0105240_10001960 | Ga0105240_1000196019 | 327 |
| 331 | 3300009147 | Ga0114129_10000066 | Ga0114129_1000006631 | 327 |
| 332 | 3300009147 | Ga0114129_10012927 | Ga0114129_1001292711 | 327 |
| 333 | 3300009174 | Ga0105241_10001630 | Ga0105241_100016303 | 327 |
| 334 | 3300009545 | Ga0105237_10001963 | Ga0105237_100019635 | 327 |
| 335 | 3300009551 | Ga0105238_10001275 | Ga0105238_1000127519 | 327 |
| 336 | 3300010375 | Ga0105239_10011225 | Ga0105239_100112256 | 327 |
| 337 | 3300013100 | Ga0157373_10000796 | Ga0157373_100007965 | 327 |
| 338 | 3300013102 | Ga0157371_10000559 | Ga0157371_100005599 | 327 |
| 339 | 3300013104 | Ga0157370_10000803 | Ga0157370_1000080333 | 327 |
| 340 | 3300013104 | Ga0157370_10086960 | Ga0157370_100869602 | 327 |
| 341 | 3300013105 | Ga0157369_10011775 | Ga0157369_100117756 | 327 |
| 342 | 3300013307 | Ga0157372_10003383 | Ga0157372_1000338311 | 327 |
| 343 | 3300013307 | Ga0157372_10007744 | Ga0157372_100077445 | 327 |
| 344 | 3300013307 | Ga0157372_10038285 | Ga0157372_100382852 | 327 |
| 345 | 3300014325 | Ga0163163_10031805 | Ga0163163_100318052 | 327 |
| 346 | 3300014497 | Ga0182008_10002573 | Ga0182008_100025734 | 327 |
| 347 | 3300014968 | Ga0157379_10016139 | Ga0157379_100161392 | 327 |
| 348 | 3300015261 | Ga0182006_1000083 | Ga0182006_100008385 | 327 |
| 349 | 3300015262 | Ga0182007_10000086 | Ga0182007_1000008639 | 327 |
| 350 | 3300015265 | Ga0182005_1000675 | Ga0182005_100067513 | 327 |
| 351 | 3300015265 | Ga0182005_1000920 | Ga0182005_10009209 | 327 |
| 352 | 3300015265 | Ga0182005_1013655 | Ga0182005_10136552 | 327 |
| 353 | 3300017792 | Ga0163161_10020254 | Ga0163161_100202542 | 327 |
| 354 | 3300017792 | Ga0163161_10398898 | Ga0163161_103988981 | 327 |
| 355 | 3300021384 | Ga0213876_10001446 | Ga0213876_1000144612 | 327 |
| 356 | 3300025207 | Ga0209760_100049 | Ga0209760_10004919 | 327 |
| 357 | 3300025231 | Ga0207427_100048 | Ga0207427_100048183 | 327 |
| 358 | 3300025233 | Ga0209437_100094 | Ga0209437_100094183 | 327 |
| 359 | 3300025261 | Ga0209233_1000106 | Ga0209233_100010674 | 327 |
| 360 | 3300025711 | Ga0207696_1005135 | Ga0207696_10051353 | 327 |
| 361 | 3300025728 | Ga0207655_1000076 | Ga0207655_100007651 | 327 |
| 362 | 3300025728 | Ga0207655_1000481 | Ga0207655_100048114 | 327 |
| 363 | 3300025728 | Ga0207655_1001394 | Ga0207655_10013945 | 327 |
| 364 | 3300025735 | Ga0207713_1000777 | Ga0207713_10007775 | 327 |
| 365 | 3300025906 | Ga0207699_10075934 | Ga0207699_100759342 | 327 |
| 366 | 3300025906 | Ga0207699_10212184 | Ga0207699_102121841 | 327 |
| 367 | 3300025909 | Ga0207705_10034907 | Ga0207705_100349071 | 327 |
| 368 | 3300025912 | Ga0207707_10010161 | Ga0207707_100101612 | 327 |
| 369 | 3300025912 | Ga0207707_10103149 | Ga0207707_101031493 | 327 |
| 370 | 3300025913 | Ga0207695_10015247 | Ga0207695_100152478 | 327 |
| 371 | 3300025914 | Ga0207671_10005589 | Ga0207671_100055893 | 327 |
| 372 | 3300025919 | Ga0207657_10124599 | Ga0207657_101245993 | 327 |
| 373 | 3300025920 | Ga0207649_10000010 | Ga0207649_10000010107 | 327 |
| 374 | 3300025920 | Ga0207649_10014298 | Ga0207649_100142983 | 327 |
| 375 | 3300025924 | Ga0207694_10027462 | Ga0207694_100274622 | 327 |
| 376 | 3300025935 | Ga0207709_10000004 | Ga0207709_10000004144 | 327 |
| 377 | 3300025935 | Ga0207709_10122816 | Ga0207709_101228162 | 327 |
| 378 | 3300025939 | Ga0207665_10000939 | Ga0207665_1000093912 | 327 |
| 379 | 3300025939 | Ga0207665_10042830 | Ga0207665_100428302 | 327 |
| 380 | 3300025945 | Ga0207679_10000022 | Ga0207679_1000002223 | 327 |
| 381 | 3300025949 | Ga0207667_10003761 | Ga0207667_100037616 | 327 |
| 382 | 3300025949 | Ga0207667_10075639 | Ga0207667_100756394 | 327 |
| 383 | 3300026078 | Ga0207702_10003125 | Ga0207702_100031258 | 327 |
| 384 | 3300026116 | Ga0207674_10001713 | Ga0207674_1000171316 | 327 |
| 385 | 3300026142 | Ga0207698_10101910 | Ga0207698_101019102 | 327 |
| 386 | 3300026142 | Ga0207698_10285915 | Ga0207698_102859152 | 327 |
| 387 | 3300027907 | Ga0207428_10002687 | Ga0207428_100026878 | 327 |
| 388 | 3300027907 | Ga0207428_10003264 | Ga0207428_1000326415 | 327 |
| 389 | 3300028558 | Ga0265326_10001140 | Ga0265326_100011402 | 327 |
| 390 | 3300028563 | Ga0265319_1002341 | Ga0265319_10023419 | 327 |
| 391 | 3300028573 | Ga0265334_10022241 | Ga0265334_100222412 | 327 |
| 392 | 3300028577 | Ga0265318_10002005 | Ga0265318_100020053 | 327 |
| 393 | 3300028800 | Ga0265338_10005997 | Ga0265338_100059974 | 327 |
| 394 | 3300028800 | Ga0265338_10282045 | Ga0265338_102820452 | 327 |
| 395 | 3300031235 | Ga0265330_10000322 | Ga0265330_1000032211 | 327 |
| 396 | 3300031235 | Ga0265330_10006673 | Ga0265330_100066732 | 327 |
| 397 | 3300031238 | Ga0265332_10001221 | Ga0265332_100012216 | 327 |
| 398 | 3300031238 | Ga0265332_10016511 | Ga0265332_100165113 | 327 |
| 399 | 3300031238 | Ga0265332_10031950 | Ga0265332_100319503 | 327 |
| 400 | 3300031239 | Ga0265328_10004455 | Ga0265328_100044554 | 327 |
| 401 | 3300031240 | Ga0265320_10044421 | Ga0265320_100444213 | 327 |
| 402 | 3300031241 | Ga0265325_10000525 | Ga0265325_1000052520 | 327 |
| 403 | 3300031247 | Ga0265340_10090297 | Ga0265340_100902971 | 327 |
| 404 | 3300031249 | Ga0265339_10000889 | Ga0265339_100008895 | 327 |
| 405 | 3300031249 | Ga0265339_10004715 | Ga0265339_100047155 | 327 |
| 406 | 3300031249 | Ga0265339_10118736 | Ga0265339_101187362 | 327 |
| 407 | 3300031250 | Ga0265331_10000252 | Ga0265331_100002528 | 327 |
| 408 | 3300031250 | Ga0265331_10000502 | Ga0265331_1000050230 | 327 |
| 409 | 3300031250 | Ga0265331_10005406 | Ga0265331_100054063 | 327 |
| 410 | 3300031344 | Ga0265316_10000397 | Ga0265316_1000039733 | 327 |
| 411 | 3300031595 | Ga0265313_10001208 | Ga0265313_100012089 | 327 |
| 412 | 3300031595 | Ga0265313_10095359 | Ga0265313_100953592 | 327 |
| 413 | 3300031616 | Ga0307508_10094678 | Ga0307508_100946782 | 327 |
| 414 | 3300031691 | Ga0316579_10109100 | Ga0316579_101091001 | 327 |
| 415 | 3300031711 | Ga0265314_10000303 | Ga0265314_1000030333 | 327 |
| 416 | 3300031711 | Ga0265314_10001701 | Ga0265314_1000170112 | 327 |
| 417 | 3300031711 | Ga0265314_10002139 | Ga0265314_100021394 | 327 |
| 418 | 3300031712 | Ga0265342_10002593 | Ga0265342_1000259311 | 327 |
| 419 | 3300031712 | Ga0265342_10012477 | Ga0265342_100124776 | 327 |
| 420 | 3300031733 | Ga0316577_10046809 | Ga0316577_100468092 | 327 |
| 421 | 3300036401 | Ga0373937_0060910 | Ga0373937_0060910_641_1624 | 327 |
| 422 | 3300036401 | Ga0373937_0154564 | Ga0373937_0154564_586_1569 | 327 |
| 423 | 3300036647 | Ga0316582_0130492 | Ga0316582_0130492_519_1547 | 327 |
| 424 | 3300037312 | Ga0395899_0000743 | Ga0395899_0000743_11031_12014 | 327 |
| 425 | 3300037312 | Ga0395899_0035413 | Ga0395899_0035413_804_1820 | 327 |
| 426 | 3300037418 | Ga0395900_0004846 | Ga0395900_0004846_5091_6107 | 327 |
| 427 | 3300037418 | Ga0395900_0070047 | Ga0395900_0070047_218_1201 | 327 |
| 428 | 3300037466 | Ga0395898_0001561 | Ga0395898_0001561_20337_21320 | 327 |
| 429 | 3300037466 | Ga0395898_0002530 | Ga0395898_0002530_10353_11351 | 327 |
| 430 | 3300037466 | Ga0395898_0090994 | Ga0395898_0090994_976_1992 | 327 |
| 431 | 3300037853 | Ga0436364_0728550 | Ga0436364_0728550_29_1030 | 327 |
| 432 | 3300037853 | Ga0436364_0769865 | Ga0436364_0769865_15832_16836 | 327 |
| 433 | 3300038443 | Ga0395901_0000646 | Ga0395901_0000646_28921_29919 | 327 |
| 434 | 3300038443 | Ga0395901_0005139 | Ga0395901_0005139_1256_2239 | 327 |
| 435 | 3300038443 | Ga0395901_0007147 | Ga0395901_0007147_5969_6985 | 327 |
| 436 | 3300038443 | Ga0395901_0092621 | Ga0395901_0092621_1324_2340 | 327 |
| 437 | 3300039437 | Ga0436365_1387122 | Ga0436365_1387122_11119_12123 | 327 |
| 438 | 3300041405 | Ga0439438_000672 | Ga0439438_000672_13968_14951 | 327 |
| 439 | 3300041405 | Ga0439438_003319 | Ga0439438_003319_3685_4668 | 327 |
| 440 | 3300041407 | Ga0439447_000020 | Ga0439447_000020_29397_30380 | 327 |
| 441 | 3300041407 | Ga0439447_006525 | Ga0439447_006525_388_1371 | 327 |
| 442 | 3300041411 | Ga0439466_0000031 | Ga0439466_0000031_29212_30195 | 327 |
| 443 | 3300041411 | Ga0439466_0000658 | Ga0439466_0000658_388_1371 | 327 |
| 444 | 3300041411 | Ga0439466_0002398 | Ga0439466_0002398_5976_6959 | 327 |
| 445 | 3300041411 | Ga0439466_0006795 | Ga0439466_0006795_2383_3420 | 327 |
| 446 | 3300041411 | Ga0439466_0037725 | Ga0439466_0037725_466_1449 | 327 |
| 447 | 3300041413 | Ga0439465_0009278 | Ga0439465_0009278_1355_2338 | 327 |
| 448 | 3300042006 | Ga0439432_000447 | Ga0439432_000447_388_1371 | 327 |
| 449 | 3300042009 | Ga0439451_000525 | Ga0439451_000525_538_1560 | 327 |
| 450 | 3300042009 | Ga0439451_005874 | Ga0439451_005874_232_1215 | 327 |
| 451 | 3300042010 | Ga0439452_000124 | Ga0439452_000124_15362_16399 | 327 |
| 452 | 3300042010 | Ga0439452_016281 | Ga0439452_016281_388_1371 | 327 |
| 453 | 3300042010 | Ga0439452_028649 | Ga0439452_028649_33_1016 | 327 |
| 454 | 3300042013 | Ga0439456_004007 | Ga0439456_004007_1792_2775 | 327 |
| 455 | 3300042016 | Ga0439463_018749 | Ga0439463_018749_126_1109 | 327 |
| 456 | 3300042121 | Ga0450919_000050 | Ga0450919_000050_5473_6456 | 327 |
| 457 | 3300042127 | Ga0450890_000057 | Ga0450890_000057_2302_3285 | 327 |
| 458 | 3300042134 | Ga0450898_001491 | Ga0450898_001491_1347_2369 | 327 |
| 459 | 3300042138 | Ga0450903_004903 | Ga0450903_004903_637_1620 | 327 |
| 460 | 3300042147 | Ga0450910_004080 | Ga0450910_004080_116_1099 | 327 |
| 461 | 3300042156 | Ga0439446_0000293 | Ga0439446_0000293_3986_4969 | 327 |
| 462 | 3300042184 | Ga0450908_000297 | Ga0450908_000297_5643_6626 | 327 |
| 463 | 3300042461 | Ga0439460_0000026 | Ga0439460_0000026_3557_4540 | 327 |
| 464 | 3300042461 | Ga0439460_0003892 | Ga0439460_0003892_2254_3237 | 327 |
| 465 | 3300042532 | Ga0450893_0000432 | Ga0450893_0000432_390_1373 | 327 |
| 466 | 3300042876 | Ga0451577_0079170 | Ga0451577_0079170_1038_2021 | 327 |
| 467 | 3300042993 | Ga0439440_0003033 | Ga0439440_0003033_561_1544 | 327 |
| 468 | 3300042993 | Ga0439440_0003557 | Ga0439440_0003557_1409_2392 | 327 |
| 469 | 3300044693 | Ga0466961_0019820 | Ga0466961_0019820_1260_2267 | 327 |
| 470 | 3300045051 | Ga0451576_0017935 | Ga0451576_0017935_1566_2549 | 327 |
| 471 | 3300045976 | Ga0466967_0184002 | Ga0466967_0184002_164_1162 | 327 |
| 472 | 3300046455 | Ga0495603_0156743 | Ga0495603_0156743_204_1187 | 327 |
| 473 | 3300046457 | Ga0495590_0006914 | Ga0495590_0006914_1954_2937 | 327 |
| 474 | 3300046458 | Ga0495591_009988 | Ga0495591_009988_158_1141 | 327 |
| 475 | 3300046460 | Ga0495638_0000262 | Ga0495638_0000262_52052_53035 | 327 |
| 476 | 3300046463 | Ga0495653_0005310 | Ga0495653_0005310_3059_4042 | 327 |
| 477 | 3300046463 | Ga0495653_0006799 | Ga0495653_0006799_3921_4904 | 327 |
| 478 | 3300046473 | Ga0495582_0004180 | Ga0495582_0004180_4320_5303 | 327 |
| 479 | 3300046474 | Ga0495605_0002203 | Ga0495605_0002203_4209_5192 | 327 |
| 480 | 3300046474 | Ga0495605_0010703 | Ga0495605_0010703_2886_3869 | 327 |
| 481 | 3300046475 | Ga0495639_0000001 | Ga0495639_0000001_136430_137413 | 327 |
| 482 | 3300046475 | Ga0495639_0008341 | Ga0495639_0008341_1755_2738 | 327 |
| 483 | 3300046491 | Ga0495584_0000111 | Ga0495584_0000111_38153_39136 | 327 |
| 484 | 3300046492 | Ga0495585_0000001 | Ga0495585_0000001_220131_221114 | 327 |
| 485 | 3300046499 | Ga0495594_0000150 | Ga0495594_0000150_4394_5377 | 327 |
| 486 | 3300046499 | Ga0495594_0010336 | Ga0495594_0010336_2187_3170 | 327 |
| 487 | 3300046499 | Ga0495594_0025741 | Ga0495594_0025741_2165_3148 | 327 |
| 488 | 3300046501 | Ga0495607_0002925 | Ga0495607_0002925_8902_9885 | 327 |
| 489 | 3300046506 | Ga0495583_0001020 | Ga0495583_0001020_23927_24910 | 327 |
| 490 | 3300046506 | Ga0495583_0002091 | Ga0495583_0002091_11092_12075 | 327 |
| 491 | 3300046506 | Ga0495583_0004168 | Ga0495583_0004168_2463_3446 | 327 |
| 492 | 3300046511 | Ga0495608_0004988 | Ga0495608_0004988_3936_4922 | 327 |
| 493 | 3300046518 | Ga0495631_0000078 | Ga0495631_0000078_18877_19860 | 327 |
| 494 | 3300046519 | Ga0495632_0006777 | Ga0495632_0006777_3809_4792 | 327 |
| 495 | 3300046523 | Ga0495644_0000017 | Ga0495644_0000017_17872_18855 | 327 |
| 496 | 3300046524 | Ga0495648_0000990 | Ga0495648_0000990_4974_5957 | 327 |
| 497 | 3300046526 | Ga0495666_0000079 | Ga0495666_0000079_29537_30520 | 327 |
| 498 | 3300046526 | Ga0495666_0001238 | Ga0495666_0001238_8811_9794 | 327 |
| 499 | 3300046526 | Ga0495666_0014846 | Ga0495666_0014846_970_1953 | 327 |
| 500 | 3300046526 | Ga0495666_0018713 | Ga0495666_0018713_1867_2850 | 327 |
| 501 | 3300046530 | Ga0495654_0000088 | Ga0495654_0000088_48466_49449 | 327 |
| 502 | 3300046536 | Ga0495587_0002643 | Ga0495587_0002643_1918_2901 | 327 |
| 503 | 3300046539 | Ga0495621_0038761 | Ga0495621_0038761_331_1329 | 327 |
| 504 | 3300046557 | Ga0495622_0000347 | Ga0495622_0000347_31803_32786 | 327 |
| 505 | 3300046557 | Ga0495622_0000448 | Ga0495622_0000448_24669_25652 | 327 |
| 506 | 3300046559 | Ga0495667_0000398 | Ga0495667_0000398_12888_13874 | 327 |
| 507 | 3300046642 | Ga0495634_0000620 | Ga0495634_0000620_26842_27825 | 327 |
| 508 | 3300046648 | Ga0495611_0003467 | Ga0495611_0003467_4666_5649 | 327 |
| 509 | 3300046663 | Ga0495635_0000441 | Ga0495635_0000441_6949_7932 | 327 |
| 510 | 3300046664 | Ga0495659_0000002 | Ga0495659_0000002_132930_133913 | 327 |
| 511 | 3300046665 | Ga0495661_0000104 | Ga0495661_0000104_25418_26401 | 327 |
| 512 | 3300046679 | Ga0495623_0000261 | Ga0495623_0000261_6674_7657 | 327 |
| 513 | 3300046679 | Ga0495623_0002508 | Ga0495623_0002508_8858_9841 | 327 |
| 514 | 3300046680 | Ga0495646_0001696 | Ga0495646_0001696_5514_6497 | 327 |
| 515 | 3300046689 | Ga0495613_0001223 | Ga0495613_0001223_16544_17527 | 327 |
| 516 | 3300046689 | Ga0495613_0044800 | Ga0495613_0044800_2159_3142 | 327 |
| 517 | 3300046691 | Ga0495670_0038379 | Ga0495670_0038379_1173_2156 | 327 |
| 518 | 3300046692 | Ga0495671_0064856 | Ga0495671_0064856_280_1263 | 327 |
| 519 | 3300046694 | Ga0495649_0000113 | Ga0495649_0000113_15921_16904 | 327 |
| 520 | 3300046794 | Ga0495589_0026715 | Ga0495589_0026715_805_1788 | 327 |
| 521 | 3300046809 | Ga0495600_0011054 | Ga0495600_0011054_727_1710 | 327 |
| 522 | 3300046809 | Ga0495600_0061111 | Ga0495600_0061111_1231_2214 | 327 |
| 523 | 3300046810 | Ga0495660_0001594 | Ga0495660_0001594_9677_10660 | 327 |
| 524 | 3300046810 | Ga0495660_0010813 | Ga0495660_0010813_1760_2743 | 327 |
| 525 | 3300047315 | Ga0495581_0016418 | Ga0495581_0016418_1832_2815 | 327 |
| 526 | 3300047317 | Ga0495604_0004315 | Ga0495604_0004315_7672_8655 | 327 |
| 527 | 3300047317 | Ga0495604_0044340 | Ga0495604_0044340_41_1024 | 327 |
| 528 | 3300047319 | Ga0495674_0008489 | Ga0495674_0008489_6620_7603 | 327 |
| 529 | 3300047320 | Ga0495672_0000440 | Ga0495672_0000440_19366_20349 | 327 |
| 530 | 3300047320 | Ga0495672_0104517 | Ga0495672_0104517_488_1471 | 327 |
| 531 | 3300047321 | Ga0495676_0206971 | Ga0495676_0206971_160_1167 | 327 |
| 532 | 3300047322 | Ga0495680_0006253 | Ga0495680_0006253_2038_3021 | 327 |
| 533 | 3300047322 | Ga0495680_0010856 | Ga0495680_0010856_4568_5551 | 327 |
| 534 | 3300047322 | Ga0495680_0027586 | Ga0495680_0027586_875_2029 | 327 |
| 535 | 3300047323 | Ga0495683_0002618 | Ga0495683_0002618_2432_3415 | 327 |
| 536 | 3300047443 | Ga0495687_003006 | Ga0495687_003006_11540_12523 | 327 |
| 537 | 3300047443 | Ga0495687_028034 | Ga0495687_028034_633_1619 | 327 |
| 538 | 3300047443 | Ga0495687_076272 | Ga0495687_076272_131_1114 | 327 |
| 539 | 3300047444 | Ga0495675_0010528 | Ga0495675_0010528_122_1105 | 327 |
| 540 | 3300047469 | Ga0495673_0000261 | Ga0495673_0000261_56172_57155 | 327 |
| 541 | 3300047673 | Ga0495593_0000441 | Ga0495593_0000441_15392_16375 | 327 |
| 542 | 3300047673 | Ga0495593_0002452 | Ga0495593_0002452_5475_6500 | 327 |
| 543 | 3300048091 | Ga0495626_0000031 | Ga0495626_0000031_148852_149835 | 327 |
| 544 | 3300048904 | Ga0496101_0153798 | Ga0496101_0153798_83_1081 | 327 |
| 545 | 3300048905 | Ga0496102_0001084 | Ga0496102_0001084_17576_18559 | 327 |
| 546 | 3300048906 | Ga0496103_0000690 | Ga0496103_0000690_6574_7557 | 327 |
| 547 | 3300048907 | Ga0496104_0071740 | Ga0496104_0071740_1669_2667 | 327 |
| 548 | 3300048908 | Ga0496105_0056075 | Ga0496105_0056075_652_1650 | 327 |
| 549 | 3300048909 | Ga0496106_0243336 | Ga0496106_0243336_168_1151 | 327 |
| 550 | 3300048912 | Ga0496109_0040556 | Ga0496109_0040556_1144_2142 | 327 |
| 551 | 3300048913 | Ga0496110_0025914 | Ga0496110_0025914_1495_2478 | 327 |
| 552 | 3300048913 | Ga0496110_0051355 | Ga0496110_0051355_886_1869 | 327 |
| 553 | 3300048913 | Ga0496110_0073253 | Ga0496110_0073253_642_1625 | 327 |
| 554 | 3300048914 | Ga0496111_0012974 | Ga0496111_0012974_1984_2967 | 327 |
| 555 | 3300048914 | Ga0496111_0111911 | Ga0496111_0111911_160_1158 | 327 |
| 556 | 3300048915 | Ga0496112_0094681 | Ga0496112_0094681_983_1966 | 327 |
| 557 | 3300048919 | Ga0496116_0000475 | Ga0496116_0000475_41997_42980 | 327 |
| 558 | 3300048919 | Ga0496116_0016061 | Ga0496116_0016061_1067_2050 | 327 |
| 559 | 3300048920 | Ga0496117_0007397 | Ga0496117_0007397_4033_5016 | 327 |
| 560 | 3300048920 | Ga0496117_0016634 | Ga0496117_0016634_716_1699 | 327 |
| 561 | 3300048921 | Ga0496118_0004367 | Ga0496118_0004367_14402_15385 | 327 |
| 562 | 3300048925 | Ga0496122_0002729 | Ga0496122_0002729_17252_18235 | 327 |
| 563 | 3300048926 | Ga0496123_0085455 | Ga0496123_0085455_271_1254 | 327 |
| 564 | 3300048927 | Ga0496124_0001409 | Ga0496124_0001409_17807_18790 | 327 |
| 565 | 3300048927 | Ga0496124_0025547 | Ga0496124_0025547_437_1420 | 327 |
| 566 | 3300048928 | Ga0496125_0000410 | Ga0496125_0000410_18391_19374 | 327 |
| 567 | 3300049459 | Ga0495678_001076 | Ga0495678_001076_10790_11773 | 327 |
| 568 | 3300049460 | Ga0495682_0000106 | Ga0495682_0000106_13945_14928 | 327 |
| 569 | 3300049576 | Ga0501040_0074659 | Ga0501040_0074659_655_1656 | 327 |
| 570 | 3300049577 | Ga0501041_0010090 | Ga0501041_0010090_4021_5052 | 327 |
| 571 | 3300049579 | Ga0501043_0173950 | Ga0501043_0173950_80_1111 | 327 |
| 572 | 3300049580 | Ga0501046_0051480 | Ga0501046_0051480_1922_2953 | 327 |
| 573 | 3300049587 | Ga0501071_0241018 | Ga0501071_0241018_278_1309 | 327 |
| 574 | 3300049587 | Ga0501071_0251333 | Ga0501071_0251333_308_1309 | 327 |
| 575 | 3300049590 | Ga0501074_0274543 | Ga0501074_0274543_82_1113 | 327 |
| 576 | 3300049591 | Ga0501075_0016477 | Ga0501075_0016477_25_1056 | 327 |
| 577 | 3300049591 | Ga0501075_0069962 | Ga0501075_0069962_311_1312 | 327 |
| 578 | 3300049592 | Ga0501076_0117833 | Ga0501076_0117833_700_1731 | 327 |
| 579 | 3300049592 | Ga0501076_0255100 | Ga0501076_0255100_304_1305 | 327 |
| 580 | 3300049593 | Ga0501077_0001429 | Ga0501077_0001429_2908_3909 | 327 |
| 581 | 3300049741 | Ga0501079_0041926 | Ga0501079_0041926_1333_2334 | 327 |
| 582 | 3300049742 | Ga0501080_0235306 | Ga0501080_0235306_165_1196 | 327 |
| 583 | 3300049742 | Ga0501080_0442074 | Ga0501080_0442074_36_1037 | 327 |
| 584 | 3300049824 | Ga0501045_0116181 | Ga0501045_0116181_370_1371 | 327 |
| 585 | 3300049824 | Ga0501045_0118558 | Ga0501045_0118558_170_1201 | 327 |
| 586 | 3300050507 | nmdc:mga05p37_30364_c1 | nmdc:mga05p37_30364_c1_3600_4616 | 327 |
| 587 | 3300050507 | nmdc:mga05p37_879_c1 | nmdc:mga05p37_879_c1_12798_13874 | 327 |
| 588 | 3300050508 | nmdc:mga09592_697_c1 | nmdc:mga09592_697_c1_13292_14368 | 327 |
| 589 | 3300050508 | nmdc:mga09592_97874_c1 | nmdc:mga09592_97874_c1_1451_2437 | 327 |
| 590 | 3300050510 | nmdc:mga06r32_28617_c1 | nmdc:mga06r32_28617_c1_1192_2208 | 327 |
| 591 | 3300050510 | nmdc:mga06r32_394_c1 | nmdc:mga06r32_394_c1_5118_6194 | 327 |
| 592 | 3300050511 | nmdc:mga08y16_1049_c1 | nmdc:mga08y16_1049_c1_3870_4946 | 327 |
| 593 | 3300050512 | nmdc:mga0n895_113096_c1 | nmdc:mga0n895_113096_c1_1059_2069 | 327 |
| 594 | 3300050513 | nmdc:mga0rr50_17172_c1 | nmdc:mga0rr50_17172_c1_217_1212 | 327 |
| 595 | 3300050513 | nmdc:mga0rr50_75455_c1 | nmdc:mga0rr50_75455_c1_717_1700 | 327 |
| 596 | 3300050514 | nmdc:mga08x19_14975_c1 | nmdc:mga08x19_14975_c1_194_1177 | 327 |
| 597 | 3300050514 | nmdc:mga08x19_3171_c1 | nmdc:mga08x19_3171_c1_485_1501 | 327 |
| 598 | 3300053084 | Ga0495595_0040572 | Ga0495595_0040572_776_1930 | 327 |
| 599 | 3300053730 | Ga0500645_001001 | Ga0500645_001001_13082_14065 | 327 |
| 600 | 3300054114 | Ga0501084_0000042 | Ga0501084_0000042_63485_64471 | 327 |
| 601 | 3300054114 | Ga0501084_0000978 | Ga0501084_0000978_16710_17741 | 327 |
| 602 | 3300060353 | Ga0501082_0047293 | Ga0501082_0047293_2119_3150 | 327 |
| 603 | 3300060353 | Ga0501082_0145516 | Ga0501082_0145516_821_1822 | 327 |
| 604 | 3300061734 | Ga0530510_0036432 | Ga0530510_0036432_1761_2792 | 327 |
| 605 | 3300061734 | Ga0530510_0134932 | Ga0530510_0134932_289_1290 | 327 |
| 606 | 2162886011 | MRS1b_contig_9156956 | MRS1b_0592.00002970 | 328 |
| 607 | 3300005290 | Ga0065712_10068215 | Ga0065712_1006821510 | 328 |
| 608 | 3300005331 | Ga0070670_100051581 | Ga0070670_1000515815 | 328 |
| 609 | 3300005331 | Ga0070670_100249923 | Ga0070670_1002499232 | 328 |
| 610 | 3300005334 | Ga0068869_100207090 | Ga0068869_1002070902 | 328 |
| 611 | 3300005335 | Ga0070666_10022333 | Ga0070666_100223332 | 328 |
| 612 | 3300005336 | Ga0070680_100141305 | Ga0070680_1001413051 | 328 |
| 613 | 3300005340 | Ga0070689_100044183 | Ga0070689_1000441835 | 328 |
| 614 | 3300005353 | Ga0070669_100020230 | Ga0070669_1000202302 | 328 |
| 615 | 3300005354 | Ga0070675_100120440 | Ga0070675_1001204402 | 328 |
| 616 | 3300005355 | Ga0070671_100121957 | Ga0070671_1001219571 | 328 |
| 617 | 3300005367 | Ga0070667_100274968 | Ga0070667_1002749681 | 328 |
| 618 | 3300005459 | Ga0068867_100163777 | Ga0068867_1001637772 | 328 |
| 619 | 3300005471 | Ga0070698_100247966 | Ga0070698_1002479662 | 328 |
| 620 | 3300005549 | Ga0070704_100145746 | Ga0070704_1001457462 | 328 |
| 621 | 3300005844 | Ga0068862_100143065 | Ga0068862_1001430652 | 328 |
| 622 | 3300006358 | Ga0068871_100106942 | Ga0068871_1001069422 | 328 |
| 623 | 3300006847 | Ga0075431_100237076 | Ga0075431_1002370762 | 328 |
| 624 | 3300006852 | Ga0075433_10071796 | Ga0075433_100717962 | 328 |
| 625 | 3300006871 | Ga0075434_100037518 | Ga0075434_1000375182 | 328 |
| 626 | 3300006871 | Ga0075434_100038555 | Ga0075434_1000385553 | 328 |
| 627 | 3300006881 | Ga0068865_100133990 | Ga0068865_1001339901 | 328 |
| 628 | 3300009094 | Ga0111539_10000313 | Ga0111539_1000031341 | 328 |
| 629 | 3300009094 | Ga0111539_10034521 | Ga0111539_100345211 | 328 |
| 630 | 3300009147 | Ga0114129_10143210 | Ga0114129_101432104 | 328 |
| 631 | 3300017792 | Ga0163161_10123250 | Ga0163161_101232503 | 328 |
| 632 | 3300025903 | Ga0207680_10029395 | Ga0207680_100293953 | 328 |
| 633 | 3300025926 | Ga0207659_10290877 | Ga0207659_102908772 | 328 |
| 634 | 3300025936 | Ga0207670_10121556 | Ga0207670_101215561 | 328 |
| 635 | 3300025938 | Ga0207704_10107453 | Ga0207704_101074531 | 328 |
| 636 | 3300025940 | Ga0207691_10046572 | Ga0207691_100465721 | 328 |
| 637 | 3300025942 | Ga0207689_10130345 | Ga0207689_101303452 | 328 |
| 638 | 3300025942 | Ga0207689_10223473 | Ga0207689_102234732 | 328 |
| 639 | 3300025945 | Ga0207679_10121748 | Ga0207679_101217482 | 328 |
| 640 | 3300026075 | Ga0207708_10084885 | Ga0207708_100848851 | 328 |
| 641 | 3300027907 | Ga0207428_10042671 | Ga0207428_100426712 | 328 |
| 642 | 3300035172 | Ga0373955_0124613 | Ga0373955_0124613_316_1302 | 328 |
| 643 | 3300035724 | Ga0373933_0019008 | Ga0373933_0019008_1553_2539 | 328 |
| 644 | 3300036401 | Ga0373937_0253348 | Ga0373937_0253348_614_1600 | 328 |
| 645 | 3300045976 | Ga0466967_0590907 | Ga0466967_0590907_57_1049 | 328 |
| 646 | 3300046691 | Ga0495670_0064033 | Ga0495670_0064033_681_1667 | 328 |
| 647 | 3300048912 | Ga0496109_0071421 | Ga0496109_0071421_1189_2175 | 328 |
| 648 | 3300048916 | Ga0496113_0138174 | Ga0496113_0138174_359_1345 | 328 |
| 649 | 3300049575 | Ga0501039_0073686 | Ga0501039_0073686_1153_2139 | 328 |
| 650 | 3300049582 | Ga0501048_0051900 | Ga0501048_0051900_1339_2325 | 328 |
| 651 | 3300049588 | Ga0501072_0020235 | Ga0501072_0020235_1093_2133 | 328 |
| 652 | 3300049591 | Ga0501075_0042799 | Ga0501075_0042799_202_1188 | 328 |
| 653 | 3300049592 | Ga0501076_0046292 | Ga0501076_0046292_1148_2134 | 328 |
| 654 | 3300049741 | Ga0501079_0148053 | Ga0501079_0148053_322_1308 | 328 |
| 655 | 3300049742 | Ga0501080_0320556 | Ga0501080_0320556_90_1076 | 328 |
| 656 | 3300049824 | Ga0501045_0055158 | Ga0501045_0055158_68_1054 | 328 |
| 657 | 3300050510 | nmdc:mga06r32_112269_c1 | nmdc:mga06r32_112269_c1_1390_2382 | 328 |
| 658 | 3300050512 | nmdc:mga0n895_45332_c1 | nmdc:mga0n895_45332_c1_819_1805 | 328 |
| 659 | 3300050515 | nmdc:mga0a205_20010_c1 | nmdc:mga0a205_20010_c1_3419_4405 | 328 |
| 660 | 3300050515 | nmdc:mga0a205_271560_c1 | nmdc:mga0a205_271560_c1_286_1272 | 328 |
| 661 | 3300054114 | Ga0501084_0030858 | Ga0501084_0030858_1589_2575 | 328 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1rjw-assembly1.cif.gz_C | crystal structure of nad(+)-dependent alcohol dehydrogenase from bacillus stearothermophilus strain lld-r | 0.9406 | 1 | 327 |
| 4z6k-assembly1.cif.gz_B | alcohol dehydrogenase from the antarctic psychrophile moraxella sp. tae 123 | 0.9403 | 1 | 328 |
| 6iqd-assembly1.cif.gz_A | crystal structure of alcohol dehydrogenase from geobacillus stearothermophilus | 0.9391 | 1 | 328 |
| 4z6k-assembly1.cif.gz_B | alcohol dehydrogenase from the antarctic psychrophile moraxella sp. tae 123 | 0.9376 | 1 | 328 |
| 6iqd-assembly1.cif.gz_A | crystal structure of alcohol dehydrogenase from geobacillus stearothermophilus | 0.9363 | 1 | 328 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WQC1_8_164_3.90.180.10 | Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain | 0.9718 | 1 | 147 | 3.90.180.10 |
| af_Q2G0G1_1_137_3.90.180.10 | Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain | 0.9473 | 1 | 139 | 3.90.180.10 |
| 1rjwC01 | Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain | 0.9429 | 1 | 327 | 3.90.180.10 |
| af_Q2G2C7_1_145_3.90.180.10 | Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain | 0.94 | 1 | 144 | 3.90.180.10 |
| af_Q556G1_5_141_3.90.180.10 | Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain | 0.9365 | 1 | 135 | 3.90.180.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6P5UT19-F1-model_v4 | deleted | 0.9858 | 1 | 328 |
|
| AF-H7GGA1-F1-model_v4 | Zinc-binding alcohol dehydrogenase family protein | 0.9846 | 1 | 328 |
GO:0004022
GO:0005737 |
| AF-A0A6P5UT19-F1-model_v4 | deleted | 0.9829 | 1 | 328 |
|
| AF-A0A831KP22-F1-model_v4 | Alcohol dehydrogenase | 0.9812 | 1 | 246 |
GO:0004022
GO:0005737 GO:0008270 |
| AF-A0A839ZTP5-F1-model_v4 | Propanol-preferring alcohol dehydrogenase (EC 1.1.1.1) | 0.9798 | 57 | 328 |
GO:0004022
GO:0005737 GO:0008270 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar