F473381

General Info

Members Datasets Scaffolds Average Seq Length
661 303 1322 167

Family's Representative Sequence

Representative Sequence 3300005437|Ga0070710_10292215|Ga0070710_102922152
Length 183
Sequence MQSNRSLEIGTGLFVLLGFAALAFLTTQLPGSSLRLKGADSGYKVLAAFDNIGDLKEGSPVTLAGVRIGRVEGIAIDPKSFKANVTLRIDRQYSEIPDDSDASIQTAGLLGGKYIGLTPGGSETFLKEGGQIELTQSALVLENLINKLFASIASKGPDQQQNGQAPAPSPAAPGKEETGKEKK

Samples

Sample ID Description Type Environment
1 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
168 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
172 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
173 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
174 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
175 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
176 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
177 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
178 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
179 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
180 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
181 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
182 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
183 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
184 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
185 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
186 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
187 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
188 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
189 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
190 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
191 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
192 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
193 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
194 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
195 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
196 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
197 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
198 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
199 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
200 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
201 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
202 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
203 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
204 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
205 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
206 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
207 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
208 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
209 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
210 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
211 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
212 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
213 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
214 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
215 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
216 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
217 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
218 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
219 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
220 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
221 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
222 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
223 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
224 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
225 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
226 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
227 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
228 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
229 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
230 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
231 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
232 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
233 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
234 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
235 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
236 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
237 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
238 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
239 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
240 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
241 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
242 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
243 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
244 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
245 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
246 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
247 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
248 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
249 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
250 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
251 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
252 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
253 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
254 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
255 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
256 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
257 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
258 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
259 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
260 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
261 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
262 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
263 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
264 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
265 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
269 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
270 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
271 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
272 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
273 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
274 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
275 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
276 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
277 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
278 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
279 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
280 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
282 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
283 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
284 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
285 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
286 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
287 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
288 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
289 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
290 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
291 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
292 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
293 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
294 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
295 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
296 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
297 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
298 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
299 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
300 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
301 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
302 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
303 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.39
Metatranscriptomes 0.61
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.27
Nodule 0
Rhizoplane 6.96
Rhizosphere 87.44
Stem 0
Stem Tuber 0
Unclassified 15.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070710_10292215 3300005437 Unclassified 1061
2 JGI25406J46586_10008769 3300003203 Bacteria 4556
3 rootH1_10088353 3300003316 Bacteria 2682
4 Ga0070658_10574648 3300005327 Bacteria 976
5 Ga0070676_10043460 3300005328 Bacteria 2612
6 Ga0070683_100028577 3300005329 Bacteria 5041
7 Ga0070683_100370560 3300005329 Unclassified 1364
8 Ga0070683_101057867 3300005329 Unclassified 779
9 Ga0070690_100001614 3300005330 Bacteria 11844
10 Ga0070690_100020619 3300005330 Bacteria 4017
11 Ga0070690_100041812 3300005330 Bacteria 2902
12 Ga0070690_100126102 3300005330 Bacteria 1724
13 Ga0070690_100185303 3300005330 Bacteria 1440
14 Ga0070670_100006939 3300005331 Bacteria 9601
15 Ga0070670_100031066 3300005331 Bacteria 4600
16 Ga0070677_10002958 3300005333 Bacteria 5462
17 Ga0070677_10004245 3300005333 Bacteria 4667
18 Ga0070677_10353554 3300005333 Unclassified 762
19 Ga0068869_100099047 3300005334 Bacteria 2203
20 Ga0068869_100137454 3300005334 Bacteria 1884
21 Ga0068869_100163942 3300005334 Bacteria 1732
22 Ga0068869_100385910 3300005334 Unclassified 1149
23 Ga0070666_10005143 3300005335 Bacteria 8009
24 Ga0070666_10010135 3300005335 Bacteria 5886
25 Ga0070666_10185480 3300005335 Bacteria 1460
26 Ga0070680_100553026 3300005336 Bacteria 986
27 Ga0070682_100048983 3300005337 Bacteria 2633
28 Ga0070682_100176752 3300005337 Bacteria 1488
29 Ga0070682_100492964 3300005337 Bacteria 948
30 Ga0070682_101001128 3300005337 Unclassified 694
31 Ga0068868_100005051 3300005338 Bacteria 9264
32 Ga0068868_100013968 3300005338 Bacteria 5907
33 Ga0068868_100155215 3300005338 Bacteria 1887
34 Ga0068868_100713868 3300005338 Bacteria 898
35 Ga0070660_100661674 3300005339 Unclassified 875
36 Ga0070689_100004511 3300005340 Bacteria 9430
37 Ga0070689_100161320 3300005340 Bacteria 1812
38 Ga0070691_10132258 3300005341 Bacteria 1265
39 Ga0070661_100046757 3300005344 Unclassified 3167
40 Ga0070661_100087663 3300005344 Bacteria 2302
41 Ga0070692_10965552 3300005345 Bacteria 594
42 Ga0070668_100039564 3300005347 Bacteria 3605
43 Ga0070668_100624342 3300005347 Bacteria 945
44 Ga0070675_100039378 3300005354 Bacteria 3857
45 Ga0070675_100344483 3300005354 Bacteria 1320
46 Ga0070675_100975375 3300005354 Unclassified 778
47 Ga0070671_100003974 3300005355 Bacteria 11643
48 Ga0070671_100007227 3300005355 Bacteria 8879
49 Ga0070671_100021177 3300005355 Bacteria 5308
50 Ga0070671_100054883 3300005355 Bacteria 3313
51 Ga0070671_100171920 3300005355 Unclassified 1833
52 Ga0070674_100084166 3300005356 Bacteria 2280
53 Ga0070673_100074381 3300005364 Bacteria 2738
54 Ga0070673_100079485 3300005364 Bacteria 2655
55 Ga0070673_100130619 3300005364 Bacteria 2107
56 Ga0070673_100314770 3300005364 Bacteria 1381
57 Ga0070673_100437431 3300005364 Bacteria 1175
58 Ga0070688_101060287 3300005365 Bacteria 646
59 Ga0070659_100339322 3300005366 Bacteria 1258
60 Ga0070667_100002544 3300005367 Bacteria 15874
61 Ga0070667_100008032 3300005367 Bacteria 8754
62 Ga0070667_100015547 3300005367 Bacteria 6291
63 Ga0070667_100032604 3300005367 Bacteria 4345
64 Ga0070667_100064141 3300005367 Bacteria 3116
65 Ga0070667_101100939 3300005367 Bacteria 742
66 Ga0070709_10351243 3300005434 Bacteria 1090
67 Ga0070714_100002141 3300005435 Bacteria 14518
68 Ga0070713_100008144 3300005436 Bacteria 7419
69 Ga0070713_100009169 3300005436 Bacteria 7062
70 Ga0070710_10010681 3300005437 Bacteria 4516
71 Ga0070710_10715679 3300005437 Bacteria 708
72 Ga0070701_10005019 3300005438 Bacteria 5425
73 Ga0070701_10102588 3300005438 Unclassified 1587
74 Ga0070711_100005169 3300005439 Bacteria 7782
75 Ga0070711_100088340 3300005439 Bacteria 2227
76 Ga0070711_100267082 3300005439 Bacteria 1349
77 Ga0070711_100858523 3300005439 Bacteria 773
78 Ga0070705_100359756 3300005440 Unclassified 1064
79 Ga0070705_100518577 3300005440 Bacteria 908
80 Ga0070700_100085478 3300005441 Bacteria 2047
81 Ga0070700_100798301 3300005441 Bacteria 760
82 Ga0070694_100504564 3300005444 Bacteria 963
83 Ga0070708_100451942 3300005445 Unclassified 1212
84 Ga0070663_100055784 3300005455 Bacteria 2829
85 Ga0070678_100079626 3300005456 Bacteria 2479
86 Ga0070678_100089397 3300005456 Bacteria 2357
87 Ga0070678_100100928 3300005456 Bacteria 2236
88 Ga0070678_100333581 3300005456 Bacteria 1299
89 Ga0070662_100900961 3300005457 Unclassified 755
90 Ga0070662_101240954 3300005457 Unclassified 641
91 Ga0070681_10001176 3300005458 Bacteria 22633
92 Ga0070681_10012210 3300005458 Bacteria 8516
93 Ga0070681_10047638 3300005458 Bacteria 4285
94 Ga0070681_10077970 3300005458 Bacteria 3270
95 Ga0070681_10094803 3300005458 Bacteria 2933
96 Ga0068867_100067446 3300005459 Bacteria 2668
97 Ga0068867_100430478 3300005459 Unclassified 1120
98 Ga0068867_100987185 3300005459 Bacteria 763
99 Ga0070685_10069525 3300005466 Bacteria 2083
100 Ga0070685_10069917 3300005466 Bacteria 2077
101 Ga0070685_10091728 3300005466 Bacteria 1840
102 Ga0070699_100067668 3300005518 Bacteria 3102
103 Ga0070679_100001010 3300005530 Bacteria 24545
104 Ga0070679_100005943 3300005530 Bacteria 11348
105 Ga0070679_100882879 3300005530 Unclassified 837
106 Ga0070684_100032852 3300005535 Bacteria 4427
107 Ga0070684_100284542 3300005535 Bacteria 1515
108 Ga0068853_100034603 3300005539 Bacteria 4289
109 Ga0068853_100180456 3300005539 Unclassified 1914
110 Ga0068853_100520152 3300005539 Unclassified 1125
111 Ga0070672_100112020 3300005543 Bacteria 2225
112 Ga0070672_100113016 3300005543 Bacteria 2216
113 Ga0070672_100134881 3300005543 Unclassified 2032
114 Ga0070686_100013559 3300005544 Bacteria 4672
115 Ga0070686_100067431 3300005544 Bacteria 2331
116 Ga0070686_100079703 3300005544 Bacteria 2165
117 Ga0070686_100151305 3300005544 Bacteria 1625
118 Ga0070686_100238064 3300005544 Bacteria 1324
119 Ga0070695_100004839 3300005545 Bacteria 7929
120 Ga0070695_100249603 3300005545 Unclassified 1291
121 Ga0070696_100915476 3300005546 Bacteria 728
122 Ga0070693_100107505 3300005547 Unclassified 1710
123 Ga0070693_100141428 3300005547 Bacteria 1515
124 Ga0070665_100007631 3300005548 Bacteria 10997
125 Ga0070665_100009143 3300005548 Bacteria 10039
126 Ga0070665_100023628 3300005548 Bacteria 6189
127 Ga0070665_100030505 3300005548 Bacteria 5424
128 Ga0070665_100416582 3300005548 Bacteria 1352
129 Ga0070665_100541953 3300005548 Bacteria 1176
130 Ga0070665_100545180 3300005548 Bacteria 1172
131 Ga0070704_100102781 3300005549 Bacteria 2157
132 Ga0068855_100008493 3300005563 Bacteria 12414
133 Ga0068855_100142023 3300005563 Bacteria 2735
134 Ga0068855_100701954 3300005563 Unclassified 1082
135 Ga0070664_100015964 3300005564 Bacteria 6149
136 Ga0070664_100062395 3300005564 Bacteria 3177
137 Ga0070664_100062655 3300005564 Bacteria 3171
138 Ga0070664_100175016 3300005564 Bacteria 1905
139 Ga0068857_100537669 3300005577 Bacteria 1100
140 Ga0068856_100043679 3300005614 Unclassified 4409
141 Ga0068856_100233844 3300005614 Bacteria 1853
142 Ga0068856_101824701 3300005614 Unclassified 620
143 Ga0070702_100007152 3300005615 Bacteria 5331
144 Ga0070702_100263943 3300005615 Bacteria 1174
145 Ga0068852_100172559 3300005616 Bacteria 2028
146 Ga0068852_100435273 3300005616 Bacteria 1296
147 Ga0068852_100851892 3300005616 Bacteria 927
148 Ga0068859_100000879 3300005617 Bacteria 30647
149 Ga0068859_100045177 3300005617 Unclassified 4426
150 Ga0068859_100123865 3300005617 Bacteria 2652
151 Ga0068859_100206466 3300005617 Bacteria 2050
152 Ga0068859_100472767 3300005617 Unclassified 1349
153 Ga0068864_100130231 3300005618 Bacteria 2259
154 Ga0068864_100180701 3300005618 Unclassified 1929
155 Ga0068864_100324967 3300005618 Bacteria 1446
156 Ga0068864_100364374 3300005618 Bacteria 1366
157 Ga0068861_100001242 3300005719 Bacteria 15887
158 Ga0068861_100010021 3300005719 Bacteria 6567
159 Ga0068861_100057361 3300005719 Bacteria 2974
160 Ga0068861_100148328 3300005719 Bacteria 1922
161 Ga0068861_100173695 3300005719 Bacteria 1788
162 Ga0068851_10128145 3300005834 Bacteria 1370
163 Ga0068870_10073584 3300005840 Unclassified 1869
164 Ga0068870_10120681 3300005840 Unclassified 1510
165 Ga0068863_100001233 3300005841 Bacteria 25518
166 Ga0068863_100012651 3300005841 Bacteria 8140
167 Ga0068863_100030107 3300005841 Bacteria 5185
168 Ga0068863_100043810 3300005841 Bacteria 4248
169 Ga0068863_100233638 3300005841 Unclassified 1774
170 Ga0068863_100278989 3300005841 Bacteria 1619
171 Ga0068863_100478627 3300005841 Bacteria 1224
172 Ga0068858_100000605 3300005842 Bacteria 37465
173 Ga0068858_100001895 3300005842 Bacteria 21356
174 Ga0068858_100010305 3300005842 Bacteria 8860
175 Ga0068858_100028741 3300005842 Bacteria 5163
176 Ga0068858_100066894 3300005842 Bacteria 3327
177 Ga0068858_100652409 3300005842 Unclassified 1023
178 Ga0068858_100827801 3300005842 Bacteria 904
179 Ga0068858_101229038 3300005842 Unclassified 737
180 Ga0068860_100001307 3300005843 Bacteria 27083
181 Ga0068860_100001577 3300005843 Bacteria 24567
182 Ga0068860_100002811 3300005843 Bacteria 18098
183 Ga0068860_100241035 3300005843 Bacteria 1759
184 Ga0068860_100307017 3300005843 Bacteria 1555
185 Ga0068862_100008641 3300005844 Bacteria 8424
186 Ga0068862_100038703 3300005844 Bacteria 4046
187 Ga0068862_100078432 3300005844 Bacteria 2862
188 Ga0068862_100190704 3300005844 Bacteria 1844
189 Ga0068862_100433263 3300005844 Bacteria 1236
190 Ga0068862_100599153 3300005844 Bacteria 1058
191 Ga0068862_100671749 3300005844 Bacteria 1001
192 Ga0068862_100873500 3300005844 Bacteria 883
193 Ga0068862_101114250 3300005844 Bacteria 785
194 Ga0081455_10000043 3300005937 Bacteria 132283
195 Ga0081455_10007291 3300005937 Bacteria 11670
196 Ga0081455_10360746 3300005937 Bacteria 1022
197 Ga0081539_10000046 3300005985 Bacteria 275677
198 Ga0070717_10102651 3300006028 Bacteria 2430
199 Ga0070716_100956556 3300006173 Unclassified 674
200 Ga0097621_100024912 3300006237 Bacteria 4678
201 Ga0097621_100033908 3300006237 Bacteria 4069
202 Ga0097621_100219591 3300006237 Bacteria 1656
203 Ga0068871_100043292 3300006358 Bacteria 3616
204 Ga0068871_100060607 3300006358 Bacteria 3087
205 Ga0068871_100187801 3300006358 Bacteria 1778
206 Ga0068871_100337733 3300006358 Bacteria 1330
207 Ga0068871_100739426 3300006358 Bacteria 903
208 Ga0075428_101037933 3300006844 Bacteria 867
209 Ga0075430_100277379 3300006846 Bacteria 1387
210 Ga0075434_100562950 3300006871 Bacteria 1159
211 Ga0068865_100076595 3300006881 Bacteria 2388
212 Ga0068865_100124262 3300006881 Bacteria 1924
213 Ga0068865_100550295 3300006881 Bacteria 969
214 Ga0068865_101181913 3300006881 Bacteria 676
215 Ga0075436_100057998 3300006914 Bacteria 2674
216 Ga0097620_100000879 3300006931 Bacteria 30647
217 Ga0097620_100045177 3300006931 Unclassified 4426
218 Ga0097620_100123865 3300006931 Bacteria 2652
219 Ga0097620_100206464 3300006931 Bacteria 2050
220 Ga0097620_100472830 3300006931 Unclassified 1349
221 Ga0075435_100098704 3300007076 Bacteria 2418
222 Ga0099795_10000008 3300007788 Bacteria 103465
223 Ga0105240_10012231 3300009093 Bacteria 11864
224 Ga0105240_10095963 3300009093 Bacteria 3614
225 Ga0105240_10107060 3300009093 Bacteria 3390
226 Ga0111539_10073103 3300009094 Bacteria 4043
227 Ga0111539_10331041 3300009094 Unclassified 1773
228 Ga0105245_10029791 3300009098 Bacteria 4824
229 Ga0105247_10000651 3300009101 Bacteria 27528
230 Ga0105247_10015776 3300009101 Bacteria 4522
231 Ga0105247_10097833 3300009101 Bacteria 1872
232 Ga0105247_10177938 3300009101 Bacteria 1418
233 Ga0105247_10181145 3300009101 Bacteria 1406
234 Ga0105242_10445280 3300009176 Bacteria 1220
235 Ga0105242_10699821 3300009176 Unclassified 991
236 Ga0105248_10003980 3300009177 Bacteria 16333
237 Ga0105248_10039842 3300009177 Bacteria 5266
238 Ga0105248_10356108 3300009177 Bacteria 1648
239 Ga0105248_11018404 3300009177 Bacteria 936
240 Ga0105238_10023366 3300009551 Bacteria 6301
241 Ga0105238_10030389 3300009551 Bacteria 5499
242 Ga0105238_10058078 3300009551 Bacteria 3879
243 Ga0105238_10132036 3300009551 Unclassified 2475
244 Ga0105238_10441241 3300009551 Bacteria 1298
245 Ga0105238_11721950 3300009551 Bacteria 658
246 Ga0105249_10004536 3300009553 Bacteria 12005
247 Ga0105249_10097848 3300009553 Bacteria 2755
248 Ga0105249_11084446 3300009553 Bacteria 871
249 Ga0105249_11463634 3300009553 Bacteria 755
250 Ga0099796_10000012 3300010159 Bacteria 55750
251 Ga0105239_10057030 3300010375 Bacteria 4285
252 Ga0105246_10052936 3300011119 Unclassified 2792
253 Ga0105246_10103665 3300011119 Bacteria 2076
254 Ga0105246_11306666 3300011119 Bacteria 672
255 Ga0157370_10015294 3300013104 Bacteria 7805
256 Ga0157370_10020326 3300013104 Bacteria 6632
257 Ga0157369_10085823 3300013105 Bacteria 3363
258 Ga0157369_11687829 3300013105 Unclassified 644
259 Ga0157374_10004416 3300013296 Bacteria 11830
260 Ga0157374_10620849 3300013296 Bacteria 1092
261 Ga0157374_11404540 3300013296 Unclassified 721
262 Ga0157378_10005593 3300013297 Bacteria 11009
263 Ga0157378_10346334 3300013297 Bacteria 1450
264 Ga0163162_10180909 3300013306 Bacteria 2234
265 Ga0163162_10412221 3300013306 Bacteria 1483
266 Ga0163162_12246751 3300013306 Unclassified 626
267 Ga0157372_10174890 3300013307 Bacteria 2485
268 Ga0157372_10218838 3300013307 Bacteria 2207
269 Ga0157372_10392409 3300013307 Unclassified 1617
270 Ga0157375_10008012 3300013308 Bacteria 9250
271 Ga0157375_10009837 3300013308 Bacteria 8410
272 Ga0157375_10057503 3300013308 Bacteria 3845
273 Ga0157375_10905616 3300013308 Bacteria 1026
274 Ga0163163_10053164 3300014325 Bacteria 3997
275 Ga0163163_10086101 3300014325 Unclassified 3151
276 Ga0163163_10621096 3300014325 Bacteria 1144
277 Ga0163163_10785124 3300014325 Bacteria 1016
278 Ga0157380_10139282 3300014326 Bacteria 2082
279 Ga0157380_10200215 3300014326 Bacteria 1771
280 Ga0157380_10278720 3300014326 Unclassified 1529
281 Ga0157380_11423289 3300014326 Unclassified 744
282 Ga0157380_11546247 3300014326 Bacteria 718
283 Ga0157379_10000348 3300014968 Bacteria 37206
284 Ga0157379_10002955 3300014968 Bacteria 14338
285 Ga0157379_10066371 3300014968 Bacteria 3225
286 Ga0157379_10857967 3300014968 Bacteria 859
287 Ga0157376_10115198 3300014969 Bacteria 2373
288 Ga0157376_10127047 3300014969 Bacteria 2269
289 Ga0157376_10260482 3300014969 Bacteria 1624
290 Ga0163161_10102888 3300017792 Bacteria 2128
291 Ga0163161_10193335 3300017792 Bacteria 1565
292 Ga0206356_10952632 3300020070 Unclassified 744
293 Ga0206353_11203996 3300020082 Unclassified 1061
294 Ga0206353_11760363 3300020082 Bacteria 758
295 Ga0224712_10044193 3300022467 Bacteria 1698
296 Ga0207697_10220881 3300025315 Bacteria 836
297 Ga0207656_10107608 3300025321 Bacteria 1285
298 Ga0207682_10004514 3300025893 Bacteria 5798
299 Ga0207682_10006063 3300025893 Bacteria 4890
300 Ga0207692_10577109 3300025898 Bacteria 721
301 Ga0207710_10000406 3300025900 Bacteria 28648
302 Ga0207710_10007467 3300025900 Bacteria 4628
303 Ga0207710_10058566 3300025900 Bacteria 1742
304 Ga0207710_10320267 3300025900 Bacteria 786
305 Ga0207688_10199541 3300025901 Bacteria 1199
306 Ga0207680_10049244 3300025903 Bacteria 2507
307 Ga0207680_10064696 3300025903 Bacteria 2243
308 Ga0207680_10098072 3300025903 Bacteria 1878
309 Ga0207680_10300314 3300025903 Unclassified 1119
310 Ga0207699_10006286 3300025906 Bacteria 5739
311 Ga0207699_10170452 3300025906 Bacteria 1456
312 Ga0207645_10025797 3300025907 Bacteria 3802
313 Ga0207645_10447630 3300025907 Unclassified 872
314 Ga0207643_10006068 3300025908 Bacteria 6456
315 Ga0207643_10041771 3300025908 Bacteria 2585
316 Ga0207705_10091923 3300025909 Bacteria 2223
317 Ga0207654_10336707 3300025911 Unclassified 1036
318 Ga0207707_10000560 3300025912 Bacteria 37696
319 Ga0207707_10032037 3300025912 Bacteria 4601
320 Ga0207707_10066171 3300025912 Bacteria 3147
321 Ga0207707_10367781 3300025912 Bacteria 1237
322 Ga0207695_10062893 3300025913 Bacteria 3828
323 Ga0207695_10086064 3300025913 Bacteria 3171
324 Ga0207695_10097864 3300025913 Bacteria 2934
325 Ga0207695_10103797 3300025913 Bacteria 2833
326 Ga0207695_10555075 3300025913 Bacteria 1030
327 Ga0207671_10203754 3300025914 Unclassified 1545
328 Ga0207693_10076336 3300025915 Bacteria 2624
329 Ga0207663_10158950 3300025916 Bacteria 1593
330 Ga0207660_10007312 3300025917 Bacteria 7146
331 Ga0207660_10078638 3300025917 Bacteria 2417
332 Ga0207660_10631456 3300025917 Bacteria 873
333 Ga0207662_10559502 3300025918 Unclassified 793
334 Ga0207649_10678572 3300025920 Unclassified 798
335 Ga0207652_10002183 3300025921 Bacteria 16718
336 Ga0207652_10010272 3300025921 Bacteria 7534
337 Ga0207681_10675559 3300025923 Bacteria 857
338 Ga0207694_10012034 3300025924 Bacteria 6524
339 Ga0207694_10250763 3300025924 Bacteria 1448
340 Ga0207694_10313954 3300025924 Bacteria 1293
341 Ga0207650_10147494 3300025925 Bacteria 1854
342 Ga0207650_10276918 3300025925 Bacteria 1365
343 Ga0207650_10357615 3300025925 Bacteria 1202
344 Ga0207659_10012808 3300025926 Bacteria 5354
345 Ga0207659_10563518 3300025926 Bacteria 969
346 Ga0207700_10081881 3300025928 Bacteria 2522
347 Ga0207664_10001080 3300025929 Bacteria 18189
348 Ga0207664_10076015 3300025929 Bacteria 2717
349 Ga0207664_10941413 3300025929 Bacteria 775
350 Ga0207644_10000879 3300025931 Bacteria 18950
351 Ga0207644_10011559 3300025931 Bacteria 5844
352 Ga0207644_10031692 3300025931 Bacteria 3685
353 Ga0207644_10440289 3300025931 Bacteria 1070
354 Ga0207706_10081899 3300025933 Bacteria 2837
355 Ga0207686_10320621 3300025934 Unclassified 1158
356 Ga0207670_10008818 3300025936 Bacteria 5714
357 Ga0207670_10055070 3300025936 Bacteria 2686
358 Ga0207669_10058178 3300025937 Bacteria 2357
359 Ga0207669_10545928 3300025937 Bacteria 934
360 Ga0207704_10169276 3300025938 Bacteria 1565
361 Ga0207704_10247730 3300025938 Unclassified 1335
362 Ga0207704_10582666 3300025938 Bacteria 913
363 Ga0207665_10478642 3300025939 Bacteria 959
364 Ga0207665_10661696 3300025939 Unclassified 819
365 Ga0207665_10741665 3300025939 Unclassified 774
366 Ga0207691_10001665 3300025940 Bacteria 21983
367 Ga0207691_10095148 3300025940 Bacteria 2665
368 Ga0207711_10003094 3300025941 Bacteria 14507
369 Ga0207711_10006632 3300025941 Bacteria 9752
370 Ga0207711_10083379 3300025941 Bacteria 2796
371 Ga0207711_10537416 3300025941 Bacteria 1090
372 Ga0207689_10122256 3300025942 Bacteria 2141
373 Ga0207689_10153088 3300025942 Unclassified 1901
374 Ga0207689_10179557 3300025942 Bacteria 1746
375 Ga0207689_10269014 3300025942 Unclassified 1411
376 Ga0207661_10161958 3300025944 Bacteria 1942
377 Ga0207661_10603129 3300025944 Bacteria 1008
378 Ga0207679_10013897 3300025945 Bacteria 5278
379 Ga0207667_10003234 3300025949 Bacteria 20105
380 Ga0207667_10076253 3300025949 Bacteria 3480
381 Ga0207667_10148672 3300025949 Bacteria 2411
382 Ga0207651_10064499 3300025960 Bacteria 2564
383 Ga0207651_10241899 3300025960 Unclassified 1471
384 Ga0207651_10285603 3300025960 Bacteria 1366
385 Ga0207712_10122545 3300025961 Bacteria 1969
386 Ga0207712_10198555 3300025961 Bacteria 1589
387 Ga0207712_11104804 3300025961 Bacteria 706
388 Ga0207668_10145746 3300025972 Bacteria 1827
389 Ga0207640_10624439 3300025981 Bacteria 915
390 Ga0207658_10004147 3300025986 Bacteria 10098
391 Ga0207658_10028540 3300025986 Bacteria 3930
392 Ga0207677_10108643 3300026023 Bacteria 2060
393 Ga0207703_10001200 3300026035 Bacteria 24281
394 Ga0207703_10001262 3300026035 Bacteria 23622
395 Ga0207703_10002873 3300026035 Bacteria 14655
396 Ga0207703_10008398 3300026035 Bacteria 8164
397 Ga0207703_10494510 3300026035 Bacteria 1147
398 Ga0207703_10537494 3300026035 Bacteria 1101
399 Ga0207678_10033147 3300026067 Bacteria 4501
400 Ga0207708_10016278 3300026075 Bacteria 5588
401 Ga0207708_10043182 3300026075 Bacteria 3436
402 Ga0207708_10120875 3300026075 Bacteria 2041
403 Ga0207708_10619854 3300026075 Unclassified 918
404 Ga0207702_10123759 3300026078 Bacteria 2318
405 Ga0207702_10187861 3300026078 Bacteria 1907
406 Ga0207702_10300895 3300026078 Bacteria 1522
407 Ga0207641_10000078 3300026088 Bacteria 143842
408 Ga0207641_10005562 3300026088 Bacteria 10741
409 Ga0207641_10211633 3300026088 Unclassified 1793
410 Ga0207641_10511323 3300026088 Bacteria 1167
411 Ga0207648_10084766 3300026089 Bacteria 2764
412 Ga0207648_10249907 3300026089 Bacteria 1581
413 Ga0207648_10442590 3300026089 Bacteria 1182
414 Ga0207648_10697771 3300026089 Bacteria 940
415 Ga0207676_10012429 3300026095 Bacteria 6100
416 Ga0207676_10103636 3300026095 Bacteria 2365
417 Ga0207676_10105548 3300026095 Bacteria 2345
418 Ga0207676_10177832 3300026095 Bacteria 1860
419 Ga0207676_11171564 3300026095 Bacteria 761
420 Ga0207674_10111979 3300026116 Bacteria 2703
421 Ga0207674_10241635 3300026116 Bacteria 1753
422 Ga0207675_100002767 3300026118 Bacteria 17224
423 Ga0207675_100020534 3300026118 Bacteria 6156
424 Ga0207675_100067064 3300026118 Bacteria 3354
425 Ga0207675_100164554 3300026118 Bacteria 2118
426 Ga0207675_100360574 3300026118 Bacteria 1426
427 Ga0207675_100362704 3300026118 Bacteria 1422
428 Ga0207683_10148672 3300026121 Unclassified 2114
429 Ga0207683_10587783 3300026121 Bacteria 1030
430 Ga0207683_10610383 3300026121 Bacteria 1010
431 Ga0207698_10609802 3300026142 Bacteria 1077
432 Ga0207698_11297157 3300026142 Bacteria 743
433 Ga0209179_1000100 3300027512 Bacteria 11846
434 Ga0207428_10117791 3300027907 Bacteria 2038
435 Ga0268266_10000944 3300028379 Bacteria 37085
436 Ga0268266_10015999 3300028379 Bacteria 6415
437 Ga0268266_10069795 3300028379 Bacteria 3045
438 Ga0268266_10157403 3300028379 Bacteria 2053
439 Ga0268266_10375174 3300028379 Bacteria 1340
440 Ga0268265_10174573 3300028380 Unclassified 1840
441 Ga0268265_10272116 3300028380 Bacteria 1511
442 Ga0268265_10283890 3300028380 Bacteria 1482
443 Ga0268265_10391542 3300028380 Bacteria 1282
444 Ga0268264_10000142 3300028381 Bacteria 170046
445 Ga0268264_10008822 3300028381 Bacteria 8358
446 Ga0268264_10035194 3300028381 Bacteria 4122
447 Ga0268264_10044472 3300028381 Bacteria 3684
448 Ga0268264_10508242 3300028381 Bacteria 1176
449 Ga0268264_10759999 3300028381 Bacteria 966
450 Ga0268264_11066497 3300028381 Unclassified 816
451 Ga0268264_11166227 3300028381 Bacteria 779
452 Ga0268264_11260017 3300028381 Bacteria 749
453 Ga0265326_10007430 3300028558 Bacteria 3362
454 Ga0265319_1006109 3300028563 Bacteria 5633
455 Ga0265319_1180751 3300028563 Bacteria 650
456 Ga0265334_10061945 3300028573 Bacteria 1408
457 Ga0265318_10002137 3300028577 Bacteria 10744
458 Ga0265338_10006299 3300028800 Bacteria 15170
459 Ga0265338_10016734 3300028800 Bacteria 7946
460 Ga0265330_10007473 3300031235 Bacteria 5320
461 Ga0265332_10000488 3300031238 Bacteria 27403
462 Ga0265328_10099728 3300031239 Bacteria 1075
463 Ga0265325_10112596 3300031241 Bacteria 1320
464 Ga0265329_10017356 3300031242 Unclassified 2478
465 Ga0265340_10005679 3300031247 Bacteria 6899
466 Ga0265340_10060456 3300031247 Unclassified 1815
467 Ga0265340_10113730 3300031247 Bacteria 1249
468 Ga0265339_10018302 3300031249 Bacteria 4131
469 Ga0265331_10002686 3300031250 Bacteria 11855
470 Ga0265331_10062288 3300031250 Bacteria 1760
471 Ga0265316_10010876 3300031344 Bacteria 8263
472 Ga0307513_10016612 3300031456 Bacteria 8869
473 Ga0307513_10035795 3300031456 Bacteria 5549
474 Ga0307513_10086529 3300031456 Bacteria 3212
475 Ga0307513_10127602 3300031456 Bacteria 2495
476 Ga0307509_10187672 3300031507 Unclassified 1923
477 Ga0307408_100628012 3300031548 Bacteria 958
478 Ga0307508_10086519 3300031616 Bacteria 2718
479 Ga0265314_10004269 3300031711 Bacteria 13374
480 Ga0307405_10013991 3300031731 Bacteria 4300
481 Ga0307405_10933162 3300031731 Bacteria 736
482 Ga0307413_10001086 3300031824 Bacteria 9945
483 Ga0307413_10057172 3300031824 Bacteria 2384
484 Ga0307413_10716413 3300031824 Unclassified 833
485 Ga0307410_10002061 3300031852 Bacteria 9505
486 Ga0307410_10019693 3300031852 Bacteria 4110
487 Ga0307410_10410024 3300031852 Unclassified 1097
488 Ga0307406_10007668 3300031901 Bacteria 5993
489 Ga0307406_10115873 3300031901 Unclassified 1853
490 Ga0307407_10006611 3300031903 Bacteria 5175
491 Ga0307407_10042563 3300031903 Bacteria 2547
492 Ga0307412_10308486 3300031911 Bacteria 1254
493 Ga0307409_100001337 3300031995 Bacteria 11970
494 Ga0307409_100004119 3300031995 Bacteria 8092
495 Ga0307409_100060302 3300031995 Bacteria 2958
496 Ga0307409_100143372 3300031995 Unclassified 2062
497 Ga0307409_100786994 3300031995 Bacteria 958
498 Ga0307416_100023053 3300032002 Bacteria 4509
499 Ga0307416_100066612 3300032002 Bacteria 2966
500 Ga0307416_100289064 3300032002 Bacteria 1622
501 Ga0307416_100357720 3300032002 Bacteria 1481
502 Ga0307416_100444003 3300032002 Unclassified 1348
503 Ga0307416_101423672 3300032002 Bacteria 799
504 Ga0307414_10476313 3300032004 Bacteria 1100
505 Ga0307411_10010770 3300032005 Bacteria 4894
506 Ga0307411_10424430 3300032005 Bacteria 1105
507 Ga0307411_10425612 3300032005 Bacteria 1104
508 Ga0307415_100061208 3300032126 Bacteria 2606
509 Ga0307415_100447169 3300032126 Bacteria 1116
510 Ga0307415_101035255 3300032126 Unclassified 765
511 Ga0307507_10406119 3300033179 Bacteria 772
512 Ga0373923_0093992 3300035111 Bacteria 1315
513 Ga0373936_0006237 3300035113 Bacteria 4496
514 Ga0373936_0062367 3300035113 Bacteria 1524
515 Ga0373943_0324406 3300035170 Unclassified 878
516 Ga0373955_0096670 3300035172 Bacteria 1690
517 Ga0373947_0515030 3300035725 Bacteria 813
518 Ga0373937_0222652 3300036401 Bacteria 1776
519 Ga0373925_0086231 3300037068 Bacteria 2395
520 Ga0436365_0998031 3300039437 Bacteria 3013
521 Ga0436360_1348721 3300039438 Bacteria 3177
522 Ga0436361_0231913 3300039447 Bacteria 3084
523 Ga0451797_1033462 3300041453 Unclassified 1284
524 Ga0451798_0663163 3300041458 Unclassified 676
525 Ga0451802_1173710 3300041460 Bacteria 1756
526 Ga0451807_0495054 3300041486 Unclassified 1185
527 Ga0451807_1553736 3300041486 Unclassified 1550
528 Ga0451807_1953677 3300041486 Unclassified 1840
529 Ga0451807_2554491 3300041486 Bacteria 1417
530 Ga0451837_0006436 3300041494 Bacteria 2638
531 Ga0451853_1034299 3300041512 Bacteria 850
532 Ga0451853_3059631 3300041512 Bacteria 828
533 Ga0451853_3463131 3300041512 Bacteria 589
534 Ga0466969_0001000 3300044656 Bacteria 15292
535 Ga0466969_0001108 3300044656 Bacteria 14512
536 Ga0466969_0064266 3300044656 Bacteria 1777
537 Ga0466972_0083824 3300044658 Bacteria 1516
538 Ga0466966_0000290 3300044684 Bacteria 32882
539 Ga0466966_0058538 3300044684 Unclassified 2435
540 Ga0466961_0000303 3300044693 Bacteria 32634
541 Ga0466963_0513703 3300044694 Unclassified 846
542 Ga0466964_0000201 3300044706 Bacteria 16769
543 Ga0466971_0000994 3300044719 Bacteria 11694
544 Ga0466970_0009626 3300044765 Bacteria 4888
545 Ga0466957_0018341 3300044842 Bacteria 4109
546 Ga0466960_0112511 3300044901 Bacteria 1416
547 Ga0466960_0416851 3300044901 Bacteria 776
548 Ga0466959_0000647 3300045049 Bacteria 20303
549 Ga0466959_0214571 3300045049 Bacteria 1336
550 Ga0451576_1539598 3300045051 Unclassified 690
551 Ga0495603_0399170 3300046455 Bacteria 788
552 Ga0495580_0060263 3300046472 Bacteria 2666
553 Ga0495606_0295098 3300046507 Bacteria 880
554 Ga0495620_0051228 3300046515 Unclassified 1758
555 Ga0495630_0505949 3300046517 Bacteria 926
556 Ga0495632_0122079 3300046519 Bacteria 1217
557 Ga0495625_0005175 3300046660 Bacteria 12033
558 Ga0495625_0087125 3300046660 Bacteria 2165
559 Ga0495613_0236960 3300046689 Bacteria 1277
560 Ga0495671_0284414 3300046692 Unclassified 796
561 Ga0495649_0002702 3300046694 Bacteria 12358
562 Ga0495674_0328861 3300047319 Bacteria 1244
563 Ga0495686_0134424 3300047472 Bacteria 1464
564 Ga0496100_0070659 3300048903 Bacteria 2328
565 Ga0496100_0542829 3300048903 Bacteria 899
566 Ga0496100_0697693 3300048903 Unclassified 792
567 Ga0496101_0013920 3300048904 Bacteria 5401
568 Ga0496101_1373953 3300048904 Unclassified 551
569 Ga0496102_0013271 3300048905 Bacteria 7133
570 Ga0496102_0088522 3300048905 Bacteria 2863
571 Ga0496102_0469530 3300048905 Unclassified 1179
572 Ga0496102_0893099 3300048905 Bacteria 810
573 Ga0496103_0112873 3300048906 Bacteria 1727
574 Ga0496103_0123115 3300048906 Bacteria 1653
575 Ga0496104_0012725 3300048907 Bacteria 7578
576 Ga0496104_0352454 3300048907 Bacteria 1384
577 Ga0496104_0480739 3300048907 Bacteria 1153
578 Ga0496105_0045145 3300048908 Bacteria 3635
579 Ga0496105_0254652 3300048908 Unclassified 1421
580 Ga0496106_0004191 3300048909 Bacteria 10749
581 Ga0496106_0071579 3300048909 Bacteria 2651
582 Ga0496107_0007814 3300048910 Bacteria 7384
583 Ga0496108_0004781 3300048911 Bacteria 10922
584 Ga0496108_0041027 3300048911 Bacteria 3861
585 Ga0496108_0286602 3300048911 Bacteria 1434
586 Ga0496109_0006535 3300048912 Bacteria 9815
587 Ga0496109_0015581 3300048912 Bacteria 6629
588 Ga0496109_0055191 3300048912 Bacteria 3624
589 Ga0496109_1336445 3300048912 Unclassified 653
590 Ga0496110_0000370 3300048913 Bacteria 30072
591 Ga0496110_0029335 3300048913 Bacteria 4733
592 Ga0496111_0003168 3300048914 Bacteria 10133
593 Ga0496111_0016386 3300048914 Bacteria 5104
594 Ga0496112_0133947 3300048915 Bacteria 2448
595 Ga0496112_0135272 3300048915 Bacteria 2435
596 Ga0496112_0298757 3300048915 Unclassified 1556
597 Ga0496113_0129006 3300048916 Bacteria 1983
598 Ga0496113_1036066 3300048916 Unclassified 645
599 Ga0496114_0001143 3300048917 Bacteria 20053
600 Ga0496114_0011750 3300048917 Bacteria 7004
601 Ga0496115_0035595 3300048918 Bacteria 3939
602 Ga0496115_0213972 3300048918 Bacteria 1592
603 Ga0496117_0000244 3300048920 Bacteria 102831
604 Ga0496118_0000040 3300048921 Bacteria 304516
605 Ga0496118_0315316 3300048921 Unclassified 851
606 Ga0496119_0015668 3300048922 Bacteria 5815
607 Ga0496120_0018628 3300048923 Bacteria 4467
608 Ga0496121_0001468 3300048924 Bacteria 39712
609 Ga0496121_0174041 3300048924 Bacteria 1560
610 Ga0496125_0000762 3300048928 Bacteria 52740
611 Ga0496126_0176455 3300048929 Bacteria 1817
612 Ga0501036_1103638 3300049572 Bacteria 648
613 Ga0501040_0640404 3300049576 Bacteria 768
614 Ga0501042_0154036 3300049578 Bacteria 1658
615 Ga0501067_0023226 3300049583 Bacteria 3436
616 Ga0501068_0001783 3300049584 Bacteria 11454
617 Ga0501068_0389381 3300049584 Bacteria 898
618 Ga0501068_0570395 3300049584 Bacteria 736
619 Ga0501069_0085536 3300049585 Bacteria 1779
620 Ga0501070_0008054 3300049586 Bacteria 8919
621 Ga0501071_0032515 3300049587 Bacteria 3704
622 Ga0501073_0000224 3300049589 Bacteria 37189
623 Ga0501073_0065718 3300049589 Bacteria 2529
624 Ga0501074_0000694 3300049590 Bacteria 21079
625 Ga0501074_0004025 3300049590 Bacteria 10483
626 Ga0501076_0151422 3300049592 Bacteria 1887
627 Ga0501077_0002293 3300049593 Bacteria 11523
628 Ga0501077_0151090 3300049593 Unclassified 1474
629 Ga0501079_0001864 3300049741 Bacteria 15120
630 Ga0501079_0441923 3300049741 Bacteria 1021
631 Ga0501080_0000347 3300049742 Bacteria 35499
632 Ga0501080_0014041 3300049742 Bacteria 7372
633 Ga0501080_0090620 3300049742 Bacteria 2840
634 Ga0501080_0833759 3300049742 Bacteria 807
635 Ga0501083_0136762 3300049744 Unclassified 1605
636 Ga0501083_0290880 3300049744 Bacteria 1063
637 Ga0501035_0001879 3300049822 Bacteria 21138
638 Ga0501035_0271375 3300049822 Bacteria 1436
639 Ga0501044_0017214 3300049823 Bacteria 7752
640 nmdc:mga08y16_53905_c1 3300050511 Bacteria 4203
641 nmdc:mga0rr50_47090_c1 3300050513 Bacteria 3178
642 nmdc:mga08x19_26912_c1 3300050514 Bacteria 3593
643 Ga0495612_0124461 3300053078 Bacteria 1111
644 Ga0500578_0273831 3300053086 Unclassified 1009
645 Ga0500583_0003542 3300053092 Bacteria 4932
646 Ga0500648_225319 3300053097 Bacteria 913
647 Ga0500617_007742 3300053124 Bacteria 4298
648 Ga0500642_0201785 3300053130 Bacteria 925
649 Ga0500658_0054272 3300053134 Bacteria 1646
650 Ga0500559_0248746 3300053136 Unclassified 838
651 Ga0500568_0279246 3300053139 Unclassified 607
652 Ga0500588_0000580 3300053146 Bacteria 5988
653 Ga0500590_054704 3300053148 Bacteria 2021
654 Ga0500627_0291086 3300053158 Bacteria 715
655 Ga0500630_048990 3300053159 Bacteria 2045
656 Ga0500639_106604 3300053163 Bacteria 1370
657 Ga0500637_0002941 3300053178 Bacteria 7710
658 Ga0500656_003854 3300053732 Bacteria 1422
659 Ga0501084_0004524 3300054114 Bacteria 11372
660 Ga0501082_0075028 3300060353 Bacteria 2913
661 Ga0466962_0000251 3300061719 Bacteria 22568
662 Ga0070710_10292215
663 JGI25406J46586_10008769
664 rootH1_10088353
665 Ga0070658_10574648
666 Ga0070676_10043460
667 Ga0070683_100028577
668 Ga0070683_100370560
669 Ga0070683_101057867
670 Ga0070690_100001614
671 Ga0070690_100020619
672 Ga0070690_100041812
673 Ga0070690_100126102
674 Ga0070690_100185303
675 Ga0070670_100006939
676 Ga0070670_100031066
677 Ga0070677_10002958
678 Ga0070677_10004245
679 Ga0070677_10353554
680 Ga0068869_100099047
681 Ga0068869_100137454
682 Ga0068869_100163942
683 Ga0068869_100385910
684 Ga0070666_10005143
685 Ga0070666_10010135
686 Ga0070666_10185480
687 Ga0070680_100553026
688 Ga0070682_100048983
689 Ga0070682_100176752
690 Ga0070682_100492964
691 Ga0070682_101001128
692 Ga0068868_100005051
693 Ga0068868_100013968
694 Ga0068868_100155215
695 Ga0068868_100713868
696 Ga0070660_100661674
697 Ga0070689_100004511
698 Ga0070689_100161320
699 Ga0070691_10132258
700 Ga0070661_100046757
701 Ga0070661_100087663
702 Ga0070692_10965552
703 Ga0070668_100039564
704 Ga0070668_100624342
705 Ga0070675_100039378
706 Ga0070675_100344483
707 Ga0070675_100975375
708 Ga0070671_100003974
709 Ga0070671_100007227
710 Ga0070671_100021177
711 Ga0070671_100054883
712 Ga0070671_100171920
713 Ga0070674_100084166
714 Ga0070673_100074381
715 Ga0070673_100079485
716 Ga0070673_100130619
717 Ga0070673_100314770
718 Ga0070673_100437431
719 Ga0070688_101060287
720 Ga0070659_100339322
721 Ga0070667_100002544
722 Ga0070667_100008032
723 Ga0070667_100015547
724 Ga0070667_100032604
725 Ga0070667_100064141
726 Ga0070667_101100939
727 Ga0070709_10351243
728 Ga0070714_100002141
729 Ga0070713_100008144
730 Ga0070713_100009169
731 Ga0070710_10010681
732 Ga0070710_10715679
733 Ga0070701_10005019
734 Ga0070701_10102588
735 Ga0070711_100005169
736 Ga0070711_100088340
737 Ga0070711_100267082
738 Ga0070711_100858523
739 Ga0070705_100359756
740 Ga0070705_100518577
741 Ga0070700_100085478
742 Ga0070700_100798301
743 Ga0070694_100504564
744 Ga0070708_100451942
745 Ga0070663_100055784
746 Ga0070678_100079626
747 Ga0070678_100089397
748 Ga0070678_100100928
749 Ga0070678_100333581
750 Ga0070662_100900961
751 Ga0070662_101240954
752 Ga0070681_10001176
753 Ga0070681_10012210
754 Ga0070681_10047638
755 Ga0070681_10077970
756 Ga0070681_10094803
757 Ga0068867_100067446
758 Ga0068867_100430478
759 Ga0068867_100987185
760 Ga0070685_10069525
761 Ga0070685_10069917
762 Ga0070685_10091728
763 Ga0070699_100067668
764 Ga0070679_100001010
765 Ga0070679_100005943
766 Ga0070679_100882879
767 Ga0070684_100032852
768 Ga0070684_100284542
769 Ga0068853_100034603
770 Ga0068853_100180456
771 Ga0068853_100520152
772 Ga0070672_100112020
773 Ga0070672_100113016
774 Ga0070672_100134881
775 Ga0070686_100013559
776 Ga0070686_100067431
777 Ga0070686_100079703
778 Ga0070686_100151305
779 Ga0070686_100238064
780 Ga0070695_100004839
781 Ga0070695_100249603
782 Ga0070696_100915476
783 Ga0070693_100107505
784 Ga0070693_100141428
785 Ga0070665_100007631
786 Ga0070665_100009143
787 Ga0070665_100023628
788 Ga0070665_100030505
789 Ga0070665_100416582
790 Ga0070665_100541953
791 Ga0070665_100545180
792 Ga0070704_100102781
793 Ga0068855_100008493
794 Ga0068855_100142023
795 Ga0068855_100701954
796 Ga0070664_100015964
797 Ga0070664_100062395
798 Ga0070664_100062655
799 Ga0070664_100175016
800 Ga0068857_100537669
801 Ga0068856_100043679
802 Ga0068856_100233844
803 Ga0068856_101824701
804 Ga0070702_100007152
805 Ga0070702_100263943
806 Ga0068852_100172559
807 Ga0068852_100435273
808 Ga0068852_100851892
809 Ga0068859_100000879
810 Ga0068859_100045177
811 Ga0068859_100123865
812 Ga0068859_100206466
813 Ga0068859_100472767
814 Ga0068864_100130231
815 Ga0068864_100180701
816 Ga0068864_100324967
817 Ga0068864_100364374
818 Ga0068861_100001242
819 Ga0068861_100010021
820 Ga0068861_100057361
821 Ga0068861_100148328
822 Ga0068861_100173695
823 Ga0068851_10128145
824 Ga0068870_10073584
825 Ga0068870_10120681
826 Ga0068863_100001233
827 Ga0068863_100012651
828 Ga0068863_100030107
829 Ga0068863_100043810
830 Ga0068863_100233638
831 Ga0068863_100278989
832 Ga0068863_100478627
833 Ga0068858_100000605
834 Ga0068858_100001895
835 Ga0068858_100010305
836 Ga0068858_100028741
837 Ga0068858_100066894
838 Ga0068858_100652409
839 Ga0068858_100827801
840 Ga0068858_101229038
841 Ga0068860_100001307
842 Ga0068860_100001577
843 Ga0068860_100002811
844 Ga0068860_100241035
845 Ga0068860_100307017
846 Ga0068862_100008641
847 Ga0068862_100038703
848 Ga0068862_100078432
849 Ga0068862_100190704
850 Ga0068862_100433263
851 Ga0068862_100599153
852 Ga0068862_100671749
853 Ga0068862_100873500
854 Ga0068862_101114250
855 Ga0081455_10000043
856 Ga0081455_10007291
857 Ga0081455_10360746
858 Ga0081539_10000046
859 Ga0070717_10102651
860 Ga0070716_100956556
861 Ga0097621_100024912
862 Ga0097621_100033908
863 Ga0097621_100219591
864 Ga0068871_100043292
865 Ga0068871_100060607
866 Ga0068871_100187801
867 Ga0068871_100337733
868 Ga0068871_100739426
869 Ga0075428_101037933
870 Ga0075430_100277379
871 Ga0075434_100562950
872 Ga0068865_100076595
873 Ga0068865_100124262
874 Ga0068865_100550295
875 Ga0068865_101181913
876 Ga0075436_100057998
877 Ga0097620_100000879
878 Ga0097620_100045177
879 Ga0097620_100123865
880 Ga0097620_100206464
881 Ga0097620_100472830
882 Ga0075435_100098704
883 Ga0099795_10000008
884 Ga0105240_10012231
885 Ga0105240_10095963
886 Ga0105240_10107060
887 Ga0111539_10073103
888 Ga0111539_10331041
889 Ga0105245_10029791
890 Ga0105247_10000651
891 Ga0105247_10015776
892 Ga0105247_10097833
893 Ga0105247_10177938
894 Ga0105247_10181145
895 Ga0105242_10445280
896 Ga0105242_10699821
897 Ga0105248_10003980
898 Ga0105248_10039842
899 Ga0105248_10356108
900 Ga0105248_11018404
901 Ga0105238_10023366
902 Ga0105238_10030389
903 Ga0105238_10058078
904 Ga0105238_10132036
905 Ga0105238_10441241
906 Ga0105238_11721950
907 Ga0105249_10004536
908 Ga0105249_10097848
909 Ga0105249_11084446
910 Ga0105249_11463634
911 Ga0099796_10000012
912 Ga0105239_10057030
913 Ga0105246_10052936
914 Ga0105246_10103665
915 Ga0105246_11306666
916 Ga0157370_10015294
917 Ga0157370_10020326
918 Ga0157369_10085823
919 Ga0157369_11687829
920 Ga0157374_10004416
921 Ga0157374_10620849
922 Ga0157374_11404540
923 Ga0157378_10005593
924 Ga0157378_10346334
925 Ga0163162_10180909
926 Ga0163162_10412221
927 Ga0163162_12246751
928 Ga0157372_10174890
929 Ga0157372_10218838
930 Ga0157372_10392409
931 Ga0157375_10008012
932 Ga0157375_10009837
933 Ga0157375_10057503
934 Ga0157375_10905616
935 Ga0163163_10053164
936 Ga0163163_10086101
937 Ga0163163_10621096
938 Ga0163163_10785124
939 Ga0157380_10139282
940 Ga0157380_10200215
941 Ga0157380_10278720
942 Ga0157380_11423289
943 Ga0157380_11546247
944 Ga0157379_10000348
945 Ga0157379_10002955
946 Ga0157379_10066371
947 Ga0157379_10857967
948 Ga0157376_10115198
949 Ga0157376_10127047
950 Ga0157376_10260482
951 Ga0163161_10102888
952 Ga0163161_10193335
953 Ga0206356_10952632
954 Ga0206353_11203996
955 Ga0206353_11760363
956 Ga0224712_10044193
957 Ga0207697_10220881
958 Ga0207656_10107608
959 Ga0207682_10004514
960 Ga0207682_10006063
961 Ga0207692_10577109
962 Ga0207710_10000406
963 Ga0207710_10007467
964 Ga0207710_10058566
965 Ga0207710_10320267
966 Ga0207688_10199541
967 Ga0207680_10049244
968 Ga0207680_10064696
969 Ga0207680_10098072
970 Ga0207680_10300314
971 Ga0207699_10006286
972 Ga0207699_10170452
973 Ga0207645_10025797
974 Ga0207645_10447630
975 Ga0207643_10006068
976 Ga0207643_10041771
977 Ga0207705_10091923
978 Ga0207654_10336707
979 Ga0207707_10000560
980 Ga0207707_10032037
981 Ga0207707_10066171
982 Ga0207707_10367781
983 Ga0207695_10062893
984 Ga0207695_10086064
985 Ga0207695_10097864
986 Ga0207695_10103797
987 Ga0207695_10555075
988 Ga0207671_10203754
989 Ga0207693_10076336
990 Ga0207663_10158950
991 Ga0207660_10007312
992 Ga0207660_10078638
993 Ga0207660_10631456
994 Ga0207662_10559502
995 Ga0207649_10678572
996 Ga0207652_10002183
997 Ga0207652_10010272
998 Ga0207681_10675559
999 Ga0207694_10012034
1000 Ga0207694_10250763
1001 Ga0207694_10313954
1002 Ga0207650_10147494
1003 Ga0207650_10276918
1004 Ga0207650_10357615
1005 Ga0207659_10012808
1006 Ga0207659_10563518
1007 Ga0207700_10081881
1008 Ga0207664_10001080
1009 Ga0207664_10076015
1010 Ga0207664_10941413
1011 Ga0207644_10000879
1012 Ga0207644_10011559
1013 Ga0207644_10031692
1014 Ga0207644_10440289
1015 Ga0207706_10081899
1016 Ga0207686_10320621
1017 Ga0207670_10008818
1018 Ga0207670_10055070
1019 Ga0207669_10058178
1020 Ga0207669_10545928
1021 Ga0207704_10169276
1022 Ga0207704_10247730
1023 Ga0207704_10582666
1024 Ga0207665_10478642
1025 Ga0207665_10661696
1026 Ga0207665_10741665
1027 Ga0207691_10001665
1028 Ga0207691_10095148
1029 Ga0207711_10003094
1030 Ga0207711_10006632
1031 Ga0207711_10083379
1032 Ga0207711_10537416
1033 Ga0207689_10122256
1034 Ga0207689_10153088
1035 Ga0207689_10179557
1036 Ga0207689_10269014
1037 Ga0207661_10161958
1038 Ga0207661_10603129
1039 Ga0207679_10013897
1040 Ga0207667_10003234
1041 Ga0207667_10076253
1042 Ga0207667_10148672
1043 Ga0207651_10064499
1044 Ga0207651_10241899
1045 Ga0207651_10285603
1046 Ga0207712_10122545
1047 Ga0207712_10198555
1048 Ga0207712_11104804
1049 Ga0207668_10145746
1050 Ga0207640_10624439
1051 Ga0207658_10004147
1052 Ga0207658_10028540
1053 Ga0207677_10108643
1054 Ga0207703_10001200
1055 Ga0207703_10001262
1056 Ga0207703_10002873
1057 Ga0207703_10008398
1058 Ga0207703_10494510
1059 Ga0207703_10537494
1060 Ga0207678_10033147
1061 Ga0207708_10016278
1062 Ga0207708_10043182
1063 Ga0207708_10120875
1064 Ga0207708_10619854
1065 Ga0207702_10123759
1066 Ga0207702_10187861
1067 Ga0207702_10300895
1068 Ga0207641_10000078
1069 Ga0207641_10005562
1070 Ga0207641_10211633
1071 Ga0207641_10511323
1072 Ga0207648_10084766
1073 Ga0207648_10249907
1074 Ga0207648_10442590
1075 Ga0207648_10697771
1076 Ga0207676_10012429
1077 Ga0207676_10103636
1078 Ga0207676_10105548
1079 Ga0207676_10177832
1080 Ga0207676_11171564
1081 Ga0207674_10111979
1082 Ga0207674_10241635
1083 Ga0207675_100002767
1084 Ga0207675_100020534
1085 Ga0207675_100067064
1086 Ga0207675_100164554
1087 Ga0207675_100360574
1088 Ga0207675_100362704
1089 Ga0207683_10148672
1090 Ga0207683_10587783
1091 Ga0207683_10610383
1092 Ga0207698_10609802
1093 Ga0207698_11297157
1094 Ga0209179_1000100
1095 Ga0207428_10117791
1096 Ga0268266_10000944
1097 Ga0268266_10015999
1098 Ga0268266_10069795
1099 Ga0268266_10157403
1100 Ga0268266_10375174
1101 Ga0268265_10174573
1102 Ga0268265_10272116
1103 Ga0268265_10283890
1104 Ga0268265_10391542
1105 Ga0268264_10000142
1106 Ga0268264_10008822
1107 Ga0268264_10035194
1108 Ga0268264_10044472
1109 Ga0268264_10508242
1110 Ga0268264_10759999
1111 Ga0268264_11066497
1112 Ga0268264_11166227
1113 Ga0268264_11260017
1114 Ga0265326_10007430
1115 Ga0265319_1006109
1116 Ga0265319_1180751
1117 Ga0265334_10061945
1118 Ga0265318_10002137
1119 Ga0265338_10006299
1120 Ga0265338_10016734
1121 Ga0265330_10007473
1122 Ga0265332_10000488
1123 Ga0265328_10099728
1124 Ga0265325_10112596
1125 Ga0265329_10017356
1126 Ga0265340_10005679
1127 Ga0265340_10060456
1128 Ga0265340_10113730
1129 Ga0265339_10018302
1130 Ga0265331_10002686
1131 Ga0265331_10062288
1132 Ga0265316_10010876
1133 Ga0307513_10016612
1134 Ga0307513_10035795
1135 Ga0307513_10086529
1136 Ga0307513_10127602
1137 Ga0307509_10187672
1138 Ga0307408_100628012
1139 Ga0307508_10086519
1140 Ga0265314_10004269
1141 Ga0307405_10013991
1142 Ga0307405_10933162
1143 Ga0307413_10001086
1144 Ga0307413_10057172
1145 Ga0307413_10716413
1146 Ga0307410_10002061
1147 Ga0307410_10019693
1148 Ga0307410_10410024
1149 Ga0307406_10007668
1150 Ga0307406_10115873
1151 Ga0307407_10006611
1152 Ga0307407_10042563
1153 Ga0307412_10308486
1154 Ga0307409_100001337
1155 Ga0307409_100004119
1156 Ga0307409_100060302
1157 Ga0307409_100143372
1158 Ga0307409_100786994
1159 Ga0307416_100023053
1160 Ga0307416_100066612
1161 Ga0307416_100289064
1162 Ga0307416_100357720
1163 Ga0307416_100444003
1164 Ga0307416_101423672
1165 Ga0307414_10476313
1166 Ga0307411_10010770
1167 Ga0307411_10424430
1168 Ga0307411_10425612
1169 Ga0307415_100061208
1170 Ga0307415_100447169
1171 Ga0307415_101035255
1172 Ga0307507_10406119
1173 Ga0373923_0093992
1174 Ga0373936_0006237
1175 Ga0373936_0062367
1176 Ga0373943_0324406
1177 Ga0373955_0096670
1178 Ga0373947_0515030
1179 Ga0373937_0222652
1180 Ga0373925_0086231
1181 Ga0436365_0998031
1182 Ga0436360_1348721
1183 Ga0436361_0231913
1184 Ga0451797_1033462
1185 Ga0451798_0663163
1186 Ga0451802_1173710
1187 Ga0451807_0495054
1188 Ga0451807_1553736
1189 Ga0451807_1953677
1190 Ga0451807_2554491
1191 Ga0451837_0006436
1192 Ga0451853_1034299
1193 Ga0451853_3059631
1194 Ga0451853_3463131
1195 Ga0466969_0001000
1196 Ga0466969_0001108
1197 Ga0466969_0064266
1198 Ga0466972_0083824
1199 Ga0466966_0000290
1200 Ga0466966_0058538
1201 Ga0466961_0000303
1202 Ga0466963_0513703
1203 Ga0466964_0000201
1204 Ga0466971_0000994
1205 Ga0466970_0009626
1206 Ga0466957_0018341
1207 Ga0466960_0112511
1208 Ga0466960_0416851
1209 Ga0466959_0000647
1210 Ga0466959_0214571
1211 Ga0451576_1539598
1212 Ga0495603_0399170
1213 Ga0495580_0060263
1214 Ga0495606_0295098
1215 Ga0495620_0051228
1216 Ga0495630_0505949
1217 Ga0495632_0122079
1218 Ga0495625_0005175
1219 Ga0495625_0087125
1220 Ga0495613_0236960
1221 Ga0495671_0284414
1222 Ga0495649_0002702
1223 Ga0495674_0328861
1224 Ga0495686_0134424
1225 Ga0496100_0070659
1226 Ga0496100_0542829
1227 Ga0496100_0697693
1228 Ga0496101_0013920
1229 Ga0496101_1373953
1230 Ga0496102_0013271
1231 Ga0496102_0088522
1232 Ga0496102_0469530
1233 Ga0496102_0893099
1234 Ga0496103_0112873
1235 Ga0496103_0123115
1236 Ga0496104_0012725
1237 Ga0496104_0352454
1238 Ga0496104_0480739
1239 Ga0496105_0045145
1240 Ga0496105_0254652
1241 Ga0496106_0004191
1242 Ga0496106_0071579
1243 Ga0496107_0007814
1244 Ga0496108_0004781
1245 Ga0496108_0041027
1246 Ga0496108_0286602
1247 Ga0496109_0006535
1248 Ga0496109_0015581
1249 Ga0496109_0055191
1250 Ga0496109_1336445
1251 Ga0496110_0000370
1252 Ga0496110_0029335
1253 Ga0496111_0003168
1254 Ga0496111_0016386
1255 Ga0496112_0133947
1256 Ga0496112_0135272
1257 Ga0496112_0298757
1258 Ga0496113_0129006
1259 Ga0496113_1036066
1260 Ga0496114_0001143
1261 Ga0496114_0011750
1262 Ga0496115_0035595
1263 Ga0496115_0213972
1264 Ga0496117_0000244
1265 Ga0496118_0000040
1266 Ga0496118_0315316
1267 Ga0496119_0015668
1268 Ga0496120_0018628
1269 Ga0496121_0001468
1270 Ga0496121_0174041
1271 Ga0496125_0000762
1272 Ga0496126_0176455
1273 Ga0501036_1103638
1274 Ga0501040_0640404
1275 Ga0501042_0154036
1276 Ga0501067_0023226
1277 Ga0501068_0001783
1278 Ga0501068_0389381
1279 Ga0501068_0570395
1280 Ga0501069_0085536
1281 Ga0501070_0008054
1282 Ga0501071_0032515
1283 Ga0501073_0000224
1284 Ga0501073_0065718
1285 Ga0501074_0000694
1286 Ga0501074_0004025
1287 Ga0501076_0151422
1288 Ga0501077_0002293
1289 Ga0501077_0151090
1290 Ga0501079_0001864
1291 Ga0501079_0441923
1292 Ga0501080_0000347
1293 Ga0501080_0014041
1294 Ga0501080_0090620
1295 Ga0501080_0833759
1296 Ga0501083_0136762
1297 Ga0501083_0290880
1298 Ga0501035_0001879
1299 Ga0501035_0271375
1300 Ga0501044_0017214
1301 nmdc:mga08y16_53905_c1
1302 nmdc:mga0rr50_47090_c1
1303 nmdc:mga08x19_26912_c1
1304 Ga0495612_0124461
1305 Ga0500578_0273831
1306 Ga0500583_0003542
1307 Ga0500648_225319
1308 Ga0500617_007742
1309 Ga0500642_0201785
1310 Ga0500658_0054272
1311 Ga0500559_0248746
1312 Ga0500568_0279246
1313 Ga0500588_0000580
1314 Ga0500590_054704
1315 Ga0500627_0291086
1316 Ga0500630_048990
1317 Ga0500639_106604
1318 Ga0500637_0002941
1319 Ga0500656_003854
1320 Ga0501084_0004524
1321 Ga0501082_0075028
1322 Ga0466962_0000251

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02470

MlaD

MlaD protein

41

120

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5uw8-assembly1.cif.gz_D structure of e. coli mce protein mlad, core mce domain 0.9187 42 138
5uw8-assembly1.cif.gz_G structure of e. coli mce protein mlad, core mce domain 0.9095 38 138
5uw2-assembly1.cif.gz_B structure of e. coli mce protein mlad, periplasmic domain 0.9086 42 149
5uw2-assembly1.cif.gz_A-2 structure of e. coli mce protein mlad, periplasmic domain 0.9038 41 149
5uw8-assembly1.cif.gz_C structure of e. coli mce protein mlad, core mce domain 0.8908 42 138
ID Description Score Start End Superfamily
af_O53971_37_112_2.40.30.170 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Efflux pump adaptor protein, beta barrel domain 0.9181 43 120 2.40.30.170
af_P64604_38_117_2.30.30.60 Mainly Beta;Roll;SH3 type barrels.; 0.9171 41 120 2.30.30.60
af_O53969_38_114_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9119 41 120 2.40.50.140
af_I6XHD6_38_114_2.30.30.60 Mainly Beta;Roll;SH3 type barrels.; 0.9107 41 120 2.30.30.60
af_O07784_38_114_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9086 41 117 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A656YNT4-F1-model_v4 deleted 0.9167 47 155
AF-M3TRK6-F1-model_v4 Mce, putative 0.9103 36 155 GO:0005543
GO:0005548
AF-A0A7V4WFZ1-F1-model_v4 Outer membrane lipid asymmetry maintenance protein MlaD 0.9103 46 158 GO:0005543
GO:0005548
AF-A0A258QLI2-F1-model_v4 Outer membrane lipid asymmetry maintenance protein MlaD 0.904 37 155 GO:0005543
GO:0005548
AF-A0A7V4WFZ1-F1-model_v4 Outer membrane lipid asymmetry maintenance protein MlaD 0.8956 46 158 GO:0005543
GO:0005548

Map