F473382

General Info

Members Datasets Scaffolds Average Seq Length
661 391 630 328

Family's Representative Sequence

Representative Sequence 3300005518|Ga0070699_100168679|Ga0070699_1001686792
Length 384
Sequence MIVPLIERAEASESFDGSQEDWRNSRRGGVQPLRCRRHCCTNVSLNMTARFDMASSMRAMVLERARDPLRQRTDIVVREPAPHEVLVRVHACGVCRTDLHIVDGELSGAKRDLVPGHEIVGAVSAVGKDVSRLAVGDRVGVPWLGWTCGNCKYCLSGRENLCDRARFTGYDLDGGYAEFTLADERYCFKLPAAYSDAEAAPLLCAGLIGFRALSMAGSGKRLGLYGFGAAAHIAIQIARYRGQEVFAFTQRNDKEGQDFARSLGAAWAGGSDEMPPEQLDGAILFAPVGALVPAALAATAKGGTVVCAGIHMSDIPAFPYRLLWGERSLCSVANLTRRDGDDFLDIAQKANVRTTVERFPLADANLALNRLRHGLIEGAAVLVP

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2511231022 Pseudomonas sp. GM79 Isolate Nodule
3 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
4 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
5 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
6 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
7 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
8 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
9 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
10 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
11 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
12 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
13 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
14 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
15 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
16 2773857670 Pseudomonas sp. 478 Isolate Unclassified
17 2784132072 Pseudomonas sp. 460 Isolate Unclassified
18 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
19 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
20 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
21 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
22 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
23 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
24 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
25 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
26 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
27 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
28 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
29 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
30 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
31 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
32 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
33 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
34 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
35 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
36 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
37 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
38 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
39 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
40 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
41 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
42 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
43 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
44 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
45 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
46 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
47 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
48 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
49 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
50 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
51 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
52 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
53 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
54 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
55 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
56 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
57 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
58 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
59 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
60 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
61 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
62 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
63 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
64 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
65 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
66 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
67 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
68 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
69 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
70 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
71 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
72 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
73 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
74 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
75 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
76 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
77 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
78 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
79 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
80 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
81 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
82 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
83 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
84 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
85 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
86 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
87 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
88 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
89 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
90 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
91 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
92 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
93 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
94 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
95 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
96 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
97 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
98 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
99 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
100 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
101 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
102 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
103 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
104 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
105 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
106 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
107 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
108 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
109 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
110 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
111 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
112 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
113 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
114 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
115 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
116 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
117 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
118 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
119 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
120 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
121 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
122 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
123 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
124 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
125 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
126 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
127 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
128 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
129 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
130 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
131 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
132 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
133 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
134 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
135 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
136 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
137 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
138 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
139 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
140 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
141 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
142 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
143 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
144 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
145 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
146 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
190 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
191 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
192 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
193 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
194 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
195 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
196 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
197 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
198 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
199 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
200 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
201 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
202 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
203 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
204 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
205 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
206 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
207 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
208 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
209 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
210 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
211 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
212 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
213 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
214 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
215 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
216 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
217 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
218 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
219 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
220 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
221 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
222 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
223 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
224 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
225 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
226 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
227 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
228 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
229 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
230 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
231 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
232 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
233 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
234 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
235 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
236 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
237 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
238 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
239 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
240 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
241 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
242 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
243 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
244 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
245 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
246 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
247 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
248 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
249 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
250 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
251 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
252 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
253 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
254 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
255 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
256 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
257 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
258 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
259 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
260 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
261 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
262 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
263 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
264 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
265 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
266 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
267 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
268 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
269 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
270 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
271 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
272 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
273 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
274 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
275 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
276 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
277 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
278 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
279 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
280 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
281 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
282 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
283 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
284 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
285 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
286 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
287 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
288 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
289 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
290 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
291 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
292 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
293 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
294 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
295 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
296 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
297 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
298 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
299 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
300 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
301 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
302 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
303 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
304 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
305 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
306 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
307 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
308 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
309 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
310 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
311 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
312 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
313 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
314 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
315 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
316 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
317 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
318 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
319 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
320 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
321 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
322 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
323 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
324 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
325 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
326 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
327 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
328 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
329 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
330 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
331 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
332 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
333 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
334 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
335 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
336 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
337 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
338 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
339 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
340 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
341 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
342 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
343 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
344 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
345 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
346 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
347 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
348 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
349 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
350 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
351 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
352 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
353 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
354 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
355 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
356 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
357 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
358 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
359 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
360 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
361 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
362 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
363 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
364 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
365 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
366 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
367 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
368 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
369 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
370 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
371 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
372 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
373 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
374 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
375 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
376 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
377 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
378 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
379 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
380 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
381 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
382 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
383 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
384 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
385 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
386 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
387 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
388 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
389 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
390 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
391 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.31
Metatranscriptomes 0
Isolates 4.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.48
Nodule 0.15
Rhizoplane 4.54
Rhizosphere 86.54
Stem 0
Stem Tuber 0
Unclassified 5.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_9156956 2162886011 Bacteria 1627
2 JGI25163J39215_1000029 3300002771 Bacteria 66589
3 JGI25164J39214_1000096 3300002772 Bacteria 87444
4 JGI25165J46597_1000143 3300003214 Bacteria 118216
5 rootH1_10012394 3300003316 Bacteria 31437
6 rootL2_10010090 3300003322 Bacteria 35147
7 rootL2_10018488 3300003322 Bacteria 43748
8 rootH1_10128101 3300003323 Bacteria 3359
9 Ga0055536_1000037 3300003781 Bacteria 138437
10 Ga0055530_10000320 3300003791 Bacteria 43510
11 Ga0055540_1000025 3300003792 Bacteria 197801
12 Ga0055531_10000585 3300003794 Bacteria 31831
13 Ga0065714_10002258 3300005288 Bacteria 36899
14 Ga0065714_10002901 3300005288 Bacteria 23244
15 Ga0065704_10070482 3300005289 Bacteria 23009
16 Ga0065712_10068215 3300005290 Bacteria 12855
17 Ga0065712_10069208 3300005290 Bacteria 7732
18 Ga0065715_10003077 3300005293 Bacteria 6366
19 Ga0065715_10224438 3300005293 Bacteria 1258
20 Ga0070658_10052631 3300005327 Bacteria 3302
21 Ga0070683_100011978 3300005329 Bacteria 7524
22 Ga0070670_100051581 3300005331 Bacteria 3532
23 Ga0070670_100249923 3300005331 Bacteria 1545
24 Ga0070677_10009694 3300005333 Bacteria 3272
25 Ga0068869_100051352 3300005334 Bacteria 2992
26 Ga0068869_100207090 3300005334 Bacteria 1549
27 Ga0070666_10022333 3300005335 Bacteria 4109
28 Ga0070666_10027040 3300005335 Bacteria 3754
29 Ga0070680_100141305 3300005336 Bacteria 2019
30 Ga0070689_100032071 3300005340 Bacteria 3995
31 Ga0070689_100044183 3300005340 Bacteria 3427
32 Ga0070691_10003139 3300005341 Bacteria 7397
33 Ga0070687_100049937 3300005343 Bacteria 2159
34 Ga0070661_100000062 3300005344 Bacteria 85485
35 Ga0070661_100022191 3300005344 Bacteria 4543
36 Ga0070661_100043394 3300005344 Bacteria 3284
37 Ga0070668_100207848 3300005347 Bacteria 1609
38 Ga0070668_100427026 3300005347 Bacteria 1135
39 Ga0070669_100020230 3300005353 Bacteria 4754
40 Ga0070675_100062092 3300005354 Bacteria 3086
41 Ga0070675_100120440 3300005354 Bacteria 2229
42 Ga0070671_100121957 3300005355 Bacteria 2194
43 Ga0070688_100275666 3300005365 Bacteria 1206
44 Ga0070667_100274968 3300005367 Bacteria 1511
45 Ga0070709_10007786 3300005434 Bacteria 5883
46 Ga0070709_10037836 3300005434 Bacteria 2950
47 Ga0070714_100104923 3300005435 Bacteria 2494
48 Ga0070714_100428916 3300005435 Bacteria 1253
49 Ga0070710_10043611 3300005437 Bacteria 2485
50 Ga0070711_100085944 3300005439 Bacteria 2254
51 Ga0070711_100202443 3300005439 Bacteria 1533
52 Ga0070708_100002248 3300005445 Bacteria 14929
53 Ga0070708_100099061 3300005445 Bacteria 2666
54 Ga0070708_100194035 3300005445 Bacteria 1900
55 Ga0070681_10001886 3300005458 Bacteria 18915
56 Ga0070681_10033626 3300005458 Bacteria 5147
57 Ga0068867_100163777 3300005459 Bacteria 1756
58 Ga0070706_100000124 3300005467 Bacteria 94753
59 Ga0070706_100033891 3300005467 Bacteria 4714
60 Ga0070706_100320959 3300005467 Bacteria 1444
61 Ga0070707_100005141 3300005468 Bacteria 12257
62 Ga0070707_100019507 3300005468 Bacteria 6388
63 Ga0070698_100247966 3300005471 Bacteria 1714
64 Ga0070699_100168679 3300005518 Bacteria 1939
65 Ga0070684_100317949 3300005535 Bacteria 1430
66 Ga0070697_100032629 3300005536 Bacteria 4192
67 Ga0068853_100001820 3300005539 Bacteria 15690
68 Ga0070695_100004211 3300005545 Bacteria 8418
69 Ga0070696_100001810 3300005546 Bacteria 14033
70 Ga0070693_100005727 3300005547 Bacteria 6000
71 Ga0070665_100069746 3300005548 Bacteria 3523
72 Ga0070704_100145746 3300005549 Bacteria 1855
73 Ga0068855_100013092 3300005563 Bacteria 10002
74 Ga0068855_100067973 3300005563 Bacteria 4149
75 Ga0070664_100000035 3300005564 Bacteria 81750
76 Ga0068857_100000802 3300005577 Bacteria 23509
77 Ga0068856_100003713 3300005614 Bacteria 15318
78 Ga0068856_100374366 3300005614 Bacteria 1443
79 Ga0068852_100041502 3300005616 Bacteria 3888
80 Ga0068859_100120565 3300005617 Bacteria 2690
81 Ga0068861_100026817 3300005719 Bacteria 4192
82 Ga0068851_10177225 3300005834 Bacteria 1179
83 Ga0068870_10202694 3300005840 Bacteria 1204
84 Ga0068860_100004545 3300005843 Bacteria 14161
85 Ga0068862_100143065 3300005844 Bacteria 2124
86 Ga0081538_10006701 3300005981 Bacteria 10083
87 Ga0081538_10020776 3300005981 Bacteria 4819
88 Ga0081540_1001134 3300005983 Bacteria 23542
89 Ga0070717_10003024 3300006028 Bacteria 11981
90 Ga0075365_10081952 3300006038 Bacteria 2187
91 Ga0075368_10010670 3300006042 Bacteria 3325
92 Ga0070715_10034504 3300006163 Bacteria 2074
93 Ga0075367_10009558 3300006178 Bacteria 5073
94 Ga0068871_100106942 3300006358 Bacteria 2349
95 Ga0075428_100001345 3300006844 Bacteria 26076
96 Ga0075428_100037201 3300006844 Bacteria 5359
97 Ga0075428_100193095 3300006844 Bacteria 2202
98 Ga0075428_100338854 3300006844 Bacteria 1615
99 Ga0075430_100168245 3300006846 Bacteria 1823
100 Ga0075431_100000499 3300006847 Bacteria 32706
101 Ga0075431_100065561 3300006847 Bacteria 3750
102 Ga0075431_100237076 3300006847 Bacteria 1857
103 Ga0075433_10008240 3300006852 Bacteria 8306
104 Ga0075433_10014903 3300006852 Bacteria 6362
105 Ga0075433_10071796 3300006852 Bacteria 3043
106 Ga0075434_100008516 3300006871 Bacteria 9538
107 Ga0075434_100037518 3300006871 Bacteria 4797
108 Ga0075434_100038555 3300006871 Bacteria 4732
109 Ga0075434_100043629 3300006871 Bacteria 4448
110 Ga0075434_100056629 3300006871 Bacteria 3896
111 Ga0075434_100094167 3300006871 Bacteria 3000
112 Ga0075434_100110310 3300006871 Bacteria 2762
113 Ga0075429_100000711 3300006880 Bacteria 26042
114 Ga0075429_100067834 3300006880 Bacteria 3105
115 Ga0068865_100133990 3300006881 Bacteria 1859
116 Ga0075436_100002130 3300006914 Bacteria 13640
117 Ga0075436_100025640 3300006914 Bacteria 4057
118 Ga0075436_100045933 3300006914 Bacteria 3013
119 Ga0097620_100120560 3300006931 Bacteria 2690
120 Ga0075435_100022510 3300007076 Bacteria 4863
121 Ga0075435_100055666 3300007076 Bacteria 3195
122 Ga0075435_100058427 3300007076 Bacteria 3124
123 Ga0075435_100079957 3300007076 Bacteria 2683
124 Ga0105251_10004128 3300009011 Bacteria 10140
125 Ga0105251_10004663 3300009011 Bacteria 9225
126 Ga0105244_10000457 3300009036 Bacteria 37377
127 Ga0105244_10000938 3300009036 Bacteria 24575
128 Ga0105244_10001727 3300009036 Bacteria 17208
129 Ga0105244_10002982 3300009036 Bacteria 12459
130 Ga0105244_10003222 3300009036 Bacteria 11821
131 Ga0105250_10012347 3300009092 Bacteria 3527
132 Ga0105240_10001960 3300009093 Bacteria 34026
133 Ga0111539_10000313 3300009094 Bacteria 59049
134 Ga0111539_10034521 3300009094 Bacteria 6132
135 Ga0111539_10451315 3300009094 Bacteria 1497
136 Ga0114129_10000066 3300009147 Bacteria 93802
137 Ga0114129_10012927 3300009147 Bacteria 11880
138 Ga0114129_10143210 3300009147 Bacteria 3275
139 Ga0114129_10366876 3300009147 Bacteria 1904
140 Ga0105243_10000026 3300009148 Bacteria 191522
141 Ga0105241_10001630 3300009174 Bacteria 17123
142 Ga0105242_10157559 3300009176 Bacteria 1985
143 Ga0105237_10000042 3300009545 Bacteria 181280
144 Ga0105237_10001963 3300009545 Bacteria 26185
145 Ga0105238_10001275 3300009551 Bacteria 25338
146 Ga0105249_10276482 3300009553 Bacteria 1675
147 Ga0105239_10011225 3300010375 Bacteria 9998
148 Ga0105246_10019156 3300011119 Bacteria 4368
149 Ga0157373_10000796 3300013100 Bacteria 24360
150 Ga0157373_10000854 3300013100 Bacteria 23667
151 Ga0157373_10254401 3300013100 Bacteria 1242
152 Ga0157371_10000559 3300013102 Bacteria 44129
153 Ga0157370_10000803 3300013104 Bacteria 39592
154 Ga0157370_10027969 3300013104 Bacteria 5552
155 Ga0157370_10048208 3300013104 Bacteria 4081
156 Ga0157370_10086960 3300013104 Bacteria 2936
157 Ga0157369_10000251 3300013105 Bacteria 73814
158 Ga0157369_10011775 3300013105 Bacteria 9933
159 Ga0157374_10000777 3300013296 Bacteria 27941
160 Ga0157372_10003383 3300013307 Bacteria 17209
161 Ga0157372_10007744 3300013307 Bacteria 11411
162 Ga0157372_10038285 3300013307 Bacteria 5292
163 Ga0157372_10051324 3300013307 Bacteria 4590
164 Ga0157375_10005653 3300013308 Bacteria 10882
165 Ga0157375_10010826 3300013308 Bacteria 8035
166 Ga0157375_10092155 3300013308 Bacteria 3093
167 Ga0163163_10031805 3300014325 Bacteria 5096
168 Ga0163163_10221202 3300014325 Bacteria 1942
169 Ga0157380_10004218 3300014326 Bacteria 9942
170 Ga0182008_10000496 3300014497 Bacteria 29685
171 Ga0182008_10002573 3300014497 Bacteria 11282
172 Ga0157377_10003910 3300014745 Bacteria 6791
173 Ga0157379_10016139 3300014968 Bacteria 6569
174 Ga0182006_1000083 3300015261 Bacteria 118727
175 Ga0182006_1004951 3300015261 Bacteria 6435
176 Ga0182007_10000086 3300015262 Bacteria 69920
177 Ga0182005_1000675 3300015265 Bacteria 16002
178 Ga0182005_1000920 3300015265 Bacteria 12860
179 Ga0182005_1013655 3300015265 Bacteria 2283
180 Ga0183362_10002 3300015683 Bacteria 1432711
181 Ga0163161_10020254 3300017792 Bacteria 4666
182 Ga0163161_10123250 3300017792 Bacteria 1949
183 Ga0163161_10398898 3300017792 Bacteria 1103
184 Ga0213872_10018004 3300021361 Bacteria 3259
185 Ga0213876_10001446 3300021384 Bacteria 14768
186 Ga0209760_100049 3300025207 Bacteria 107275
187 Ga0207427_100048 3300025231 Bacteria 238464
188 Ga0209437_100094 3300025233 Bacteria 238465
189 Ga0209233_1000106 3300025261 Bacteria 268795
190 Ga0209676_1000002 3300025292 Bacteria 1732948
191 Ga0209050_1000006 3300025298 Bacteria 1359702
192 Ga0209051_1000001 3300025303 Bacteria 1732974
193 Ga0209257_1000056 3300025304 Bacteria 403132
194 Ga0207696_1005135 3300025711 Bacteria 5500
195 Ga0207655_1000070 3300025728 Bacteria 239196
196 Ga0207655_1000076 3300025728 Bacteria 226359
197 Ga0207655_1000481 3300025728 Bacteria 51474
198 Ga0207655_1001371 3300025728 Bacteria 22824
199 Ga0207655_1001394 3300025728 Bacteria 22565
200 Ga0207655_1001956 3300025728 Bacteria 17604
201 Ga0207655_1002348 3300025728 Bacteria 15475
202 Ga0207713_1000777 3300025735 Bacteria 29481
203 Ga0207713_1006522 3300025735 Bacteria 7093
204 Ga0207680_10029395 3300025903 Bacteria 3086
205 Ga0207699_10007119 3300025906 Bacteria 5454
206 Ga0207699_10075934 3300025906 Bacteria 2068
207 Ga0207699_10212184 3300025906 Bacteria 1317
208 Ga0207645_10020213 3300025907 Bacteria 4361
209 Ga0207643_10146556 3300025908 Bacteria 1413
210 Ga0207705_10034907 3300025909 Bacteria 3597
211 Ga0207705_10116121 3300025909 Bacteria 1981
212 Ga0207684_10000045 3300025910 Bacteria 253128
213 Ga0207684_10055983 3300025910 Bacteria 3345
214 Ga0207707_10003369 3300025912 Bacteria 14184
215 Ga0207707_10010161 3300025912 Bacteria 8168
216 Ga0207707_10103149 3300025912 Bacteria 2493
217 Ga0207695_10015247 3300025913 Bacteria 9061
218 Ga0207671_10000847 3300025914 Bacteria 38847
219 Ga0207671_10005589 3300025914 Bacteria 11549
220 Ga0207663_10090967 3300025916 Bacteria 2025
221 Ga0207662_10078463 3300025918 Bacteria 2010
222 Ga0207657_10124599 3300025919 Bacteria 2117
223 Ga0207649_10000010 3300025920 Bacteria 284354
224 Ga0207649_10014298 3300025920 Bacteria 4440
225 Ga0207649_10151345 3300025920 Bacteria 1598
226 Ga0207646_10019447 3300025922 Bacteria 6312
227 Ga0207646_10093779 3300025922 Bacteria 2688
228 Ga0207681_10064076 3300025923 Bacteria 2536
229 Ga0207694_10027462 3300025924 Bacteria 4335
230 Ga0207659_10290877 3300025926 Bacteria 1339
231 Ga0207664_10144690 3300025929 Bacteria 2015
232 Ga0207706_10324295 3300025933 Bacteria 1340
233 Ga0207709_10000004 3300025935 Bacteria 825156
234 Ga0207709_10122816 3300025935 Bacteria 1756
235 Ga0207670_10121556 3300025936 Bacteria 1899
236 Ga0207704_10107453 3300025938 Bacteria 1877
237 Ga0207665_10000939 3300025939 Bacteria 19702
238 Ga0207665_10042830 3300025939 Bacteria 3026
239 Ga0207691_10046572 3300025940 Bacteria 3983
240 Ga0207691_10061544 3300025940 Bacteria 3409
241 Ga0207689_10112881 3300025942 Bacteria 2234
242 Ga0207689_10130345 3300025942 Bacteria 2069
243 Ga0207689_10223473 3300025942 Bacteria 1556
244 Ga0207679_10000022 3300025945 Bacteria 219036
245 Ga0207679_10121748 3300025945 Bacteria 2078
246 Ga0207667_10003761 3300025949 Bacteria 18701
247 Ga0207667_10075639 3300025949 Bacteria 3496
248 Ga0207651_10193904 3300025960 Bacteria 1623
249 Ga0207712_10207661 3300025961 Bacteria 1557
250 Ga0207708_10084885 3300026075 Bacteria 2435
251 Ga0207702_10003125 3300026078 Bacteria 15355
252 Ga0207702_10421275 3300026078 Bacteria 1291
253 Ga0207648_10048665 3300026089 Bacteria 3711
254 Ga0207674_10001713 3300026116 Bacteria 28060
255 Ga0207675_100152288 3300026118 Bacteria 2202
256 Ga0207675_100248288 3300026118 Bacteria 1722
257 Ga0207683_10145286 3300026121 Bacteria 2139
258 Ga0207698_10101910 3300026142 Bacteria 2382
259 Ga0207698_10285915 3300026142 Bacteria 1528
260 Ga0209813_10041349 3300027866 Bacteria 1405
261 Ga0207428_10002687 3300027907 Bacteria 17719
262 Ga0207428_10003264 3300027907 Bacteria 15804
263 Ga0207428_10042671 3300027907 Bacteria 3667
264 Ga0207428_10059996 3300027907 Bacteria 3014
265 Ga0265326_10001140 3300028558 Bacteria 9482
266 Ga0265319_1002341 3300028563 Bacteria 10431
267 Ga0265334_10001262 3300028573 Bacteria 12312
268 Ga0265334_10022241 3300028573 Bacteria 2585
269 Ga0265318_10002005 3300028577 Bacteria 11283
270 Ga0265338_10005997 3300028800 Bacteria 15628
271 Ga0265338_10017707 3300028800 Bacteria 7662
272 Ga0265338_10049605 3300028800 Bacteria 3803
273 Ga0265338_10282045 3300028800 Bacteria 1213
274 Ga0316181_1227316 3300030744 Bacteria 1909
275 Ga0265330_10000322 3300031235 Bacteria 34393
276 Ga0265330_10006673 3300031235 Bacteria 5694
277 Ga0265332_10001221 3300031238 Bacteria 14855
278 Ga0265332_10016511 3300031238 Bacteria 3257
279 Ga0265332_10031950 3300031238 Bacteria 2295
280 Ga0265332_10110890 3300031238 Bacteria 1156
281 Ga0265328_10004455 3300031239 Bacteria 6085
282 Ga0265320_10044421 3300031240 Bacteria 2189
283 Ga0265325_10000525 3300031241 Bacteria 27638
284 Ga0265340_10090297 3300031247 Bacteria 1433
285 Ga0265339_10000889 3300031249 Bacteria 22952
286 Ga0265339_10004715 3300031249 Bacteria 9247
287 Ga0265339_10118736 3300031249 Bacteria 1361
288 Ga0265331_10000252 3300031250 Bacteria 63468
289 Ga0265331_10000502 3300031250 Bacteria 36921
290 Ga0265331_10005406 3300031250 Bacteria 7721
291 Ga0265316_10000397 3300031344 Bacteria 49700
292 Ga0265313_10001208 3300031595 Bacteria 24677
293 Ga0265313_10095359 3300031595 Bacteria 1328
294 Ga0307508_10094678 3300031616 Bacteria 2577
295 Ga0316579_10109100 3300031691 Bacteria 1328
296 Ga0265314_10000303 3300031711 Bacteria 70486
297 Ga0265314_10001687 3300031711 Bacteria 24037
298 Ga0265314_10001701 3300031711 Bacteria 23896
299 Ga0265314_10002139 3300031711 Bacteria 20716
300 Ga0265342_10002593 3300031712 Bacteria 15480
301 Ga0265342_10012477 3300031712 Bacteria 5753
302 Ga0307405_10012674 3300031731 Bacteria 4474
303 Ga0316577_10046809 3300031733 Bacteria 2415
304 Ga0307414_10260026 3300032004 Unclassified 1448
305 Ga0373923_0045074 3300035111 Bacteria 1831
306 Ga0373939_0010780 3300035114 Bacteria 2295
307 Ga0373945_0096715 3300035116 Bacteria 1151
308 Ga0373956_0077554 3300035119 Bacteria 1521
309 Ga0373955_0121393 3300035172 Bacteria 1519
310 Ga0373955_0124613 3300035172 Bacteria 1500
311 Ga0316574_0142450 3300035398 Bacteria 1545
312 Ga0373924_0003730 3300035410 Bacteria 5264
313 Ga0373924_0067353 3300035410 Bacteria 1506
314 Ga0373933_0019008 3300035724 Bacteria 3873
315 Ga0373933_0214506 3300035724 Bacteria 1234
316 Ga0373933_0249473 3300035724 Bacteria 1143
317 Ga0373937_0035560 3300036401 Bacteria 4535
318 Ga0373937_0060910 3300036401 Bacteria 3469
319 Ga0373937_0061901 3300036401 Bacteria 3440
320 Ga0373937_0154564 3300036401 Bacteria 2150
321 Ga0373937_0253348 3300036401 Bacteria 1659
322 Ga0373937_0459976 3300036401 Bacteria 1209
323 Ga0316582_0130492 3300036647 Bacteria 1687
324 Ga0395899_0000743 3300037312 Bacteria 32540
325 Ga0395899_0035413 3300037312 Bacteria 3747
326 Ga0395900_0004846 3300037418 Bacteria 14174
327 Ga0395900_0070047 3300037418 Bacteria 3605
328 Ga0395900_0266109 3300037418 Bacteria 1710
329 Ga0395898_0001561 3300037466 Bacteria 31392
330 Ga0395898_0002530 3300037466 Bacteria 21459
331 Ga0395898_0090994 3300037466 Bacteria 2935
332 Ga0395905_0083949 3300037471 Bacteria 2984
333 Ga0436364_0728550 3300037853 Bacteria 1185
334 Ga0436364_0769865 3300037853 Bacteria 23589
335 Ga0436364_1276281 3300037853 Bacteria 15092
336 Ga0395901_0000646 3300038443 Bacteria 40293
337 Ga0395901_0005139 3300038443 Bacteria 13211
338 Ga0395901_0007147 3300038443 Bacteria 11269
339 Ga0395901_0092621 3300038443 Bacteria 3163
340 Ga0395901_0367565 3300038443 Bacteria 1482
341 Ga0436365_1387122 3300039437 Bacteria 30710
342 Ga0436361_1100786 3300039447 Bacteria 11720
343 Ga0436362_1065128 3300039453 Bacteria 1230
344 Ga0439438_000672 3300041405 Bacteria 15338
345 Ga0439438_003319 3300041405 Bacteria 6549
346 Ga0439447_000020 3300041407 Bacteria 58031
347 Ga0439447_006525 3300041407 Bacteria 3777
348 Ga0439466_0000031 3300041411 Bacteria 61194
349 Ga0439466_0000658 3300041411 Bacteria 12990
350 Ga0439466_0002398 3300041411 Bacteria 7347
351 Ga0439466_0006795 3300041411 Bacteria 4339
352 Ga0439466_0037725 3300041411 Bacteria 1626
353 Ga0439465_0009278 3300041413 Bacteria 3100
354 Ga0439432_000447 3300042006 Bacteria 15337
355 Ga0439451_000525 3300042009 Bacteria 7298
356 Ga0439451_005874 3300042009 Bacteria 2507
357 Ga0439452_000124 3300042010 Bacteria 59201
358 Ga0439452_016281 3300042010 Bacteria 2021
359 Ga0439452_028649 3300042010 Bacteria 1388
360 Ga0439456_004007 3300042013 Bacteria 2985
361 Ga0439456_030807 3300042013 Bacteria 1148
362 Ga0439463_018749 3300042016 Bacteria 1722
363 Ga0450911_000551 3300042115 Bacteria 11644
364 Ga0450919_000050 3300042121 Bacteria 10419
365 Ga0450890_000057 3300042127 Bacteria 21630
366 Ga0450898_001491 3300042134 Bacteria 3096
367 Ga0450903_004903 3300042138 Bacteria 2257
368 Ga0450910_004080 3300042147 Bacteria 1964
369 Ga0439446_0000293 3300042156 Bacteria 9464
370 Ga0450908_000297 3300042184 Bacteria 9847
371 Ga0439460_0000026 3300042461 Bacteria 21156
372 Ga0439460_0003892 3300042461 Bacteria 3624
373 Ga0450893_0000432 3300042532 Bacteria 5919
374 Ga0451577_0079170 3300042876 Bacteria 2930
375 Ga0451577_0336187 3300042876 Bacteria 1370
376 Ga0439440_0003033 3300042993 Bacteria 3201
377 Ga0439440_0003557 3300042993 Bacteria 3012
378 Ga0466961_0019820 3300044693 Bacteria 4327
379 Ga0451576_0017935 3300045051 Bacteria 7770
380 Ga0466967_0184002 3300045976 Bacteria 1972
381 Ga0466967_0590907 3300045976 Bacteria 1095
382 Ga0495592_0106998 3300046454 Bacteria 1984
383 Ga0495603_0156743 3300046455 Bacteria 1321
384 Ga0495590_0006914 3300046457 Bacteria 4403
385 Ga0495591_009988 3300046458 Bacteria 3722
386 Ga0495629_0018317 3300046459 Bacteria 5013
387 Ga0495638_0000262 3300046460 Bacteria 70901
388 Ga0495653_0005310 3300046463 Bacteria 10478
389 Ga0495653_0006799 3300046463 Bacteria 9393
390 Ga0495653_0018759 3300046463 Bacteria 5614
391 Ga0495580_0129118 3300046472 Bacteria 1754
392 Ga0495582_0004180 3300046473 Bacteria 8116
393 Ga0495605_0002203 3300046474 Bacteria 12166
394 Ga0495605_0010703 3300046474 Bacteria 5126
395 Ga0495605_0118265 3300046474 Bacteria 1203
396 Ga0495639_0000001 3300046475 Bacteria 204442
397 Ga0495639_0008341 3300046475 Bacteria 4444
398 Ga0495664_0238826 3300046477 Bacteria 1099
399 Ga0495584_0000111 3300046491 Bacteria 56145
400 Ga0495585_0000001 3300046492 Bacteria 609804
401 Ga0495594_0000150 3300046499 Bacteria 33190
402 Ga0495594_0010336 3300046499 Bacteria 4838
403 Ga0495594_0025741 3300046499 Bacteria 3163
404 Ga0495607_0002925 3300046501 Bacteria 13453
405 Ga0495583_0001020 3300046506 Bacteria 31872
406 Ga0495583_0002091 3300046506 Bacteria 18015
407 Ga0495583_0004168 3300046506 Bacteria 10536
408 Ga0495608_0003654 3300046511 Bacteria 11055
409 Ga0495608_0004988 3300046511 Bacteria 9504
410 Ga0495618_0072590 3300046514 Bacteria 2190
411 Ga0495630_0245666 3300046517 Bacteria 1367
412 Ga0495631_0000078 3300046518 Bacteria 63148
413 Ga0495632_0006777 3300046519 Bacteria 7315
414 Ga0495644_0000017 3300046523 Bacteria 85885
415 Ga0495644_0030858 3300046523 Bacteria 2024
416 Ga0495648_0000990 3300046524 Bacteria 29242
417 Ga0495666_0000079 3300046526 Bacteria 38093
418 Ga0495666_0001238 3300046526 Bacteria 12361
419 Ga0495666_0014846 3300046526 Bacteria 3875
420 Ga0495666_0018713 3300046526 Bacteria 3442
421 Ga0495654_0000088 3300046530 Bacteria 104763
422 Ga0495665_0096248 3300046531 Bacteria 1555
423 Ga0495586_0165541 3300046535 Bacteria 1248
424 Ga0495587_0000877 3300046536 Bacteria 19880
425 Ga0495587_0002643 3300046536 Bacteria 11969
426 Ga0495621_0038761 3300046539 Bacteria 1664
427 Ga0495597_0071142 3300046542 Bacteria 1498
428 Ga0495622_0000347 3300046557 Bacteria 33186
429 Ga0495622_0000448 3300046557 Bacteria 26565
430 Ga0495667_0000398 3300046559 Bacteria 27824
431 Ga0495667_0076158 3300046559 Bacteria 2182
432 Ga0495634_0000620 3300046642 Bacteria 34465
433 Ga0495611_0003467 3300046648 Bacteria 6950
434 Ga0495635_0000441 3300046663 Bacteria 26300
435 Ga0495635_0024716 3300046663 Bacteria 4187
436 Ga0495659_0000002 3300046664 Bacteria 176698
437 Ga0495661_0000104 3300046665 Bacteria 101211
438 Ga0495657_0084592 3300046675 Bacteria 2046
439 Ga0495623_0000261 3300046679 Bacteria 34079
440 Ga0495623_0002508 3300046679 Bacteria 12149
441 Ga0495623_0073696 3300046679 Bacteria 2122
442 Ga0495646_0001696 3300046680 Bacteria 13198
443 Ga0495646_0003686 3300046680 Bacteria 9559
444 Ga0495658_0150479 3300046683 Bacteria 1429
445 Ga0495613_0001223 3300046689 Bacteria 19621
446 Ga0495613_0044800 3300046689 Bacteria 3272
447 Ga0495670_0038379 3300046691 Bacteria 2388
448 Ga0495670_0064033 3300046691 Bacteria 1852
449 Ga0495671_0064856 3300046692 Bacteria 1797
450 Ga0495649_0000113 3300046694 Bacteria 71567
451 Ga0495589_0026715 3300046794 Bacteria 2923
452 Ga0495600_0011054 3300046809 Bacteria 5617
453 Ga0495600_0061111 3300046809 Bacteria 2460
454 Ga0495660_0001594 3300046810 Bacteria 15228
455 Ga0495660_0010813 3300046810 Bacteria 5300
456 Ga0495581_0016418 3300047315 Bacteria 4305
457 Ga0495604_0004315 3300047317 Bacteria 11256
458 Ga0495604_0013697 3300047317 Bacteria 6464
459 Ga0495604_0044340 3300047317 Bacteria 3475
460 Ga0495604_0143542 3300047317 Bacteria 1703
461 Ga0495674_0008489 3300047319 Bacteria 9784
462 Ga0495672_0000440 3300047320 Bacteria 49603
463 Ga0495672_0002093 3300047320 Bacteria 18704
464 Ga0495672_0104517 3300047320 Bacteria 1530
465 Ga0495676_0013029 3300047321 Bacteria 7483
466 Ga0495676_0206971 3300047321 Bacteria 1360
467 Ga0495680_0000029 3300047322 Bacteria 112033
468 Ga0495680_0006253 3300047322 Bacteria 11099
469 Ga0495680_0010856 3300047322 Bacteria 8099
470 Ga0495680_0027586 3300047322 Bacteria 4663
471 Ga0495683_0002618 3300047323 Bacteria 10766
472 Ga0495687_003006 3300047443 Bacteria 12736
473 Ga0495687_028034 3300047443 Bacteria 2625
474 Ga0495687_076272 3300047443 Bacteria 1327
475 Ga0495675_0010528 3300047444 Bacteria 5781
476 Ga0495673_0000261 3300047469 Bacteria 73160
477 Ga0495684_0192412 3300047471 Bacteria 1507
478 Ga0495593_0000441 3300047673 Bacteria 23225
479 Ga0495593_0002452 3300047673 Bacteria 11161
480 Ga0495626_0000031 3300048091 Bacteria 197930
481 Ga0496101_0153798 3300048904 Bacteria 1761
482 Ga0496102_0001084 3300048905 Bacteria 25181
483 Ga0496103_0000690 3300048906 Bacteria 25132
484 Ga0496104_0071740 3300048907 Bacteria 3293
485 Ga0496105_0056075 3300048908 Bacteria 3253
486 Ga0496106_0243336 3300048909 Bacteria 1437
487 Ga0496108_0085981 3300048911 Unclassified 2670
488 Ga0496109_0031625 3300048912 Bacteria 4752
489 Ga0496109_0040556 3300048912 Bacteria 4217
490 Ga0496109_0071421 3300048912 Bacteria 3187
491 Ga0496110_0025914 3300048913 Bacteria 5014
492 Ga0496110_0051355 3300048913 Bacteria 3623
493 Ga0496110_0073253 3300048913 Bacteria 3040
494 Ga0496110_0097921 3300048913 Bacteria 2628
495 Ga0496111_0012974 3300048914 Bacteria 5657
496 Ga0496111_0111911 3300048914 Bacteria 2011
497 Ga0496112_0078286 3300048915 Bacteria 3270
498 Ga0496112_0094681 3300048915 Bacteria 2957
499 Ga0496113_0138174 3300048916 Bacteria 1916
500 Ga0496115_0084929 3300048918 Bacteria 2581
501 Ga0496116_0000475 3300048919 Bacteria 55484
502 Ga0496116_0016061 3300048919 Bacteria 5879
503 Ga0496116_0130658 3300048919 Bacteria 1432
504 Ga0496117_0007397 3300048920 Bacteria 10744
505 Ga0496117_0016634 3300048920 Bacteria 6193
506 Ga0496117_0057344 3300048920 Bacteria 2705
507 Ga0496118_0004367 3300048921 Bacteria 16815
508 Ga0496118_0063330 3300048921 Bacteria 2721
509 Ga0496119_0107050 3300048922 Bacteria 1559
510 Ga0496121_0150036 3300048924 Bacteria 1716
511 Ga0496122_0002729 3300048925 Bacteria 24434
512 Ga0496122_0143699 3300048925 Bacteria 1487
513 Ga0496123_0085455 3300048926 Bacteria 1898
514 Ga0496123_0180927 3300048926 Bacteria 1101
515 Ga0496124_0001409 3300048927 Bacteria 35871
516 Ga0496124_0025547 3300048927 Bacteria 5349
517 Ga0496124_0216886 3300048927 Bacteria 1442
518 Ga0496125_0000410 3300048928 Bacteria 80395
519 Ga0496126_0085316 3300048929 Bacteria 2784
520 Ga0495678_001076 3300049459 Bacteria 23066
521 Ga0495682_0000106 3300049460 Bacteria 74069
522 Ga0501031_0163787 3300049568 Bacteria 1453
523 Ga0501033_0016763 3300049570 Bacteria 5542
524 Ga0501038_0379586 3300049574 Bacteria 1096
525 Ga0501039_0073686 3300049575 Bacteria 2653
526 Ga0501039_0169840 3300049575 Bacteria 1714
527 Ga0501040_0074659 3300049576 Bacteria 2343
528 Ga0501040_0082382 3300049576 Bacteria 2230
529 Ga0501041_0010090 3300049577 Bacteria 5564
530 Ga0501041_0056786 3300049577 Bacteria 2393
531 Ga0501042_0033617 3300049578 Bacteria 3635
532 Ga0501042_0047423 3300049578 Bacteria 3064
533 Ga0501043_0173950 3300049579 Bacteria 1679
534 Ga0501043_0239250 3300049579 Bacteria 1400
535 Ga0501046_0002435 3300049580 Bacteria 17438
536 Ga0501046_0051480 3300049580 Bacteria 3249
537 Ga0501048_0020326 3300049582 Bacteria 4866
538 Ga0501048_0051900 3300049582 Bacteria 2918
539 Ga0501067_0063125 3300049583 Bacteria 2051
540 Ga0501068_0243780 3300049584 Bacteria 1144
541 Ga0501069_0009278 3300049585 Bacteria 5193
542 Ga0501070_0023153 3300049586 Bacteria 5203
543 Ga0501071_0084027 3300049587 Bacteria 2332
544 Ga0501071_0241018 3300049587 Bacteria 1363
545 Ga0501071_0251333 3300049587 Bacteria 1334
546 Ga0501072_0006922 3300049588 Bacteria 8607
547 Ga0501072_0020235 3300049588 Bacteria 5155
548 Ga0501073_0036605 3300049589 Bacteria 3487
549 Ga0501074_0274543 3300049590 Bacteria 1198
550 Ga0501075_0001993 3300049591 Bacteria 13483
551 Ga0501075_0005332 3300049591 Bacteria 8794
552 Ga0501075_0016477 3300049591 Bacteria 5324
553 Ga0501075_0042799 3300049591 Bacteria 3397
554 Ga0501075_0069962 3300049591 Bacteria 2652
555 Ga0501076_0003305 3300049592 Bacteria 11299
556 Ga0501076_0046292 3300049592 Bacteria 3437
557 Ga0501076_0048023 3300049592 Bacteria 3374
558 Ga0501076_0112845 3300049592 Bacteria 2199
559 Ga0501076_0117833 3300049592 Bacteria 2149
560 Ga0501076_0255100 3300049592 Bacteria 1435
561 Ga0501077_0001429 3300049593 Bacteria 14339
562 Ga0501077_0032891 3300049593 Bacteria 3303
563 Ga0501077_0048058 3300049593 Bacteria 2711
564 Ga0501223_004683 3300049663 Bacteria 2910
565 Ga0501079_0003080 3300049741 Bacteria 12207
566 Ga0501079_0041926 3300049741 Bacteria 3534
567 Ga0501079_0129654 3300049741 Bacteria 1962
568 Ga0501079_0148053 3300049741 Bacteria 1830
569 Ga0501080_0040971 3300049742 Bacteria 4317
570 Ga0501080_0047205 3300049742 Bacteria 4009
571 Ga0501080_0123300 3300049742 Bacteria 2400
572 Ga0501080_0235306 3300049742 Bacteria 1674
573 Ga0501080_0320556 3300049742 Unclassified 1403
574 Ga0501080_0442074 3300049742 Bacteria 1167
575 Ga0501081_0004345 3300049743 Bacteria 9087
576 Ga0501081_0011241 3300049743 Bacteria 5855
577 Ga0501083_0014666 3300049744 Bacteria 5479
578 Ga0501083_0137461 3300049744 Bacteria 1600
579 Ga0501035_0153614 3300049822 Bacteria 1996
580 Ga0501035_0226768 3300049822 Bacteria 1593
581 Ga0501044_0207745 3300049823 Bacteria 1914
582 Ga0501045_0055158 3300049824 Bacteria 2907
583 Ga0501045_0062102 3300049824 Bacteria 2741
584 Ga0501045_0116181 3300049824 Bacteria 1985
585 Ga0501045_0118558 3300049824 Bacteria 1964
586 Ga0501045_0185452 3300049824 Bacteria 1550
587 nmdc:mga0yw44_21288_c1 3300050492 Bacteria 2989
588 nmdc:mga0k408_7762_c1 3300050493 Bacteria 5736
589 nmdc:mga06z11_183827_c1 3300050494 Bacteria 1207
590 nmdc:mga05p37_2991_c1 3300050507 Bacteria 19627
591 nmdc:mga05p37_30364_c1 3300050507 Bacteria 6594
592 nmdc:mga05p37_879_c1 3300050507 Bacteria 33833
593 nmdc:mga09592_697_c1 3300050508 Bacteria 25685
594 nmdc:mga09592_97874_c1 3300050508 Bacteria 2511
595 nmdc:mga06r32_112269_c1 3300050510 Bacteria 2682
596 nmdc:mga06r32_28617_c1 3300050510 Bacteria 5217
597 nmdc:mga06r32_394_c1 3300050510 Bacteria 36886
598 nmdc:mga08y16_1049_c1 3300050511 Bacteria 27130
599 nmdc:mga08y16_17670_c1 3300050511 Bacteria 7513
600 nmdc:mga08y16_41071_c1 3300050511 Bacteria 4846
601 nmdc:mga0n895_113096_c1 3300050512 Bacteria 2732
602 nmdc:mga0n895_45332_c1 3300050512 Bacteria 4291
603 nmdc:mga0rr50_17172_c1 3300050513 Bacteria 4825
604 nmdc:mga0rr50_205_c1 3300050513 Bacteria 31964
605 nmdc:mga0rr50_75455_c1 3300050513 Bacteria 2584
606 nmdc:mga08x19_14975_c1 3300050514 Bacteria 4709
607 nmdc:mga08x19_2208_c1 3300050514 Bacteria 11900
608 nmdc:mga08x19_3171_c1 3300050514 Bacteria 9864
609 nmdc:mga0a205_20010_c1 3300050515 Bacteria 6315
610 nmdc:mga0a205_271560_c1 3300050515 Bacteria 1572
611 Ga0495595_0040572 3300053084 Bacteria 2127
612 Ga0500645_001001 3300053730 Bacteria 15940
613 Ga0501084_0000042 3300054114 Bacteria 100450
614 Ga0501084_0000978 3300054114 Bacteria 22179
615 Ga0501084_0020252 3300054114 Bacteria 5545
616 Ga0501084_0030858 3300054114 Bacteria 4481
617 Ga0501084_0079221 3300054114 Bacteria 2753
618 Ga0501084_0131267 3300054114 Bacteria 2108
619 Ga0501082_0019667 3300060353 Bacteria 5822
620 Ga0501082_0033002 3300060353 Bacteria 4464
621 Ga0501082_0041923 3300060353 Bacteria 3946
622 Ga0501082_0047293 3300060353 Bacteria 3707
623 Ga0501082_0049884 3300060353 Bacteria 3609
624 Ga0501082_0136057 3300060353 Bacteria 2132
625 Ga0501082_0145516 3300060353 Bacteria 2057
626 Ga0530510_0000918 3300061734 Bacteria 19421
627 Ga0530510_0016789 3300061734 Bacteria 5184
628 Ga0530510_0036432 3300061734 Bacteria 3546
629 Ga0530510_0134932 3300061734 Bacteria 1817
630 Ga0530510_0257988 3300061734 Bacteria 1299

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005347 Ga0070668_100207848 Ga0070668_1002078483 284
2 3300048918 Ga0496115_0084929 Ga0496115_0084929_19_957 302
3 3300038443 Ga0395901_0367565 Ga0395901_0367565_66_1073 305
4 3300009036 Ga0105244_10000457 Ga0105244_1000045714 308
5 3300013100 Ga0157373_10000854 Ga0157373_100008543 308
6 3300036401 Ga0373937_0035560 Ga0373937_0035560_1306_2235 308
7 3300009147 Ga0114129_10366876 Ga0114129_103668762 309
8 3300013105 Ga0157369_10000251 Ga0157369_1000025125 309
9 3300039453 Ga0436362_1065128 Ga0436362_1065128_91_1062 309
10 3300021361 Ga0213872_10018004 Ga0213872_100180042 310
11 3300028573 Ga0265334_10001262 Ga0265334_1000126212 310
12 3300046535 Ga0495586_0165541 Ga0495586_0165541_26_958 310
13 3300003781 Ga0055536_1000037 Ga0055536_100003722 311
14 3300003791 Ga0055530_10000320 Ga0055530_1000032042 311
15 3300003792 Ga0055540_1000025 Ga0055540_1000025143 311
16 3300003794 Ga0055531_10000585 Ga0055531_1000058527 311
17 3300009011 Ga0105251_10004663 Ga0105251_100046633 311
18 3300009036 Ga0105244_10000938 Ga0105244_1000093812 311
19 3300009545 Ga0105237_10000042 Ga0105237_1000004213 311
20 3300015261 Ga0182006_1004951 Ga0182006_10049512 311
21 3300025292 Ga0209676_1000002 Ga0209676_1000002568 311
22 3300025298 Ga0209050_1000006 Ga0209050_10000061002 311
23 3300025303 Ga0209051_1000001 Ga0209051_1000001568 311
24 3300025304 Ga0209257_1000056 Ga0209257_1000056237 311
25 3300025728 Ga0207655_1000070 Ga0207655_1000070132 311
26 3300025728 Ga0207655_1001371 Ga0207655_100137114 311
27 3300025735 Ga0207713_1006522 Ga0207713_10065226 311
28 3300025914 Ga0207671_10000847 Ga0207671_1000084722 311
29 3300037418 Ga0395900_0266109 Ga0395900_0266109_198_1172 311
30 3300048919 Ga0496116_0130658 Ga0496116_0130658_158_1141 311
31 3300048920 Ga0496117_0057344 Ga0496117_0057344_377_1360 311
32 3300048921 Ga0496118_0063330 Ga0496118_0063330_394_1377 311
33 3300048922 Ga0496119_0107050 Ga0496119_0107050_179_1162 311
34 3300048924 Ga0496121_0150036 Ga0496121_0150036_375_1358 311
35 3300048925 Ga0496122_0143699 Ga0496122_0143699_308_1291 311
36 3300048926 Ga0496123_0180927 Ga0496123_0180927_45_1028 311
37 3300048927 Ga0496124_0216886 Ga0496124_0216886_155_1138 311
38 3300006028 Ga0070717_10003024 Ga0070717_100030247 312
39 3300060353 Ga0501082_0049884 Ga0501082_0049884_717_1655 312
40 3300005288 Ga0065714_10002258 Ga0065714_1000225814 313
41 3300005289 Ga0065704_10070482 Ga0065704_1007048218 313
42 3300005719 Ga0068861_100026817 Ga0068861_1000268175 313
43 3300006042 Ga0075368_10010670 Ga0075368_100106703 313
44 3300006178 Ga0075367_10009558 Ga0075367_100095584 313
45 3300013104 Ga0157370_10027969 Ga0157370_100279695 313
46 3300025942 Ga0207689_10112881 Ga0207689_101128812 313
47 3300026118 Ga0207675_100248288 Ga0207675_1002482881 313
48 3300027866 Ga0209813_10041349 Ga0209813_100413492 313
49 3300035398 Ga0316574_0142450 Ga0316574_0142450_316_1308 313
50 3300039447 Ga0436361_1100786 Ga0436361_1100786_7450_8454 313
51 3300049584 Ga0501068_0243780 Ga0501068_0243780_26_1018 313
52 3300050493 nmdc:mga0k408_7762_c1 nmdc:mga0k408_7762_c1_4458_5480 313
53 3300050494 nmdc:mga06z11_183827_c1 nmdc:mga06z11_183827_c1_134_1156 313
54 3300035111 Ga0373923_0045074 Ga0373923_0045074_489_1433 314
55 3300035116 Ga0373945_0096715 Ga0373945_0096715_154_1098 314
56 3300035119 Ga0373956_0077554 Ga0373956_0077554_301_1245 314
57 3300035172 Ga0373955_0121393 Ga0373955_0121393_336_1280 314
58 3300035410 Ga0373924_0067353 Ga0373924_0067353_50_994 314
59 3300046454 Ga0495592_0106998 Ga0495592_0106998_579_1523 314
60 3300046472 Ga0495580_0129118 Ga0495580_0129118_30_974 314
61 3300046477 Ga0495664_0238826 Ga0495664_0238826_83_1027 314
62 3300046514 Ga0495618_0072590 Ga0495618_0072590_718_1662 314
63 3300046517 Ga0495630_0245666 Ga0495630_0245666_390_1334 314
64 3300046531 Ga0495665_0096248 Ga0495665_0096248_39_983 314
65 3300046559 Ga0495667_0076158 Ga0495667_0076158_646_1590 314
66 3300046679 Ga0495623_0073696 Ga0495623_0073696_660_1604 314
67 3300046683 Ga0495658_0150479 Ga0495658_0150479_268_1212 314
68 3300047317 Ga0495604_0143542 Ga0495604_0143542_732_1676 314
69 3300047471 Ga0495684_0192412 Ga0495684_0192412_238_1182 314
70 3300009176 Ga0105242_10157559 Ga0105242_101575592 315
71 3300028800 Ga0265338_10017707 Ga0265338_100177074 315
72 3300035724 Ga0373933_0214506 Ga0373933_0214506_272_1222 315
73 3300048915 Ga0496112_0078286 Ga0496112_0078286_294_1241 315
74 3300049589 Ga0501073_0036605 Ga0501073_0036605_1904_2881 315
75 3300049741 Ga0501079_0129654 Ga0501079_0129654_637_1614 315
76 3300049742 Ga0501080_0047205 Ga0501080_0047205_391_1368 315
77 3300050511 nmdc:mga08y16_17670_c1 nmdc:mga08y16_17670_c1_4581_5528 315
78 3300060353 Ga0501082_0136057 Ga0501082_0136057_147_1124 315
79 3300009036 Ga0105244_10003222 Ga0105244_100032227 316
80 3300013307 Ga0157372_10051324 Ga0157372_100513243 316
81 3300013308 Ga0157375_10005653 Ga0157375_100056537 316
82 3300014325 Ga0163163_10221202 Ga0163163_102212022 316
83 3300025728 Ga0207655_1001956 Ga0207655_10019567 316
84 3300025728 Ga0207655_1002348 Ga0207655_10023489 316
85 3300031238 Ga0265332_10110890 Ga0265332_101108901 316
86 3300031711 Ga0265314_10001687 Ga0265314_100016872 316
87 3300049586 Ga0501070_0023153 Ga0501070_0023153_2709_3692 316
88 3300049585 Ga0501069_0009278 Ga0501069_0009278_418_1425 317
89 3300049744 Ga0501083_0014666 Ga0501083_0014666_4055_5062 317
90 3300060353 Ga0501082_0019667 Ga0501082_0019667_1194_2201 317
91 3300049824 Ga0501045_0185452 Ga0501045_0185452_250_1206 318
92 3300035410 Ga0373924_0003730 Ga0373924_0003730_800_1780 319
93 3300037471 Ga0395905_0083949 Ga0395905_0083949_54_1022 319
94 3300050507 nmdc:mga05p37_2991_c1 nmdc:mga05p37_2991_c1_1137_2102 320
95 3300050511 nmdc:mga08y16_41071_c1 nmdc:mga08y16_41071_c1_3593_4558 320
96 3300050513 nmdc:mga0rr50_205_c1 nmdc:mga0rr50_205_c1_14519_15484 320
97 3300050514 nmdc:mga08x19_2208_c1 nmdc:mga08x19_2208_c1_10274_11239 320
98 3300005327 Ga0070658_10052631 Ga0070658_100526312 321
99 3300013100 Ga0157373_10254401 Ga0157373_102544011 321
100 3300013104 Ga0157370_10048208 Ga0157370_100482083 321
101 3300025909 Ga0207705_10116121 Ga0207705_101161212 321
102 3300003316 rootH1_10012394 rootH1_100123945 322
103 3300003322 rootL2_10018488 rootL2_1001848845 322
104 3300036401 Ga0373937_0459976 Ga0373937_0459976_11_979 322
105 3300042013 Ga0439456_030807 Ga0439456_030807_160_1137 322
106 3300047321 Ga0495676_0013029 Ga0495676_0013029_1496_2509 322
107 3300048911 Ga0496108_0085981 Ga0496108_0085981_98_1078 322
108 3300048913 Ga0496110_0097921 Ga0496110_0097921_160_1140 322
109 3300049592 Ga0501076_0112845 Ga0501076_0112845_236_1204 322
110 3300003323 rootH1_10128101 rootH1_101281013 323
111 3300005340 Ga0070689_100032071 Ga0070689_1000320714 323
112 3300005445 Ga0070708_100002248 Ga0070708_10000224811 323
113 3300005614 Ga0068856_100374366 Ga0068856_1003743663 323
114 3300006852 Ga0075433_10014903 Ga0075433_100149037 323
115 3300007076 Ga0075435_100055666 Ga0075435_1000556665 323
116 3300025910 Ga0207684_10055983 Ga0207684_100559833 323
117 3300026078 Ga0207702_10421275 Ga0207702_104212752 323
118 3300027907 Ga0207428_10059996 Ga0207428_100599964 323
119 3300048929 Ga0496126_0085316 Ga0496126_0085316_1040_2023 323
120 iso_pu_bacteria 2511231022 2511364662 323
121 iso_pu_bacteria 2511231156 2511825091 323
122 iso_pu_bacteria 2599185248 2599768931 323
123 iso_pu_bacteria 2599185289 2599884715 323
124 iso_pu_bacteria 2599185291 2599896106 323
125 iso_pu_bacteria 2599185305 2599957992 323
126 iso_pu_bacteria 2599185313 2600003920 323
127 iso_pu_bacteria 2599185315 2600015715 323
128 iso_pu_bacteria 2599185321 2600050922 323
129 iso_pu_bacteria 2599185324 2600068992 323
130 iso_pu_bacteria 2600254931 2600362930 323
131 iso_pu_bacteria 2623620446 2624491274 323
132 iso_pu_bacteria 2643221565 2643844405 323
133 iso_pu_bacteria 2667528170 2671088800 323
134 iso_pu_bacteria 2773857670 2774119030 323
135 iso_pu_bacteria 2784132072 2784312669 323
136 iso_pu_bacteria 2808606377 2808931570 323
137 iso_pu_bacteria 2808606381 2808953655 323
138 iso_pu_bacteria 2808606382 2808956227 323
139 iso_pu_bacteria 2808606395 2809036124 323
140 iso_pu_bacteria 2818991456 2819654795 323
141 iso_pu_bacteria 2825651385 2825652128 323
142 iso_pu_bacteria 2860339153 2860345469 323
143 iso_pu_bacteria 2913036834 2913040220 323
144 iso_pu_bacteria 2919697872 2919701215 323
145 iso_pu_bacteria 2923586266 2923588287 323
146 iso_pu_bacteria 2931396565 2931402789 323
147 iso_pu_bacteria 2988728565 2988734041 323
148 iso_pu_bacteria 8015687852 8015690835 323
149 iso_pu_bacteria 8019775933 8019778172 323
150 iso_pu_bacteria 8056569372 8056574346 323
151 3300005329 Ga0070683_100011978 Ga0070683_1000119786 324
152 3300005354 Ga0070675_100062092 Ga0070675_1000620921 324
153 3300005365 Ga0070688_100275666 Ga0070688_1002756661 324
154 3300005445 Ga0070708_100194035 Ga0070708_1001940352 324
155 3300005458 Ga0070681_10001886 Ga0070681_1000188611 324
156 3300005467 Ga0070706_100000124 Ga0070706_10000012469 324
157 3300005467 Ga0070706_100033891 Ga0070706_1000338913 324
158 3300005468 Ga0070707_100005141 Ga0070707_1000051412 324
159 3300005468 Ga0070707_100019507 Ga0070707_1000195076 324
160 3300005536 Ga0070697_100032629 Ga0070697_1000326294 324
161 3300005617 Ga0068859_100120565 Ga0068859_1001205653 324
162 3300005834 Ga0068851_10177225 Ga0068851_101772252 324
163 3300005840 Ga0068870_10202694 Ga0068870_102026941 324
164 3300005981 Ga0081538_10006701 Ga0081538_100067018 324
165 3300006871 Ga0075434_100008516 Ga0075434_1000085164 324
166 3300006871 Ga0075434_100110310 Ga0075434_1001103102 324
167 3300006931 Ga0097620_100120560 Ga0097620_1001205602 324
168 3300009036 Ga0105244_10001727 Ga0105244_100017272 324
169 3300009148 Ga0105243_10000026 Ga0105243_100000268 324
170 3300009553 Ga0105249_10276482 Ga0105249_102764822 324
171 3300011119 Ga0105246_10019156 Ga0105246_100191563 324
172 3300013308 Ga0157375_10092155 Ga0157375_100921553 324
173 3300014497 Ga0182008_10000496 Ga0182008_1000049614 324
174 3300014745 Ga0157377_10003910 Ga0157377_100039106 324
175 3300015683 Ga0183362_10002 Ga0183362_10002123 324
176 3300025907 Ga0207645_10020213 Ga0207645_100202133 324
177 3300025908 Ga0207643_10146556 Ga0207643_101465562 324
178 3300025910 Ga0207684_10000045 Ga0207684_10000045157 324
179 3300025912 Ga0207707_10003369 Ga0207707_100033698 324
180 3300025922 Ga0207646_10019447 Ga0207646_100194472 324
181 3300025922 Ga0207646_10093779 Ga0207646_100937792 324
182 3300025933 Ga0207706_10324295 Ga0207706_103242952 324
183 3300025940 Ga0207691_10061544 Ga0207691_100615442 324
184 3300025960 Ga0207651_10193904 Ga0207651_101939041 324
185 3300025961 Ga0207712_10207661 Ga0207712_102076612 324
186 3300026118 Ga0207675_100152288 Ga0207675_1001522882 324
187 3300028800 Ga0265338_10049605 Ga0265338_100496054 324
188 3300035114 Ga0373939_0010780 Ga0373939_0010780_495_1472 324
189 3300042115 Ga0450911_000551 Ga0450911_000551_7887_8861 324
190 3300042876 Ga0451577_0336187 Ga0451577_0336187_307_1293 324
191 3300046459 Ga0495629_0018317 Ga0495629_0018317_1629_2603 324
192 3300046463 Ga0495653_0018759 Ga0495653_0018759_1438_2412 324
193 3300046474 Ga0495605_0118265 Ga0495605_0118265_29_1003 324
194 3300046511 Ga0495608_0003654 Ga0495608_0003654_775_1755 324
195 3300046523 Ga0495644_0030858 Ga0495644_0030858_267_1241 324
196 3300046536 Ga0495587_0000877 Ga0495587_0000877_17809_18783 324
197 3300046542 Ga0495597_0071142 Ga0495597_0071142_358_1332 324
198 3300046663 Ga0495635_0024716 Ga0495635_0024716_3075_4049 324
199 3300046680 Ga0495646_0003686 Ga0495646_0003686_3893_4867 324
200 3300047317 Ga0495604_0013697 Ga0495604_0013697_1598_2572 324
201 3300047320 Ga0495672_0002093 Ga0495672_0002093_1302_2276 324
202 3300047322 Ga0495680_0000029 Ga0495680_0000029_88891_89865 324
203 3300048912 Ga0496109_0031625 Ga0496109_0031625_3491_4477 324
204 3300049568 Ga0501031_0163787 Ga0501031_0163787_387_1367 324
205 3300049570 Ga0501033_0016763 Ga0501033_0016763_30_1010 324
206 3300049574 Ga0501038_0379586 Ga0501038_0379586_30_1010 324
207 3300049575 Ga0501039_0169840 Ga0501039_0169840_348_1328 324
208 3300049577 Ga0501041_0056786 Ga0501041_0056786_95_1072 324
209 3300049578 Ga0501042_0047423 Ga0501042_0047423_1148_2170 324
210 3300049579 Ga0501043_0239250 Ga0501043_0239250_78_1064 324
211 3300049580 Ga0501046_0002435 Ga0501046_0002435_16059_17039 324
212 3300049582 Ga0501048_0020326 Ga0501048_0020326_1445_2425 324
213 3300049583 Ga0501067_0063125 Ga0501067_0063125_1043_2023 324
214 3300049587 Ga0501071_0084027 Ga0501071_0084027_319_1299 324
215 3300049588 Ga0501072_0006922 Ga0501072_0006922_5735_6715 324
216 3300049591 Ga0501075_0001993 Ga0501075_0001993_11059_12039 324
217 3300049592 Ga0501076_0048023 Ga0501076_0048023_387_1367 324
218 3300049593 Ga0501077_0048058 Ga0501077_0048058_109_1083 324
219 3300049742 Ga0501080_0123300 Ga0501080_0123300_1034_2014 324
220 3300049743 Ga0501081_0004345 Ga0501081_0004345_3455_4435 324
221 3300049743 Ga0501081_0011241 Ga0501081_0011241_3380_4399 324
222 3300049744 Ga0501083_0137461 Ga0501083_0137461_30_1010 324
223 3300049822 Ga0501035_0153614 Ga0501035_0153614_933_1919 324
224 3300049822 Ga0501035_0226768 Ga0501035_0226768_87_1067 324
225 3300049824 Ga0501045_0062102 Ga0501045_0062102_988_1965 324
226 3300054114 Ga0501084_0020252 Ga0501084_0020252_1445_2425 324
227 3300054114 Ga0501084_0131267 Ga0501084_0131267_78_1064 324
228 3300060353 Ga0501082_0033002 Ga0501082_0033002_3455_4435 324
229 3300061734 Ga0530510_0000918 Ga0530510_0000918_7383_8363 324
230 3300061734 Ga0530510_0257988 Ga0530510_0257988_38_1024 324
231 3300005293 Ga0065715_10224438 Ga0065715_102244381 325
232 3300005333 Ga0070677_10009694 Ga0070677_100096941 325
233 3300005335 Ga0070666_10027040 Ga0070666_100270402 325
234 3300005343 Ga0070687_100049937 Ga0070687_1000499372 325
235 3300005344 Ga0070661_100043394 Ga0070661_1000433942 325
236 3300005347 Ga0070668_100427026 Ga0070668_1004270261 325
237 3300005548 Ga0070665_100069746 Ga0070665_1000697462 325
238 3300005843 Ga0068860_100004545 Ga0068860_1000045453 325
239 3300006038 Ga0075365_10081952 Ga0075365_100819522 325
240 3300006844 Ga0075428_100193095 Ga0075428_1001930951 325
241 3300009094 Ga0111539_10451315 Ga0111539_104513151 325
242 3300013308 Ga0157375_10010826 Ga0157375_100108265 325
243 3300014326 Ga0157380_10004218 Ga0157380_100042185 325
244 3300025918 Ga0207662_10078463 Ga0207662_100784632 325
245 3300025920 Ga0207649_10151345 Ga0207649_101513452 325
246 3300025923 Ga0207681_10064076 Ga0207681_100640763 325
247 3300026089 Ga0207648_10048665 Ga0207648_100486652 325
248 3300026121 Ga0207683_10145286 Ga0207683_101452862 325
249 3300050492 nmdc:mga0yw44_21288_c1 nmdc:mga0yw44_21288_c1_1186_2217 325
250 3300005434 Ga0070709_10037836 Ga0070709_100378362 326
251 3300005435 Ga0070714_100428916 Ga0070714_1004289161 326
252 3300005439 Ga0070711_100202443 Ga0070711_1002024431 326
253 3300006844 Ga0075428_100338854 Ga0075428_1003388542 326
254 3300013296 Ga0157374_10000777 Ga0157374_100007779 326
255 3300025906 Ga0207699_10007119 Ga0207699_100071194 326
256 3300025916 Ga0207663_10090967 Ga0207663_100909672 326
257 3300025929 Ga0207664_10144690 Ga0207664_101446902 326
258 3300030744 Ga0316181_1227316 Ga0316181_12273162 326
259 3300031731 Ga0307405_10012674 Ga0307405_100126742 326
260 3300032004 Ga0307414_10260026 Ga0307414_102600262 326
261 3300035724 Ga0373933_0249473 Ga0373933_0249473_109_1104 326
262 3300036401 Ga0373937_0061901 Ga0373937_0061901_186_1181 326
263 3300037853 Ga0436364_1276281 Ga0436364_1276281_5263_6249 326
264 3300046675 Ga0495657_0084592 Ga0495657_0084592_359_1354 326
265 3300049576 Ga0501040_0082382 Ga0501040_0082382_77_1069 326
266 3300049578 Ga0501042_0033617 Ga0501042_0033617_1363_2355 326
267 3300049591 Ga0501075_0005332 Ga0501075_0005332_2251_3243 326
268 3300049592 Ga0501076_0003305 Ga0501076_0003305_2543_3535 326
269 3300049593 Ga0501077_0032891 Ga0501077_0032891_2264_3256 326
270 3300049663 Ga0501223_004683 Ga0501223_004683_1621_2661 326
271 3300049741 Ga0501079_0003080 Ga0501079_0003080_139_1131 326
272 3300049742 Ga0501080_0040971 Ga0501080_0040971_899_1891 326
273 3300049823 Ga0501044_0207745 Ga0501044_0207745_253_1707 326
274 3300054114 Ga0501084_0079221 Ga0501084_0079221_247_1239 326
275 3300060353 Ga0501082_0041923 Ga0501082_0041923_327_1319 326
276 3300061734 Ga0530510_0016789 Ga0530510_0016789_2674_3666 326
277 3300002771 JGI25163J39215_1000029 JGI25163J39215_10000293 327
278 3300002772 JGI25164J39214_1000096 JGI25164J39214_100009659 327
279 3300003214 JGI25165J46597_1000143 JGI25165J46597_100014346 327
280 3300003322 rootL2_10010090 rootL2_100100909 327
281 3300005288 Ga0065714_10002901 Ga0065714_1000290112 327
282 3300005290 Ga0065712_10069208 Ga0065712_100692084 327
283 3300005293 Ga0065715_10003077 Ga0065715_100030774 327
284 3300005334 Ga0068869_100051352 Ga0068869_1000513523 327
285 3300005341 Ga0070691_10003139 Ga0070691_100031393 327
286 3300005344 Ga0070661_100000062 Ga0070661_10000006264 327
287 3300005344 Ga0070661_100022191 Ga0070661_1000221912 327
288 3300005434 Ga0070709_10007786 Ga0070709_100077863 327
289 3300005435 Ga0070714_100104923 Ga0070714_1001049232 327
290 3300005437 Ga0070710_10043611 Ga0070710_100436112 327
291 3300005439 Ga0070711_100085944 Ga0070711_1000859442 327
292 3300005445 Ga0070708_100099061 Ga0070708_1000990612 327
293 3300005458 Ga0070681_10033626 Ga0070681_100336263 327
294 3300005467 Ga0070706_100320959 Ga0070706_1003209592 327
295 3300005518 Ga0070699_100168679 Ga0070699_1001686792 327
296 3300005535 Ga0070684_100317949 Ga0070684_1003179492 327
297 3300005539 Ga0068853_100001820 Ga0068853_10000182012 327
298 3300005545 Ga0070695_100004211 Ga0070695_1000042115 327
299 3300005546 Ga0070696_100001810 Ga0070696_1000018109 327
300 3300005547 Ga0070693_100005727 Ga0070693_1000057271 327
301 3300005563 Ga0068855_100013092 Ga0068855_1000130923 327
302 3300005563 Ga0068855_100067973 Ga0068855_1000679733 327
303 3300005564 Ga0070664_100000035 Ga0070664_10000003565 327
304 3300005577 Ga0068857_100000802 Ga0068857_10000080210 327
305 3300005614 Ga0068856_100003713 Ga0068856_1000037137 327
306 3300005616 Ga0068852_100041502 Ga0068852_1000415022 327
307 3300005981 Ga0081538_10020776 Ga0081538_100207763 327
308 3300005983 Ga0081540_1001134 Ga0081540_100113410 327
309 3300006163 Ga0070715_10034504 Ga0070715_100345042 327
310 3300006844 Ga0075428_100001345 Ga0075428_10000134510 327
311 3300006844 Ga0075428_100037201 Ga0075428_1000372011 327
312 3300006846 Ga0075430_100168245 Ga0075430_1001682452 327
313 3300006847 Ga0075431_100000499 Ga0075431_10000049919 327
314 3300006847 Ga0075431_100065561 Ga0075431_1000655612 327
315 3300006852 Ga0075433_10008240 Ga0075433_100082403 327
316 3300006871 Ga0075434_100043629 Ga0075434_1000436292 327
317 3300006871 Ga0075434_100056629 Ga0075434_1000566291 327
318 3300006871 Ga0075434_100094167 Ga0075434_1000941672 327
319 3300006880 Ga0075429_100000711 Ga0075429_10000071115 327
320 3300006880 Ga0075429_100067834 Ga0075429_1000678342 327
321 3300006914 Ga0075436_100002130 Ga0075436_10000213014 327
322 3300006914 Ga0075436_100025640 Ga0075436_1000256403 327
323 3300006914 Ga0075436_100045933 Ga0075436_1000459333 327
324 3300007076 Ga0075435_100022510 Ga0075435_1000225105 327
325 3300007076 Ga0075435_100058427 Ga0075435_1000584273 327
326 3300007076 Ga0075435_100079957 Ga0075435_1000799572 327
327 3300009011 Ga0105251_10004128 Ga0105251_100041288 327
328 3300009036 Ga0105244_10002982 Ga0105244_1000298212 327
329 3300009092 Ga0105250_10012347 Ga0105250_100123473 327
330 3300009093 Ga0105240_10001960 Ga0105240_1000196019 327
331 3300009147 Ga0114129_10000066 Ga0114129_1000006631 327
332 3300009147 Ga0114129_10012927 Ga0114129_1001292711 327
333 3300009174 Ga0105241_10001630 Ga0105241_100016303 327
334 3300009545 Ga0105237_10001963 Ga0105237_100019635 327
335 3300009551 Ga0105238_10001275 Ga0105238_1000127519 327
336 3300010375 Ga0105239_10011225 Ga0105239_100112256 327
337 3300013100 Ga0157373_10000796 Ga0157373_100007965 327
338 3300013102 Ga0157371_10000559 Ga0157371_100005599 327
339 3300013104 Ga0157370_10000803 Ga0157370_1000080333 327
340 3300013104 Ga0157370_10086960 Ga0157370_100869602 327
341 3300013105 Ga0157369_10011775 Ga0157369_100117756 327
342 3300013307 Ga0157372_10003383 Ga0157372_1000338311 327
343 3300013307 Ga0157372_10007744 Ga0157372_100077445 327
344 3300013307 Ga0157372_10038285 Ga0157372_100382852 327
345 3300014325 Ga0163163_10031805 Ga0163163_100318052 327
346 3300014497 Ga0182008_10002573 Ga0182008_100025734 327
347 3300014968 Ga0157379_10016139 Ga0157379_100161392 327
348 3300015261 Ga0182006_1000083 Ga0182006_100008385 327
349 3300015262 Ga0182007_10000086 Ga0182007_1000008639 327
350 3300015265 Ga0182005_1000675 Ga0182005_100067513 327
351 3300015265 Ga0182005_1000920 Ga0182005_10009209 327
352 3300015265 Ga0182005_1013655 Ga0182005_10136552 327
353 3300017792 Ga0163161_10020254 Ga0163161_100202542 327
354 3300017792 Ga0163161_10398898 Ga0163161_103988981 327
355 3300021384 Ga0213876_10001446 Ga0213876_1000144612 327
356 3300025207 Ga0209760_100049 Ga0209760_10004919 327
357 3300025231 Ga0207427_100048 Ga0207427_100048183 327
358 3300025233 Ga0209437_100094 Ga0209437_100094183 327
359 3300025261 Ga0209233_1000106 Ga0209233_100010674 327
360 3300025711 Ga0207696_1005135 Ga0207696_10051353 327
361 3300025728 Ga0207655_1000076 Ga0207655_100007651 327
362 3300025728 Ga0207655_1000481 Ga0207655_100048114 327
363 3300025728 Ga0207655_1001394 Ga0207655_10013945 327
364 3300025735 Ga0207713_1000777 Ga0207713_10007775 327
365 3300025906 Ga0207699_10075934 Ga0207699_100759342 327
366 3300025906 Ga0207699_10212184 Ga0207699_102121841 327
367 3300025909 Ga0207705_10034907 Ga0207705_100349071 327
368 3300025912 Ga0207707_10010161 Ga0207707_100101612 327
369 3300025912 Ga0207707_10103149 Ga0207707_101031493 327
370 3300025913 Ga0207695_10015247 Ga0207695_100152478 327
371 3300025914 Ga0207671_10005589 Ga0207671_100055893 327
372 3300025919 Ga0207657_10124599 Ga0207657_101245993 327
373 3300025920 Ga0207649_10000010 Ga0207649_10000010107 327
374 3300025920 Ga0207649_10014298 Ga0207649_100142983 327
375 3300025924 Ga0207694_10027462 Ga0207694_100274622 327
376 3300025935 Ga0207709_10000004 Ga0207709_10000004144 327
377 3300025935 Ga0207709_10122816 Ga0207709_101228162 327
378 3300025939 Ga0207665_10000939 Ga0207665_1000093912 327
379 3300025939 Ga0207665_10042830 Ga0207665_100428302 327
380 3300025945 Ga0207679_10000022 Ga0207679_1000002223 327
381 3300025949 Ga0207667_10003761 Ga0207667_100037616 327
382 3300025949 Ga0207667_10075639 Ga0207667_100756394 327
383 3300026078 Ga0207702_10003125 Ga0207702_100031258 327
384 3300026116 Ga0207674_10001713 Ga0207674_1000171316 327
385 3300026142 Ga0207698_10101910 Ga0207698_101019102 327
386 3300026142 Ga0207698_10285915 Ga0207698_102859152 327
387 3300027907 Ga0207428_10002687 Ga0207428_100026878 327
388 3300027907 Ga0207428_10003264 Ga0207428_1000326415 327
389 3300028558 Ga0265326_10001140 Ga0265326_100011402 327
390 3300028563 Ga0265319_1002341 Ga0265319_10023419 327
391 3300028573 Ga0265334_10022241 Ga0265334_100222412 327
392 3300028577 Ga0265318_10002005 Ga0265318_100020053 327
393 3300028800 Ga0265338_10005997 Ga0265338_100059974 327
394 3300028800 Ga0265338_10282045 Ga0265338_102820452 327
395 3300031235 Ga0265330_10000322 Ga0265330_1000032211 327
396 3300031235 Ga0265330_10006673 Ga0265330_100066732 327
397 3300031238 Ga0265332_10001221 Ga0265332_100012216 327
398 3300031238 Ga0265332_10016511 Ga0265332_100165113 327
399 3300031238 Ga0265332_10031950 Ga0265332_100319503 327
400 3300031239 Ga0265328_10004455 Ga0265328_100044554 327
401 3300031240 Ga0265320_10044421 Ga0265320_100444213 327
402 3300031241 Ga0265325_10000525 Ga0265325_1000052520 327
403 3300031247 Ga0265340_10090297 Ga0265340_100902971 327
404 3300031249 Ga0265339_10000889 Ga0265339_100008895 327
405 3300031249 Ga0265339_10004715 Ga0265339_100047155 327
406 3300031249 Ga0265339_10118736 Ga0265339_101187362 327
407 3300031250 Ga0265331_10000252 Ga0265331_100002528 327
408 3300031250 Ga0265331_10000502 Ga0265331_1000050230 327
409 3300031250 Ga0265331_10005406 Ga0265331_100054063 327
410 3300031344 Ga0265316_10000397 Ga0265316_1000039733 327
411 3300031595 Ga0265313_10001208 Ga0265313_100012089 327
412 3300031595 Ga0265313_10095359 Ga0265313_100953592 327
413 3300031616 Ga0307508_10094678 Ga0307508_100946782 327
414 3300031691 Ga0316579_10109100 Ga0316579_101091001 327
415 3300031711 Ga0265314_10000303 Ga0265314_1000030333 327
416 3300031711 Ga0265314_10001701 Ga0265314_1000170112 327
417 3300031711 Ga0265314_10002139 Ga0265314_100021394 327
418 3300031712 Ga0265342_10002593 Ga0265342_1000259311 327
419 3300031712 Ga0265342_10012477 Ga0265342_100124776 327
420 3300031733 Ga0316577_10046809 Ga0316577_100468092 327
421 3300036401 Ga0373937_0060910 Ga0373937_0060910_641_1624 327
422 3300036401 Ga0373937_0154564 Ga0373937_0154564_586_1569 327
423 3300036647 Ga0316582_0130492 Ga0316582_0130492_519_1547 327
424 3300037312 Ga0395899_0000743 Ga0395899_0000743_11031_12014 327
425 3300037312 Ga0395899_0035413 Ga0395899_0035413_804_1820 327
426 3300037418 Ga0395900_0004846 Ga0395900_0004846_5091_6107 327
427 3300037418 Ga0395900_0070047 Ga0395900_0070047_218_1201 327
428 3300037466 Ga0395898_0001561 Ga0395898_0001561_20337_21320 327
429 3300037466 Ga0395898_0002530 Ga0395898_0002530_10353_11351 327
430 3300037466 Ga0395898_0090994 Ga0395898_0090994_976_1992 327
431 3300037853 Ga0436364_0728550 Ga0436364_0728550_29_1030 327
432 3300037853 Ga0436364_0769865 Ga0436364_0769865_15832_16836 327
433 3300038443 Ga0395901_0000646 Ga0395901_0000646_28921_29919 327
434 3300038443 Ga0395901_0005139 Ga0395901_0005139_1256_2239 327
435 3300038443 Ga0395901_0007147 Ga0395901_0007147_5969_6985 327
436 3300038443 Ga0395901_0092621 Ga0395901_0092621_1324_2340 327
437 3300039437 Ga0436365_1387122 Ga0436365_1387122_11119_12123 327
438 3300041405 Ga0439438_000672 Ga0439438_000672_13968_14951 327
439 3300041405 Ga0439438_003319 Ga0439438_003319_3685_4668 327
440 3300041407 Ga0439447_000020 Ga0439447_000020_29397_30380 327
441 3300041407 Ga0439447_006525 Ga0439447_006525_388_1371 327
442 3300041411 Ga0439466_0000031 Ga0439466_0000031_29212_30195 327
443 3300041411 Ga0439466_0000658 Ga0439466_0000658_388_1371 327
444 3300041411 Ga0439466_0002398 Ga0439466_0002398_5976_6959 327
445 3300041411 Ga0439466_0006795 Ga0439466_0006795_2383_3420 327
446 3300041411 Ga0439466_0037725 Ga0439466_0037725_466_1449 327
447 3300041413 Ga0439465_0009278 Ga0439465_0009278_1355_2338 327
448 3300042006 Ga0439432_000447 Ga0439432_000447_388_1371 327
449 3300042009 Ga0439451_000525 Ga0439451_000525_538_1560 327
450 3300042009 Ga0439451_005874 Ga0439451_005874_232_1215 327
451 3300042010 Ga0439452_000124 Ga0439452_000124_15362_16399 327
452 3300042010 Ga0439452_016281 Ga0439452_016281_388_1371 327
453 3300042010 Ga0439452_028649 Ga0439452_028649_33_1016 327
454 3300042013 Ga0439456_004007 Ga0439456_004007_1792_2775 327
455 3300042016 Ga0439463_018749 Ga0439463_018749_126_1109 327
456 3300042121 Ga0450919_000050 Ga0450919_000050_5473_6456 327
457 3300042127 Ga0450890_000057 Ga0450890_000057_2302_3285 327
458 3300042134 Ga0450898_001491 Ga0450898_001491_1347_2369 327
459 3300042138 Ga0450903_004903 Ga0450903_004903_637_1620 327
460 3300042147 Ga0450910_004080 Ga0450910_004080_116_1099 327
461 3300042156 Ga0439446_0000293 Ga0439446_0000293_3986_4969 327
462 3300042184 Ga0450908_000297 Ga0450908_000297_5643_6626 327
463 3300042461 Ga0439460_0000026 Ga0439460_0000026_3557_4540 327
464 3300042461 Ga0439460_0003892 Ga0439460_0003892_2254_3237 327
465 3300042532 Ga0450893_0000432 Ga0450893_0000432_390_1373 327
466 3300042876 Ga0451577_0079170 Ga0451577_0079170_1038_2021 327
467 3300042993 Ga0439440_0003033 Ga0439440_0003033_561_1544 327
468 3300042993 Ga0439440_0003557 Ga0439440_0003557_1409_2392 327
469 3300044693 Ga0466961_0019820 Ga0466961_0019820_1260_2267 327
470 3300045051 Ga0451576_0017935 Ga0451576_0017935_1566_2549 327
471 3300045976 Ga0466967_0184002 Ga0466967_0184002_164_1162 327
472 3300046455 Ga0495603_0156743 Ga0495603_0156743_204_1187 327
473 3300046457 Ga0495590_0006914 Ga0495590_0006914_1954_2937 327
474 3300046458 Ga0495591_009988 Ga0495591_009988_158_1141 327
475 3300046460 Ga0495638_0000262 Ga0495638_0000262_52052_53035 327
476 3300046463 Ga0495653_0005310 Ga0495653_0005310_3059_4042 327
477 3300046463 Ga0495653_0006799 Ga0495653_0006799_3921_4904 327
478 3300046473 Ga0495582_0004180 Ga0495582_0004180_4320_5303 327
479 3300046474 Ga0495605_0002203 Ga0495605_0002203_4209_5192 327
480 3300046474 Ga0495605_0010703 Ga0495605_0010703_2886_3869 327
481 3300046475 Ga0495639_0000001 Ga0495639_0000001_136430_137413 327
482 3300046475 Ga0495639_0008341 Ga0495639_0008341_1755_2738 327
483 3300046491 Ga0495584_0000111 Ga0495584_0000111_38153_39136 327
484 3300046492 Ga0495585_0000001 Ga0495585_0000001_220131_221114 327
485 3300046499 Ga0495594_0000150 Ga0495594_0000150_4394_5377 327
486 3300046499 Ga0495594_0010336 Ga0495594_0010336_2187_3170 327
487 3300046499 Ga0495594_0025741 Ga0495594_0025741_2165_3148 327
488 3300046501 Ga0495607_0002925 Ga0495607_0002925_8902_9885 327
489 3300046506 Ga0495583_0001020 Ga0495583_0001020_23927_24910 327
490 3300046506 Ga0495583_0002091 Ga0495583_0002091_11092_12075 327
491 3300046506 Ga0495583_0004168 Ga0495583_0004168_2463_3446 327
492 3300046511 Ga0495608_0004988 Ga0495608_0004988_3936_4922 327
493 3300046518 Ga0495631_0000078 Ga0495631_0000078_18877_19860 327
494 3300046519 Ga0495632_0006777 Ga0495632_0006777_3809_4792 327
495 3300046523 Ga0495644_0000017 Ga0495644_0000017_17872_18855 327
496 3300046524 Ga0495648_0000990 Ga0495648_0000990_4974_5957 327
497 3300046526 Ga0495666_0000079 Ga0495666_0000079_29537_30520 327
498 3300046526 Ga0495666_0001238 Ga0495666_0001238_8811_9794 327
499 3300046526 Ga0495666_0014846 Ga0495666_0014846_970_1953 327
500 3300046526 Ga0495666_0018713 Ga0495666_0018713_1867_2850 327
501 3300046530 Ga0495654_0000088 Ga0495654_0000088_48466_49449 327
502 3300046536 Ga0495587_0002643 Ga0495587_0002643_1918_2901 327
503 3300046539 Ga0495621_0038761 Ga0495621_0038761_331_1329 327
504 3300046557 Ga0495622_0000347 Ga0495622_0000347_31803_32786 327
505 3300046557 Ga0495622_0000448 Ga0495622_0000448_24669_25652 327
506 3300046559 Ga0495667_0000398 Ga0495667_0000398_12888_13874 327
507 3300046642 Ga0495634_0000620 Ga0495634_0000620_26842_27825 327
508 3300046648 Ga0495611_0003467 Ga0495611_0003467_4666_5649 327
509 3300046663 Ga0495635_0000441 Ga0495635_0000441_6949_7932 327
510 3300046664 Ga0495659_0000002 Ga0495659_0000002_132930_133913 327
511 3300046665 Ga0495661_0000104 Ga0495661_0000104_25418_26401 327
512 3300046679 Ga0495623_0000261 Ga0495623_0000261_6674_7657 327
513 3300046679 Ga0495623_0002508 Ga0495623_0002508_8858_9841 327
514 3300046680 Ga0495646_0001696 Ga0495646_0001696_5514_6497 327
515 3300046689 Ga0495613_0001223 Ga0495613_0001223_16544_17527 327
516 3300046689 Ga0495613_0044800 Ga0495613_0044800_2159_3142 327
517 3300046691 Ga0495670_0038379 Ga0495670_0038379_1173_2156 327
518 3300046692 Ga0495671_0064856 Ga0495671_0064856_280_1263 327
519 3300046694 Ga0495649_0000113 Ga0495649_0000113_15921_16904 327
520 3300046794 Ga0495589_0026715 Ga0495589_0026715_805_1788 327
521 3300046809 Ga0495600_0011054 Ga0495600_0011054_727_1710 327
522 3300046809 Ga0495600_0061111 Ga0495600_0061111_1231_2214 327
523 3300046810 Ga0495660_0001594 Ga0495660_0001594_9677_10660 327
524 3300046810 Ga0495660_0010813 Ga0495660_0010813_1760_2743 327
525 3300047315 Ga0495581_0016418 Ga0495581_0016418_1832_2815 327
526 3300047317 Ga0495604_0004315 Ga0495604_0004315_7672_8655 327
527 3300047317 Ga0495604_0044340 Ga0495604_0044340_41_1024 327
528 3300047319 Ga0495674_0008489 Ga0495674_0008489_6620_7603 327
529 3300047320 Ga0495672_0000440 Ga0495672_0000440_19366_20349 327
530 3300047320 Ga0495672_0104517 Ga0495672_0104517_488_1471 327
531 3300047321 Ga0495676_0206971 Ga0495676_0206971_160_1167 327
532 3300047322 Ga0495680_0006253 Ga0495680_0006253_2038_3021 327
533 3300047322 Ga0495680_0010856 Ga0495680_0010856_4568_5551 327
534 3300047322 Ga0495680_0027586 Ga0495680_0027586_875_2029 327
535 3300047323 Ga0495683_0002618 Ga0495683_0002618_2432_3415 327
536 3300047443 Ga0495687_003006 Ga0495687_003006_11540_12523 327
537 3300047443 Ga0495687_028034 Ga0495687_028034_633_1619 327
538 3300047443 Ga0495687_076272 Ga0495687_076272_131_1114 327
539 3300047444 Ga0495675_0010528 Ga0495675_0010528_122_1105 327
540 3300047469 Ga0495673_0000261 Ga0495673_0000261_56172_57155 327
541 3300047673 Ga0495593_0000441 Ga0495593_0000441_15392_16375 327
542 3300047673 Ga0495593_0002452 Ga0495593_0002452_5475_6500 327
543 3300048091 Ga0495626_0000031 Ga0495626_0000031_148852_149835 327
544 3300048904 Ga0496101_0153798 Ga0496101_0153798_83_1081 327
545 3300048905 Ga0496102_0001084 Ga0496102_0001084_17576_18559 327
546 3300048906 Ga0496103_0000690 Ga0496103_0000690_6574_7557 327
547 3300048907 Ga0496104_0071740 Ga0496104_0071740_1669_2667 327
548 3300048908 Ga0496105_0056075 Ga0496105_0056075_652_1650 327
549 3300048909 Ga0496106_0243336 Ga0496106_0243336_168_1151 327
550 3300048912 Ga0496109_0040556 Ga0496109_0040556_1144_2142 327
551 3300048913 Ga0496110_0025914 Ga0496110_0025914_1495_2478 327
552 3300048913 Ga0496110_0051355 Ga0496110_0051355_886_1869 327
553 3300048913 Ga0496110_0073253 Ga0496110_0073253_642_1625 327
554 3300048914 Ga0496111_0012974 Ga0496111_0012974_1984_2967 327
555 3300048914 Ga0496111_0111911 Ga0496111_0111911_160_1158 327
556 3300048915 Ga0496112_0094681 Ga0496112_0094681_983_1966 327
557 3300048919 Ga0496116_0000475 Ga0496116_0000475_41997_42980 327
558 3300048919 Ga0496116_0016061 Ga0496116_0016061_1067_2050 327
559 3300048920 Ga0496117_0007397 Ga0496117_0007397_4033_5016 327
560 3300048920 Ga0496117_0016634 Ga0496117_0016634_716_1699 327
561 3300048921 Ga0496118_0004367 Ga0496118_0004367_14402_15385 327
562 3300048925 Ga0496122_0002729 Ga0496122_0002729_17252_18235 327
563 3300048926 Ga0496123_0085455 Ga0496123_0085455_271_1254 327
564 3300048927 Ga0496124_0001409 Ga0496124_0001409_17807_18790 327
565 3300048927 Ga0496124_0025547 Ga0496124_0025547_437_1420 327
566 3300048928 Ga0496125_0000410 Ga0496125_0000410_18391_19374 327
567 3300049459 Ga0495678_001076 Ga0495678_001076_10790_11773 327
568 3300049460 Ga0495682_0000106 Ga0495682_0000106_13945_14928 327
569 3300049576 Ga0501040_0074659 Ga0501040_0074659_655_1656 327
570 3300049577 Ga0501041_0010090 Ga0501041_0010090_4021_5052 327
571 3300049579 Ga0501043_0173950 Ga0501043_0173950_80_1111 327
572 3300049580 Ga0501046_0051480 Ga0501046_0051480_1922_2953 327
573 3300049587 Ga0501071_0241018 Ga0501071_0241018_278_1309 327
574 3300049587 Ga0501071_0251333 Ga0501071_0251333_308_1309 327
575 3300049590 Ga0501074_0274543 Ga0501074_0274543_82_1113 327
576 3300049591 Ga0501075_0016477 Ga0501075_0016477_25_1056 327
577 3300049591 Ga0501075_0069962 Ga0501075_0069962_311_1312 327
578 3300049592 Ga0501076_0117833 Ga0501076_0117833_700_1731 327
579 3300049592 Ga0501076_0255100 Ga0501076_0255100_304_1305 327
580 3300049593 Ga0501077_0001429 Ga0501077_0001429_2908_3909 327
581 3300049741 Ga0501079_0041926 Ga0501079_0041926_1333_2334 327
582 3300049742 Ga0501080_0235306 Ga0501080_0235306_165_1196 327
583 3300049742 Ga0501080_0442074 Ga0501080_0442074_36_1037 327
584 3300049824 Ga0501045_0116181 Ga0501045_0116181_370_1371 327
585 3300049824 Ga0501045_0118558 Ga0501045_0118558_170_1201 327
586 3300050507 nmdc:mga05p37_30364_c1 nmdc:mga05p37_30364_c1_3600_4616 327
587 3300050507 nmdc:mga05p37_879_c1 nmdc:mga05p37_879_c1_12798_13874 327
588 3300050508 nmdc:mga09592_697_c1 nmdc:mga09592_697_c1_13292_14368 327
589 3300050508 nmdc:mga09592_97874_c1 nmdc:mga09592_97874_c1_1451_2437 327
590 3300050510 nmdc:mga06r32_28617_c1 nmdc:mga06r32_28617_c1_1192_2208 327
591 3300050510 nmdc:mga06r32_394_c1 nmdc:mga06r32_394_c1_5118_6194 327
592 3300050511 nmdc:mga08y16_1049_c1 nmdc:mga08y16_1049_c1_3870_4946 327
593 3300050512 nmdc:mga0n895_113096_c1 nmdc:mga0n895_113096_c1_1059_2069 327
594 3300050513 nmdc:mga0rr50_17172_c1 nmdc:mga0rr50_17172_c1_217_1212 327
595 3300050513 nmdc:mga0rr50_75455_c1 nmdc:mga0rr50_75455_c1_717_1700 327
596 3300050514 nmdc:mga08x19_14975_c1 nmdc:mga08x19_14975_c1_194_1177 327
597 3300050514 nmdc:mga08x19_3171_c1 nmdc:mga08x19_3171_c1_485_1501 327
598 3300053084 Ga0495595_0040572 Ga0495595_0040572_776_1930 327
599 3300053730 Ga0500645_001001 Ga0500645_001001_13082_14065 327
600 3300054114 Ga0501084_0000042 Ga0501084_0000042_63485_64471 327
601 3300054114 Ga0501084_0000978 Ga0501084_0000978_16710_17741 327
602 3300060353 Ga0501082_0047293 Ga0501082_0047293_2119_3150 327
603 3300060353 Ga0501082_0145516 Ga0501082_0145516_821_1822 327
604 3300061734 Ga0530510_0036432 Ga0530510_0036432_1761_2792 327
605 3300061734 Ga0530510_0134932 Ga0530510_0134932_289_1290 327
606 2162886011 MRS1b_contig_9156956 MRS1b_0592.00002970 328
607 3300005290 Ga0065712_10068215 Ga0065712_1006821510 328
608 3300005331 Ga0070670_100051581 Ga0070670_1000515815 328
609 3300005331 Ga0070670_100249923 Ga0070670_1002499232 328
610 3300005334 Ga0068869_100207090 Ga0068869_1002070902 328
611 3300005335 Ga0070666_10022333 Ga0070666_100223332 328
612 3300005336 Ga0070680_100141305 Ga0070680_1001413051 328
613 3300005340 Ga0070689_100044183 Ga0070689_1000441835 328
614 3300005353 Ga0070669_100020230 Ga0070669_1000202302 328
615 3300005354 Ga0070675_100120440 Ga0070675_1001204402 328
616 3300005355 Ga0070671_100121957 Ga0070671_1001219571 328
617 3300005367 Ga0070667_100274968 Ga0070667_1002749681 328
618 3300005459 Ga0068867_100163777 Ga0068867_1001637772 328
619 3300005471 Ga0070698_100247966 Ga0070698_1002479662 328
620 3300005549 Ga0070704_100145746 Ga0070704_1001457462 328
621 3300005844 Ga0068862_100143065 Ga0068862_1001430652 328
622 3300006358 Ga0068871_100106942 Ga0068871_1001069422 328
623 3300006847 Ga0075431_100237076 Ga0075431_1002370762 328
624 3300006852 Ga0075433_10071796 Ga0075433_100717962 328
625 3300006871 Ga0075434_100037518 Ga0075434_1000375182 328
626 3300006871 Ga0075434_100038555 Ga0075434_1000385553 328
627 3300006881 Ga0068865_100133990 Ga0068865_1001339901 328
628 3300009094 Ga0111539_10000313 Ga0111539_1000031341 328
629 3300009094 Ga0111539_10034521 Ga0111539_100345211 328
630 3300009147 Ga0114129_10143210 Ga0114129_101432104 328
631 3300017792 Ga0163161_10123250 Ga0163161_101232503 328
632 3300025903 Ga0207680_10029395 Ga0207680_100293953 328
633 3300025926 Ga0207659_10290877 Ga0207659_102908772 328
634 3300025936 Ga0207670_10121556 Ga0207670_101215561 328
635 3300025938 Ga0207704_10107453 Ga0207704_101074531 328
636 3300025940 Ga0207691_10046572 Ga0207691_100465721 328
637 3300025942 Ga0207689_10130345 Ga0207689_101303452 328
638 3300025942 Ga0207689_10223473 Ga0207689_102234732 328
639 3300025945 Ga0207679_10121748 Ga0207679_101217482 328
640 3300026075 Ga0207708_10084885 Ga0207708_100848851 328
641 3300027907 Ga0207428_10042671 Ga0207428_100426712 328
642 3300035172 Ga0373955_0124613 Ga0373955_0124613_316_1302 328
643 3300035724 Ga0373933_0019008 Ga0373933_0019008_1553_2539 328
644 3300036401 Ga0373937_0253348 Ga0373937_0253348_614_1600 328
645 3300045976 Ga0466967_0590907 Ga0466967_0590907_57_1049 328
646 3300046691 Ga0495670_0064033 Ga0495670_0064033_681_1667 328
647 3300048912 Ga0496109_0071421 Ga0496109_0071421_1189_2175 328
648 3300048916 Ga0496113_0138174 Ga0496113_0138174_359_1345 328
649 3300049575 Ga0501039_0073686 Ga0501039_0073686_1153_2139 328
650 3300049582 Ga0501048_0051900 Ga0501048_0051900_1339_2325 328
651 3300049588 Ga0501072_0020235 Ga0501072_0020235_1093_2133 328
652 3300049591 Ga0501075_0042799 Ga0501075_0042799_202_1188 328
653 3300049592 Ga0501076_0046292 Ga0501076_0046292_1148_2134 328
654 3300049741 Ga0501079_0148053 Ga0501079_0148053_322_1308 328
655 3300049742 Ga0501080_0320556 Ga0501080_0320556_90_1076 328
656 3300049824 Ga0501045_0055158 Ga0501045_0055158_68_1054 328
657 3300050510 nmdc:mga06r32_112269_c1 nmdc:mga06r32_112269_c1_1390_2382 328
658 3300050512 nmdc:mga0n895_45332_c1 nmdc:mga0n895_45332_c1_819_1805 328
659 3300050515 nmdc:mga0a205_20010_c1 nmdc:mga0a205_20010_c1_3419_4405 328
660 3300050515 nmdc:mga0a205_271560_c1 nmdc:mga0a205_271560_c1_286_1272 328
661 3300054114 Ga0501084_0030858 Ga0501084_0030858_1589_2575 328

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

81

192

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1rjw-assembly1.cif.gz_C crystal structure of nad(+)-dependent alcohol dehydrogenase from bacillus stearothermophilus strain lld-r 0.9406 1 327
4z6k-assembly1.cif.gz_B alcohol dehydrogenase from the antarctic psychrophile moraxella sp. tae 123 0.9403 1 328
6iqd-assembly1.cif.gz_A crystal structure of alcohol dehydrogenase from geobacillus stearothermophilus 0.9391 1 328
4z6k-assembly1.cif.gz_B alcohol dehydrogenase from the antarctic psychrophile moraxella sp. tae 123 0.9376 1 328
6iqd-assembly1.cif.gz_A crystal structure of alcohol dehydrogenase from geobacillus stearothermophilus 0.9363 1 328
ID Description Score Start End Superfamily
af_P9WQC1_8_164_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9718 1 147 3.90.180.10
af_Q2G0G1_1_137_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9473 1 139 3.90.180.10
1rjwC01 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9429 1 327 3.90.180.10
af_Q2G2C7_1_145_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.94 1 144 3.90.180.10
af_Q556G1_5_141_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9365 1 135 3.90.180.10
ID Description Score Start End GO Terms
AF-A0A6P5UT19-F1-model_v4 deleted 0.9858 1 328
AF-H7GGA1-F1-model_v4 Zinc-binding alcohol dehydrogenase family protein 0.9846 1 328 GO:0004022
GO:0005737
AF-A0A6P5UT19-F1-model_v4 deleted 0.9829 1 328
AF-A0A831KP22-F1-model_v4 Alcohol dehydrogenase 0.9812 1 246 GO:0004022
GO:0005737
GO:0008270
AF-A0A839ZTP5-F1-model_v4 Propanol-preferring alcohol dehydrogenase (EC 1.1.1.1) 0.9798 57 328 GO:0004022
GO:0005737
GO:0008270

Feature Viewer

pLDDT pTM Quality
95.94 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map