F473322

General Info

Members Datasets Scaffolds Average Seq Length
660 344 658 245

Family's Representative Sequence

Representative Sequence 3300006028|Ga0070717_10067295|Ga0070717_100672952
Length 275
Sequence VTQVAAAPAPSSLDVDVVVAESIHKTYRVSRPPREVLRGVSLRVHDGEFVALMGPSGCGKSTLLHILGGLEPADAGTVRIRDTDVYALDDERRSRFRRDHIGFVFQSFNLLPTLTAAENVALPLRLRNSSRLRVRDRISRRAVQDRVAALMDQLNLRGLQGHGPDEISGGEQQRVAIARALAAAPSLLLADEPTGNLDWTTGHDVMNLLARLCRSEHQTTILVTHDARVAAYADRVLVMRDGEIVDSVELARDQAAAGAFPDPAPLIARLSKLEL

Samples

Sample ID Description Type Environment
1 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
2 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
7 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
8 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
9 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
10 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
102 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
103 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
107 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
109 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
110 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
112 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
163 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
164 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
165 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
166 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
167 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
168 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
169 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
170 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
171 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
172 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
173 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
174 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
175 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
176 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
177 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
178 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
179 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
180 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
181 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
182 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
183 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
184 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
185 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
186 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
187 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
188 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
189 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
190 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
191 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
192 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
193 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
194 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
195 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
196 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
197 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
198 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
199 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
200 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
201 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
202 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
203 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
204 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
205 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
206 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
207 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
208 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
209 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
210 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
211 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
212 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
213 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
214 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
215 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
216 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
217 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
218 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
219 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
220 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
221 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
222 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
223 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
224 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
225 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
226 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
227 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
228 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
229 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
230 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
231 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
232 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
233 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
234 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
235 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
236 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
237 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
238 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
239 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
240 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
241 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
242 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
243 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
244 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
245 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
246 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
247 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
248 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
249 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
250 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
251 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
252 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
253 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
254 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
255 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
256 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
257 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
258 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
259 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
260 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
261 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
262 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
263 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
264 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
265 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
266 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
267 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
268 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
269 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
270 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
271 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
272 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
273 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
274 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
275 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
276 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
277 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
278 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
279 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
280 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
281 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
282 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
283 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
284 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
285 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
286 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
287 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
288 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
289 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
290 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
291 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
292 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
293 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
294 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
295 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
296 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
297 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
298 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
299 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
300 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
301 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
302 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
303 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
304 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
305 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
306 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
307 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
308 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
309 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
310 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
311 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
312 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
315 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
316 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
317 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
318 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
319 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
320 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
321 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
322 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
323 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
324 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
325 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
326 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
327 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
328 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
329 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
330 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
331 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
332 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
333 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
334 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
335 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
336 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
337 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
338 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
339 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
340 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
341 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
342 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
343 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
344 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.64
Metatranscriptomes 1.06
Isolates 0.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.03
Nodule 0.15
Rhizoplane 1.97
Rhizosphere 90.45
Stem 0
Stem Tuber 0
Unclassified 4.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1000612 3300002705 Bacteria 19787
2 JGI25154J39366_1001968 3300002738 Bacteria 6045
3 JGI25157J39369_1000312 3300002741 Bacteria 35057
4 Ga0055539_1000392 3300003752 Bacteria 17667
5 Ga0055539_1006949 3300003752 Bacteria 1439
6 Ga0055533_1000024 3300003756 Bacteria 338067
7 Ga0055525_1001464 3300003759 Bacteria 4191
8 Ga0055535_1000156 3300003761 Bacteria 72919
9 Ga0055529_1000382 3300003763 Bacteria 48005
10 Ga0070658_10055978 3300005327 Bacteria 3205
11 Ga0070658_10107053 3300005327 Bacteria 2313
12 Ga0070683_100022020 3300005329 Bacteria 5690
13 Ga0070690_100029883 3300005330 Bacteria 3384
14 Ga0070690_100151133 3300005330 Bacteria 1584
15 Ga0068869_100034845 3300005334 Bacteria 3564
16 Ga0068869_100245611 3300005334 Bacteria 1427
17 Ga0070666_10018555 3300005335 Bacteria 4476
18 Ga0070680_100032072 3300005336 Bacteria 4226
19 Ga0070680_100161957 3300005336 Bacteria 1880
20 Ga0070682_100097036 3300005337 Bacteria 1939
21 Ga0070660_100087903 3300005339 Bacteria 2446
22 Ga0070661_100017561 3300005344 Bacteria 5078
23 Ga0070661_100114064 3300005344 Bacteria 2020
24 Ga0070661_100478516 3300005344 Bacteria 994
25 Ga0070692_10115207 3300005345 Bacteria 1492
26 Ga0070692_10191526 3300005345 Bacteria 1192
27 Ga0070668_100065709 3300005347 Bacteria 2814
28 Ga0070669_100184840 3300005353 Bacteria 1632
29 Ga0070671_100042441 3300005355 Bacteria 3780
30 Ga0070674_100123820 3300005356 Bacteria 1917
31 Ga0070673_100013302 3300005364 Bacteria 5685
32 Ga0070659_100037104 3300005366 Bacteria 3799
33 Ga0070659_100415591 3300005366 Bacteria 1137
34 Ga0070659_100472767 3300005366 Bacteria 1066
35 Ga0070703_10010562 3300005406 Bacteria 2604
36 Ga0070709_10003529 3300005434 Bacteria 8405
37 Ga0070709_10373420 3300005434 Bacteria 1058
38 Ga0070714_100000876 3300005435 Bacteria 21365
39 Ga0070714_100001586 3300005435 Bacteria 16520
40 Ga0070714_100065964 3300005435 Bacteria 3119
41 Ga0070714_100150716 3300005435 Bacteria 2095
42 Ga0070714_100272661 3300005435 Bacteria 1569
43 Ga0070714_100482497 3300005435 Bacteria 1180
44 Ga0070713_100006721 3300005436 Bacteria 8005
45 Ga0070713_100020650 3300005436 Bacteria 5053
46 Ga0070713_100057368 3300005436 Bacteria 3242
47 Ga0070713_100162319 3300005436 Bacteria 1995
48 Ga0070713_100325102 3300005436 Bacteria 1421
49 Ga0070713_100374945 3300005436 Bacteria 1324
50 Ga0070713_100429734 3300005436 Bacteria 1237
51 Ga0070713_100488287 3300005436 Bacteria 1161
52 Ga0070710_10103645 3300005437 Bacteria 1698
53 Ga0070701_10062795 3300005438 Bacteria 1964
54 Ga0070711_100080096 3300005439 Bacteria 2324
55 Ga0070711_100118570 3300005439 Bacteria 1953
56 Ga0070705_100106474 3300005440 Bacteria 1782
57 Ga0070708_100005323 3300005445 Bacteria 10203
58 Ga0070708_100007981 3300005445 Bacteria 8480
59 Ga0070708_100033356 3300005445 Bacteria 4473
60 Ga0070708_100401507 3300005445 Bacteria 1292
61 Ga0070663_100010807 3300005455 Bacteria 5702
62 Ga0070663_100382956 3300005455 Bacteria 1146
63 Ga0070678_100111779 3300005456 Bacteria 2138
64 Ga0070685_10311721 3300005466 Bacteria 1064
65 Ga0070706_100145682 3300005467 Bacteria 2211
66 Ga0070706_100162596 3300005467 Bacteria 2085
67 Ga0070706_100164403 3300005467 Bacteria 2072
68 Ga0070707_100023484 3300005468 Bacteria 5834
69 Ga0070707_100074077 3300005468 Bacteria 3283
70 Ga0070707_100103569 3300005468 Bacteria 2758
71 Ga0070698_100012375 3300005471 Bacteria 9035
72 Ga0070698_100028908 3300005471 Bacteria 5755
73 Ga0070698_100037748 3300005471 Bacteria 4980
74 Ga0070698_100065306 3300005471 Bacteria 3664
75 Ga0070698_100256125 3300005471 Bacteria 1682
76 Ga0070699_100002157 3300005518 Bacteria 17795
77 Ga0070679_100104663 3300005530 Bacteria 2816
78 Ga0070679_100137297 3300005530 Bacteria 2426
79 Ga0070679_100197993 3300005530 Bacteria 1976
80 Ga0070679_100274364 3300005530 Bacteria 1640
81 Ga0070679_100842605 3300005530 Bacteria 860
82 Ga0070684_100048798 3300005535 Bacteria 3673
83 Ga0070697_100001147 3300005536 Bacteria 20063
84 Ga0070697_100698357 3300005536 Bacteria 895
85 Ga0068853_100228758 3300005539 Bacteria 1700
86 Ga0070686_100098508 3300005544 Bacteria 1970
87 Ga0070695_100056033 3300005545 Bacteria 2542
88 Ga0070693_100079586 3300005547 Bacteria 1950
89 Ga0070665_100040225 3300005548 Bacteria 4700
90 Ga0070665_100216207 3300005548 Bacteria 1917
91 Ga0068855_100001676 3300005563 Bacteria 27723
92 Ga0068855_100002198 3300005563 Bacteria 24123
93 Ga0068855_100206229 3300005563 Bacteria 2211
94 Ga0068855_100303616 3300005563 Bacteria 1767
95 Ga0070664_100188970 3300005564 Bacteria 1834
96 Ga0068857_100004386 3300005577 Bacteria 11926
97 Ga0068857_100255375 3300005577 Bacteria 1608
98 Ga0068857_100259848 3300005577 Bacteria 1593
99 Ga0068854_100001850 3300005578 Bacteria 12888
100 Ga0068854_100018637 3300005578 Bacteria 4664
101 Ga0068856_100001613 3300005614 Bacteria 23596
102 Ga0068856_100371215 3300005614 Bacteria 1450
103 Ga0068852_100024458 3300005616 Bacteria 4881
104 Ga0068852_100498034 3300005616 Bacteria 1213
105 Ga0068859_100089026 3300005617 Bacteria 3136
106 Ga0068864_100054091 3300005618 Bacteria 3464
107 Ga0068866_10077820 3300005718 Bacteria 1773
108 Ga0068861_100028719 3300005719 Bacteria 4060
109 Ga0068851_10021955 3300005834 Bacteria 3103
110 Ga0068863_100050102 3300005841 Bacteria 3960
111 Ga0068858_100143485 3300005842 Bacteria 2242
112 Ga0068862_100042397 3300005844 Bacteria 3876
113 Ga0081540_1000769 3300005983 Bacteria 29441
114 Ga0070717_10041878 3300006028 Bacteria 3734
115 Ga0070717_10067295 3300006028 Bacteria 2980
116 Ga0070717_10067949 3300006028 Bacteria 2966
117 Ga0070717_10111193 3300006028 Bacteria 2337
118 Ga0070717_10166280 3300006028 Bacteria 1916
119 Ga0070717_10394771 3300006028 Bacteria 1242
120 Ga0070717_10441832 3300006028 Bacteria 1171
121 Ga0070716_100063638 3300006173 Bacteria 2142
122 Ga0070712_100056178 3300006175 Bacteria 2760
123 Ga0070712_100322581 3300006175 Bacteria 1256
124 Ga0070712_100473217 3300006175 Bacteria 1046
125 Ga0070712_100696732 3300006175 Bacteria 866
126 Ga0075370_10002313 3300006353 Bacteria 8794
127 Ga0075428_100497153 3300006844 Bacteria 1305
128 Ga0075434_100474985 3300006871 Bacteria 1271
129 Ga0075434_100500853 3300006871 Bacteria 1235
130 Ga0068865_100101152 3300006881 Bacteria 2110
131 Ga0075436_100238231 3300006914 Bacteria 1293
132 Ga0097620_100089027 3300006931 Bacteria 3136
133 Ga0075435_100117249 3300007076 Bacteria 2219
134 Ga0105244_10069702 3300009036 Bacteria 1755
135 Ga0105240_10036971 3300009093 Bacteria 6275
136 Ga0105240_10204891 3300009093 Bacteria 2309
137 Ga0105240_10274635 3300009093 Bacteria 1939
138 Ga0105240_10636821 3300009093 Bacteria 1170
139 Ga0105247_10079417 3300009101 Bacteria 2065
140 Ga0114129_10989098 3300009147 Bacteria 1060
141 Ga0105243_10027867 3300009148 Bacteria 4333
142 Ga0105243_10717979 3300009148 Bacteria 976
143 Ga0105241_10001456 3300009174 Bacteria 18150
144 Ga0105241_10522641 3300009174 Bacteria 1061
145 Ga0105248_10120406 3300009177 Bacteria 2961
146 Ga0105248_10359409 3300009177 Bacteria 1639
147 Ga0105237_10261410 3300009545 Bacteria 1733
148 Ga0105238_10053247 3300009551 Bacteria 4067
149 Ga0105238_10074576 3300009551 Bacteria 3385
150 Ga0105238_10238330 3300009551 Bacteria 1796
151 Ga0105239_10015868 3300010375 Bacteria 8337
152 Ga0105246_10210491 3300011119 Bacteria 1517
153 Ga0157322_1000682 3300012490 Bacteria 1400
154 Ga0157373_10029187 3300013100 Bacteria 3975
155 Ga0157369_10016813 3300013105 Bacteria 8222
156 Ga0157369_10074902 3300013105 Bacteria 3630
157 Ga0157369_10115783 3300013105 Bacteria 2847
158 Ga0157369_10322720 3300013105 Bacteria 1605
159 Ga0157374_10150884 3300013296 Bacteria 2260
160 Ga0157378_10251152 3300013297 Bacteria 1693
161 Ga0157372_10500938 3300013307 Bacteria 1416
162 Ga0163163_10375230 3300014325 Bacteria 1479
163 Ga0157380_10220040 3300014326 Bacteria 1698
164 Ga0157379_10067463 3300014968 Bacteria 3197
165 Ga0157379_10149443 3300014968 Bacteria 2107
166 Ga0157376_10136666 3300014969 Bacteria 2194
167 Ga0163161_10048776 3300017792 Bacteria 3058
168 Ga0206351_10067632 3300020077 Bacteria 1220
169 Ga0206354_10199349 3300020081 Bacteria 1124
170 Ga0206353_10541231 3300020082 Bacteria 2196
171 Ga0206353_10624408 3300020082 Bacteria 3865
172 Ga0206353_11329215 3300020082 Bacteria 1540
173 Ga0213876_10019401 3300021384 Bacteria 3592
174 Ga0213875_10000180 3300021388 Bacteria 64310
175 Ga0213875_10002224 3300021388 Bacteria 11796
176 Ga0213875_10006402 3300021388 Bacteria 6186
177 Ga0224712_10004037 3300022467 Bacteria 3909
178 Ga0224712_10015787 3300022467 Bacteria 2465
179 Ga0209674_100007 3300025226 Bacteria 1077082
180 Ga0209563_100060 3300025230 Bacteria 284876
181 Ga0207427_100282 3300025231 Bacteria 37116
182 Ga0209258_100608 3300025242 Bacteria 28992
183 Ga0209258_101271 3300025242 Bacteria 9530
184 Ga0209646_1000056 3300025246 Bacteria 269860
185 Ga0209026_1000009 3300025250 Bacteria 531812
186 Ga0209026_1012460 3300025250 Bacteria 1482
187 Ga0209677_100088 3300025253 Bacteria 108817
188 Ga0209677_100112 3300025253 Bacteria 85460
189 Ga0209759_1000035 3300025256 Bacteria 264254
190 Ga0209759_1001596 3300025256 Bacteria 12277
191 Ga0209455_1000108 3300025272 Bacteria 193021
192 Ga0209051_1013374 3300025303 Bacteria 3911
193 Ga0207653_10002079 3300025885 Bacteria 6375
194 Ga0207692_10037899 3300025898 Bacteria 2361
195 Ga0207692_10045419 3300025898 Bacteria 2197
196 Ga0207692_10045671 3300025898 Bacteria 2192
197 Ga0207692_10129278 3300025898 Bacteria 1424
198 Ga0207642_10055496 3300025899 Bacteria 1812
199 Ga0207710_10046697 3300025900 Bacteria 1934
200 Ga0207647_10010385 3300025904 Bacteria 6576
201 Ga0207685_10190191 3300025905 Bacteria 958
202 Ga0207699_10000158 3300025906 Bacteria 42258
203 Ga0207699_10033398 3300025906 Bacteria 2908
204 Ga0207699_10047451 3300025906 Bacteria 2519
205 Ga0207699_10066781 3300025906 Bacteria 2184
206 Ga0207705_10029672 3300025909 Bacteria 3899
207 Ga0207705_10102847 3300025909 Bacteria 2103
208 Ga0207684_10106339 3300025910 Bacteria 2400
209 Ga0207684_10223284 3300025910 Bacteria 1626
210 Ga0207684_10532369 3300025910 Bacteria 1006
211 Ga0207654_10338767 3300025911 Bacteria 1033
212 Ga0207707_10199373 3300025912 Bacteria 1745
213 Ga0207695_10006051 3300025913 Bacteria 15793
214 Ga0207695_10019920 3300025913 Bacteria 7705
215 Ga0207695_10071935 3300025913 Bacteria 3531
216 Ga0207695_10569824 3300025913 Bacteria 1014
217 Ga0207671_10000084 3300025914 Bacteria 143562
218 Ga0207693_10022351 3300025915 Bacteria 5026
219 Ga0207693_10043437 3300025915 Bacteria 3536
220 Ga0207693_10085515 3300025915 Bacteria 2470
221 Ga0207693_10244014 3300025915 Bacteria 1410
222 Ga0207663_10029675 3300025916 Bacteria 3215
223 Ga0207663_10047499 3300025916 Bacteria 2650
224 Ga0207660_10099281 3300025917 Bacteria 2172
225 Ga0207662_10018371 3300025918 Bacteria 3967
226 Ga0207657_10002556 3300025919 Bacteria 19687
227 Ga0207649_10036392 3300025920 Bacteria 2964
228 Ga0207649_10161525 3300025920 Bacteria 1553
229 Ga0207652_10081806 3300025921 Bacteria 2825
230 Ga0207652_10405978 3300025921 Bacteria 1229
231 Ga0207646_10024398 3300025922 Bacteria 5540
232 Ga0207646_10072601 3300025922 Bacteria 3074
233 Ga0207681_10166301 3300025923 Bacteria 1668
234 Ga0207650_10028939 3300025925 Bacteria 3978
235 Ga0207659_10173776 3300025926 Bacteria 1701
236 Ga0207700_10001842 3300025928 Bacteria 12019
237 Ga0207700_10003998 3300025928 Bacteria 8635
238 Ga0207700_10004506 3300025928 Bacteria 8228
239 Ga0207700_10007477 3300025928 Bacteria 6679
240 Ga0207700_10041439 3300025928 Bacteria 3369
241 Ga0207700_10107548 3300025928 Bacteria 2238
242 Ga0207700_10158358 3300025928 Bacteria 1878
243 Ga0207700_10871172 3300025928 Bacteria 806
244 Ga0207664_10006557 3300025929 Bacteria 8018
245 Ga0207664_10007560 3300025929 Bacteria 7541
246 Ga0207664_10012393 3300025929 Bacteria 6093
247 Ga0207664_10019809 3300025929 Bacteria 4979
248 Ga0207664_10028105 3300025929 Bacteria 4271
249 Ga0207664_10031619 3300025929 Bacteria 4050
250 Ga0207664_10099500 3300025929 Bacteria 2400
251 Ga0207664_10132699 3300025929 Bacteria 2098
252 Ga0207664_10294211 3300025929 Bacteria 1427
253 Ga0207664_10543189 3300025929 Bacteria 1042
254 Ga0207706_10062137 3300025933 Bacteria 3290
255 Ga0207709_10004398 3300025935 Bacteria 8155
256 Ga0207669_10059732 3300025937 Bacteria 2334
257 Ga0207665_10123437 3300025939 Bacteria 1831
258 Ga0207711_10076701 3300025941 Bacteria 2911
259 Ga0207689_10005327 3300025942 Bacteria 11530
260 Ga0207689_10061084 3300025942 Bacteria 3099
261 Ga0207661_10117840 3300025944 Bacteria 2256
262 Ga0207679_10091598 3300025945 Bacteria 2353
263 Ga0207667_10004482 3300025949 Bacteria 17103
264 Ga0207667_10025343 3300025949 Bacteria 6493
265 Ga0207667_10080392 3300025949 Bacteria 3377
266 Ga0207651_10020387 3300025960 Bacteria 4000
267 Ga0207640_10007857 3300025981 Bacteria 5886
268 Ga0207640_10184253 3300025981 Bacteria 1568
269 Ga0207640_10232588 3300025981 Bacteria 1419
270 Ga0207678_10005019 3300026067 Bacteria 11874
271 Ga0207678_10020796 3300026067 Bacteria 5752
272 Ga0207678_10028132 3300026067 Bacteria 4909
273 Ga0207678_10073596 3300026067 Bacteria 2928
274 Ga0207678_10302611 3300026067 Bacteria 1374
275 Ga0207702_10001270 3300026078 Bacteria 25363
276 Ga0207702_10072917 3300026078 Bacteria 2960
277 Ga0207702_10246431 3300026078 Bacteria 1676
278 Ga0207702_10277046 3300026078 Bacteria 1584
279 Ga0207641_10557956 3300026088 Bacteria 1117
280 Ga0207648_10022368 3300026089 Bacteria 5679
281 Ga0207676_10169852 3300026095 Bacteria 1899
282 Ga0207674_10004701 3300026116 Bacteria 16372
283 Ga0207674_10007623 3300026116 Bacteria 12607
284 Ga0207674_10010776 3300026116 Bacteria 10313
285 Ga0207674_10081071 3300026116 Bacteria 3247
286 Ga0207674_10351876 3300026116 Bacteria 1424
287 Ga0207674_10377251 3300026116 Bacteria 1371
288 Ga0207674_10633395 3300026116 Bacteria 1032
289 Ga0207675_100011354 3300026118 Bacteria 8335
290 Ga0207675_100087291 3300026118 Bacteria 2929
291 Ga0207683_10003247 3300026121 Bacteria 14185
292 Ga0207683_10344205 3300026121 Bacteria 1368
293 Ga0207698_10146877 3300026142 Bacteria 2040
294 Ga0207698_10291352 3300026142 Bacteria 1515
295 Ga0207698_10444634 3300026142 Bacteria 1250
296 Ga0207698_10654889 3300026142 Bacteria 1041
297 Ga0268266_10044396 3300028379 Bacteria 3800
298 Ga0268266_10095417 3300028379 Bacteria 2612
299 Ga0268265_10102326 3300028380 Bacteria 2317
300 Ga0265337_1000156 3300028556 Bacteria 34716
301 Ga0265337_1000890 3300028556 Bacteria 15716
302 Ga0265326_10002580 3300028558 Bacteria 6092
303 Ga0265319_1005166 3300028563 Bacteria 6308
304 Ga0265319_1008551 3300028563 Bacteria 4469
305 Ga0265334_10001536 3300028573 Bacteria 11162
306 Ga0265334_10008570 3300028573 Bacteria 4343
307 Ga0265318_10026143 3300028577 Bacteria 2300
308 Ga0265323_10004739 3300028653 Bacteria 5833
309 Ga0265323_10039397 3300028653 Bacteria 1723
310 Ga0265322_10020397 3300028654 Bacteria 1900
311 Ga0265336_10000039 3300028666 Bacteria 149376
312 Ga0265336_10003476 3300028666 Bacteria 6166
313 Ga0265336_10075655 3300028666 Bacteria 1006
314 Ga0307515_10164821 3300028794 Bacteria 2240
315 Ga0265338_10000581 3300028800 Bacteria 64325
316 Ga0265338_10000996 3300028800 Bacteria 47684
317 Ga0265338_10003568 3300028800 Bacteria 21755
318 Ga0265324_10000223 3300029957 Bacteria 43654
319 Ga0265324_10003273 3300029957 Bacteria 7792
320 Ga0265324_10005061 3300029957 Bacteria 5776
321 Ga0265332_10005023 3300031238 Bacteria 6148
322 Ga0265332_10005452 3300031238 Bacteria 5866
323 Ga0265320_10002524 3300031240 Bacteria 12717
324 Ga0265320_10006560 3300031240 Bacteria 7321
325 Ga0265325_10009908 3300031241 Bacteria 5544
326 Ga0265325_10103641 3300031241 Bacteria 1390
327 Ga0265339_10057908 3300031249 Bacteria 2094
328 Ga0265331_10051701 3300031250 Bacteria 1966
329 Ga0265316_10017133 3300031344 Bacteria 6271
330 Ga0307509_10004585 3300031507 Bacteria 19813
331 Ga0307509_10196248 3300031507 Bacteria 1862
332 Ga0265314_10007401 3300031711 Bacteria 9519
333 Ga0265342_10007254 3300031712 Bacteria 8146
334 Ga0265342_10015905 3300031712 Bacteria 4934
335 Ga0307516_10001841 3300031730 Bacteria 29116
336 Ga0307406_10044655 3300031901 Bacteria 2778
337 Ga0307409_100123981 3300031995 Bacteria 2194
338 Ga0307409_100254455 3300031995 Bacteria 1608
339 Ga0307409_100357417 3300031995 Bacteria 1380
340 Ga0307416_100261089 3300032002 Bacteria 1693
341 Ga0307416_100774357 3300032002 Bacteria 1054
342 Ga0307414_10550945 3300032004 Bacteria 1028
343 Ga0307415_100333541 3300032126 Bacteria 1270
344 Ga0307415_100744514 3300032126 Bacteria 889
345 Ga0316214_1005208 3300033545 Bacteria 1696
346 Ga0373930_0012475 3300034816 Bacteria 1551
347 Ga0373948_0016015 3300034817 Bacteria 1382
348 Ga0373938_0013493 3300034957 Bacteria 1551
349 Ga0373928_0008832 3300035084 Bacteria 1962
350 Ga0373934_0032823 3300035086 Bacteria 2037
351 Ga0373934_0113999 3300035086 Bacteria 1097
352 Ga0373940_0018304 3300035088 Bacteria 1756
353 Ga0373951_0004542 3300035091 Bacteria 3289
354 Ga0373952_0021663 3300035092 Bacteria 1358
355 Ga0373923_0036948 3300035111 Bacteria 1996
356 Ga0373923_0071137 3300035111 Bacteria 1494
357 Ga0373923_0091444 3300035111 Bacteria 1331
358 Ga0373932_0011366 3300035112 Bacteria 2174
359 Ga0373936_0009348 3300035113 Bacteria 3694
360 Ga0373936_0014586 3300035113 Bacteria 3007
361 Ga0373936_0031908 3300035113 Bacteria 2082
362 Ga0373936_0054683 3300035113 Bacteria 1620
363 Ga0373939_0017948 3300035114 Bacteria 1887
364 Ga0373945_0032032 3300035116 Bacteria 1861
365 Ga0373945_0121571 3300035116 Bacteria 1038
366 Ga0373953_0018744 3300035117 Bacteria 2565
367 Ga0373954_0043482 3300035118 Bacteria 2095
368 Ga0373954_0051002 3300035118 Bacteria 1942
369 Ga0373956_0014027 3300035119 Bacteria 3342
370 Ga0373956_0022915 3300035119 Bacteria 2676
371 Ga0373957_0050081 3300035120 Bacteria 1595
372 Ga0373943_0000118 3300035170 Bacteria 29527
373 Ga0373943_0118116 3300035170 Bacteria 1407
374 Ga0373943_0203576 3300035170 Bacteria 1096
375 Ga0373946_0000064 3300035171 Bacteria 28039
376 Ga0373946_0028886 3300035171 Bacteria 2202
377 Ga0373955_0010519 3300035172 Bacteria 4373
378 Ga0373955_0132200 3300035172 Bacteria 1457
379 Ga0373942_0006369 3300035207 Bacteria 2725
380 Ga0373961_0137319 3300035241 Bacteria 823
381 Ga0373924_0027144 3300035410 Bacteria 2275
382 Ga0373931_0096849 3300035691 Bacteria 1653
383 Ga0373935_0013165 3300035692 Bacteria 4986
384 Ga0373935_0136842 3300035692 Bacteria 1651
385 Ga0373927_0001651 3300035695 Bacteria 16718
386 Ga0373927_0093123 3300035695 Bacteria 1957
387 Ga0373933_0007307 3300035724 Bacteria 6025
388 Ga0373933_0058840 3300035724 Bacteria 2313
389 Ga0373933_0205982 3300035724 Bacteria 1259
390 Ga0373947_0004139 3300035725 Bacteria 8530
391 Ga0373947_0249742 3300035725 Bacteria 1173
392 Ga0373937_0079458 3300036401 Bacteria 3031
393 Ga0373937_0081292 3300036401 Bacteria 2997
394 Ga0373937_0699042 3300036401 Bacteria 960
395 Ga0373937_0799362 3300036401 Bacteria 891
396 Ga0373925_0000033 3300037068 Bacteria 144636
397 Ga0373925_0004725 3300037068 Bacteria 10268
398 Ga0373925_0174475 3300037068 Bacteria 1698
399 Ga0373925_0217651 3300037068 Bacteria 1523
400 Ga0395898_0039736 3300037466 Bacteria 4655
401 Ga0316581_0072420 3300037588 Bacteria 1059
402 Ga0436364_0714989 3300037853 Bacteria 4672
403 Ga0436364_0804297 3300037853 Bacteria 871
404 Ga0436364_0967013 3300037853 Bacteria 873
405 Ga0436364_0999853 3300037853 Bacteria 64321
406 Ga0436364_1201093 3300037853 Bacteria 6371
407 Ga0436364_1280826 3300037853 Bacteria 93394
408 Ga0395901_0082437 3300038443 Bacteria 3360
409 Ga0436365_0254126 3300039437 Bacteria 67152
410 Ga0436365_1711073 3300039437 Bacteria 1247
411 Ga0436361_0671223 3300039447 Bacteria 1977
412 Ga0436363_1021423 3300039450 Bacteria 1950
413 Ga0436363_1147650 3300039450 Bacteria 684
414 Ga0436363_1683620 3300039450 Bacteria 3638
415 Ga0450900_010917 3300042136 Bacteria 1172
416 Ga0451577_0007523 3300042876 Bacteria 10696
417 Ga0451577_0053690 3300042876 Bacteria 3597
418 Ga0466969_0008397 3300044656 Bacteria 5477
419 Ga0466969_0031508 3300044656 Bacteria 2698
420 Ga0453683_0073765 3300044673 Bacteria 2136
421 Ga0466966_0001971 3300044684 Bacteria 13298
422 Ga0466961_0019461 3300044693 Bacteria 4366
423 Ga0466961_0035660 3300044693 Bacteria 3193
424 Ga0466961_0132771 3300044693 Bacteria 1560
425 Ga0453684_0000744 3300044712 Bacteria 113684
426 Ga0453684_0002501 3300044712 Bacteria 44341
427 Ga0453684_0004636 3300044712 Bacteria 28581
428 Ga0453684_0021789 3300044712 Bacteria 9548
429 Ga0453684_0030047 3300044712 Bacteria 7690
430 Ga0453684_0214514 3300044712 Bacteria 2234
431 Ga0453684_0225182 3300044712 Bacteria 2169
432 Ga0466970_0008040 3300044765 Bacteria 5295
433 Ga0466957_0041014 3300044842 Bacteria 2799
434 Ga0466957_0108034 3300044842 Bacteria 1762
435 Ga0466959_0346126 3300045049 Bacteria 1014
436 Ga0466959_0588872 3300045049 Bacteria 749
437 Ga0451576_0015606 3300045051 Bacteria 8409
438 Ga0451576_0489452 3300045051 Bacteria 1292
439 Ga0466958_0014412 3300045836 Bacteria 4514
440 Ga0466958_0384807 3300045836 Bacteria 905
441 Ga0466967_0023662 3300045976 Bacteria 5038
442 Ga0466967_0841704 3300045976 Bacteria 911
443 Ga0495592_0063648 3300046454 Bacteria 2705
444 Ga0495629_0350239 3300046459 Bacteria 1007
445 Ga0495641_0120520 3300046461 Bacteria 1170
446 Ga0495651_0000901 3300046462 Bacteria 23049
447 Ga0495651_0003670 3300046462 Bacteria 11756
448 Ga0495651_0142219 3300046462 Bacteria 1738
449 Ga0495651_0355171 3300046462 Bacteria 967
450 Ga0495653_0045907 3300046463 Bacteria 3384
451 Ga0495653_0053241 3300046463 Bacteria 3097
452 Ga0495653_0385915 3300046463 Bacteria 893
453 Ga0495650_0007772 3300046471 Bacteria 6380
454 Ga0495580_0138599 3300046472 Bacteria 1687
455 Ga0495582_0030507 3300046473 Bacteria 2960
456 Ga0495582_0058786 3300046473 Bacteria 2120
457 Ga0495605_0028762 3300046474 Bacteria 2867
458 Ga0495639_0007408 3300046475 Bacteria 4713
459 Ga0495639_0090310 3300046475 Bacteria 1436
460 Ga0495662_0039050 3300046476 Bacteria 2293
461 Ga0495662_0100385 3300046476 Bacteria 1416
462 Ga0495664_0009856 3300046477 Bacteria 5356
463 Ga0495664_0034763 3300046477 Bacteria 2965
464 Ga0495664_0096713 3300046477 Bacteria 1777
465 Ga0495664_0116181 3300046477 Bacteria 1617
466 Ga0495664_0364245 3300046477 Bacteria 870
467 Ga0495583_0000200 3300046506 Bacteria 100827
468 Ga0495606_0001544 3300046507 Bacteria 30344
469 Ga0495608_0022570 3300046511 Bacteria 4315
470 Ga0495608_0033128 3300046511 Bacteria 3494
471 Ga0495608_0037387 3300046511 Bacteria 3264
472 Ga0495608_0126268 3300046511 Bacteria 1638
473 Ga0495618_0031755 3300046514 Bacteria 3306
474 Ga0495618_0177665 3300046514 Bacteria 1353
475 Ga0495618_0182141 3300046514 Bacteria 1334
476 Ga0495620_0011584 3300046515 Bacteria 4595
477 Ga0495628_0000976 3300046516 Bacteria 26153
478 Ga0495628_0008261 3300046516 Bacteria 8947
479 Ga0495628_0018418 3300046516 Bacteria 5784
480 Ga0495630_0019516 3300046517 Bacteria 4983
481 Ga0495630_0165258 3300046517 Bacteria 1685
482 Ga0495630_0220634 3300046517 Bacteria 1447
483 Ga0495643_0003845 3300046522 Bacteria 10819
484 Ga0495666_0019387 3300046526 Bacteria 3375
485 Ga0495652_0000666 3300046529 Bacteria 39838
486 Ga0495652_0013433 3300046529 Bacteria 7370
487 Ga0495652_0014103 3300046529 Bacteria 7177
488 Ga0495652_0060340 3300046529 Bacteria 3205
489 Ga0495652_0112952 3300046529 Bacteria 2181
490 Ga0495652_0114984 3300046529 Bacteria 2157
491 Ga0495652_0192406 3300046529 Bacteria 1555
492 Ga0495652_0259229 3300046529 Bacteria 1284
493 Ga0495665_0018513 3300046531 Bacteria 3742
494 Ga0495665_0035736 3300046531 Bacteria 2653
495 Ga0495665_0205504 3300046531 Bacteria 1020
496 Ga0495640_0051381 3300046533 Bacteria 2833
497 Ga0495640_0383102 3300046533 Bacteria 865
498 Ga0495586_0012684 3300046535 Bacteria 4469
499 Ga0495586_0062286 3300046535 Bacteria 2030
500 Ga0495587_0024169 3300046536 Bacteria 3727
501 Ga0495587_0090531 3300046536 Bacteria 1767
502 Ga0495587_0143033 3300046536 Bacteria 1364
503 Ga0495587_0382665 3300046536 Bacteria 782
504 Ga0495645_0100735 3300046543 Bacteria 2054
505 Ga0495667_0010392 3300046559 Bacteria 6299
506 Ga0495667_0015143 3300046559 Bacteria 5206
507 Ga0495667_0026147 3300046559 Bacteria 3932
508 Ga0495668_0010852 3300046616 Bacteria 5486
509 Ga0495634_0019234 3300046642 Bacteria 4854
510 Ga0495634_0042598 3300046642 Bacteria 3079
511 Ga0495634_0093116 3300046642 Bacteria 1954
512 Ga0495634_0105737 3300046642 Bacteria 1814
513 Ga0495634_0113034 3300046642 Bacteria 1744
514 Ga0495625_0003764 3300046660 Bacteria 14726
515 Ga0495635_0007797 3300046663 Bacteria 7475
516 Ga0495635_0008189 3300046663 Bacteria 7301
517 Ga0495635_0018839 3300046663 Bacteria 4817
518 Ga0495635_0107822 3300046663 Bacteria 1902
519 Ga0495635_0142254 3300046663 Bacteria 1633
520 Ga0495657_0027021 3300046675 Bacteria 4056
521 Ga0495657_0052560 3300046675 Bacteria 2730
522 Ga0495657_0136401 3300046675 Bacteria 1532
523 Ga0495599_0129050 3300046678 Bacteria 1570
524 Ga0495623_0058570 3300046679 Bacteria 2421
525 Ga0495623_0089415 3300046679 Bacteria 1893
526 Ga0495623_0169363 3300046679 Bacteria 1277
527 Ga0495623_0171045 3300046679 Bacteria 1269
528 Ga0495646_0011146 3300046680 Bacteria 5709
529 Ga0495646_0011654 3300046680 Bacteria 5587
530 Ga0495646_0053566 3300046680 Bacteria 2432
531 Ga0495669_0014203 3300046684 Bacteria 3405
532 Ga0495613_0012221 3300046689 Bacteria 6380
533 Ga0495613_0015907 3300046689 Bacteria 5601
534 Ga0495613_0046753 3300046689 Bacteria 3199
535 Ga0495624_0058759 3300046690 Bacteria 2414
536 Ga0495624_0072602 3300046690 Bacteria 2140
537 Ga0495624_0180882 3300046690 Bacteria 1285
538 Ga0495649_0000068 3300046694 Bacteria 92317
539 Ga0495589_0009718 3300046794 Bacteria 4997
540 Ga0495589_0114553 3300046794 Bacteria 1300
541 Ga0495600_0005924 3300046809 Bacteria 7395
542 Ga0495600_0018011 3300046809 Bacteria 4497
543 Ga0495600_0058358 3300046809 Bacteria 2521
544 Ga0495600_0102771 3300046809 Bacteria 1862
545 Ga0495600_0335008 3300046809 Bacteria 949
546 Ga0495660_0009826 3300046810 Bacteria 5570
547 Ga0495581_0027460 3300047315 Bacteria 3301
548 Ga0495581_0042772 3300047315 Bacteria 2622
549 Ga0495604_0006567 3300047317 Bacteria 9221
550 Ga0495604_0024117 3300047317 Bacteria 4855
551 Ga0495604_0031210 3300047317 Bacteria 4228
552 Ga0495604_0056816 3300047317 Bacteria 3010
553 Ga0495604_0095533 3300047317 Bacteria 2195
554 Ga0495604_0096794 3300047317 Bacteria 2177
555 Ga0495636_0137372 3300047318 Bacteria 1090
556 Ga0495674_0021787 3300047319 Bacteria 5922
557 Ga0495674_0063841 3300047319 Bacteria 3202
558 Ga0495674_0098171 3300047319 Bacteria 2494
559 Ga0495674_0134701 3300047319 Bacteria 2080
560 Ga0495676_0166628 3300047321 Bacteria 1554
561 Ga0495680_0004658 3300047322 Bacteria 13060
562 Ga0495680_0042566 3300047322 Bacteria 3602
563 Ga0495680_0056095 3300047322 Bacteria 3051
564 Ga0495680_0189864 3300047322 Bacteria 1478
565 Ga0495687_025223 3300047443 Bacteria 2814
566 Ga0495675_0159428 3300047444 Bacteria 1390
567 Ga0495675_0311100 3300047444 Bacteria 933
568 Ga0495685_063671 3300047447 Bacteria 1241
569 Ga0495685_084099 3300047447 Bacteria 1058
570 Ga0495684_0003355 3300047471 Bacteria 12572
571 Ga0495684_0166508 3300047471 Bacteria 1641
572 Ga0495593_0007860 3300047673 Bacteria 6212
573 Ga0495593_0115136 3300047673 Bacteria 1371
574 Ga0495593_0130719 3300047673 Bacteria 1274
575 Ga0495602_0071518 3300048088 Bacteria 2962
576 Ga0495602_0072266 3300048088 Bacteria 2942
577 Ga0495602_0197182 3300048088 Bacteria 1539
578 Ga0495602_0320687 3300048088 Bacteria 1127
579 Ga0495614_0039688 3300048089 Bacteria 2020
580 Ga0495614_0051565 3300048089 Bacteria 1763
581 Ga0496101_0104075 3300048904 Bacteria 2128
582 Ga0496102_0313347 3300048905 Bacteria 1478
583 Ga0496104_0155040 3300048907 Bacteria 2198
584 Ga0496106_0058056 3300048909 Bacteria 2928
585 Ga0496107_0107455 3300048910 Bacteria 2049
586 Ga0496108_0201225 3300048911 Bacteria 1728
587 Ga0496108_0299762 3300048911 Bacteria 1400
588 Ga0496109_0061867 3300048912 Bacteria 3423
589 Ga0496110_0084127 3300048913 Bacteria 2839
590 Ga0496111_0021903 3300048914 Bacteria 4467
591 Ga0496112_0699436 3300048915 Bacteria 941
592 Ga0496114_0103689 3300048917 Bacteria 2431
593 Ga0496115_0043395 3300048918 Bacteria 3586
594 Ga0496126_0020870 3300048929 Bacteria 6412
595 Ga0501031_0322954 3300049568 Bacteria 1000
596 Ga0501032_0004860 3300049569 Bacteria 10063
597 Ga0501033_0010129 3300049570 Bacteria 7235
598 Ga0501036_0024415 3300049572 Bacteria 5095
599 Ga0501036_0141781 3300049572 Bacteria 2028
600 Ga0501036_0173581 3300049572 Bacteria 1816
601 Ga0501036_0354639 3300049572 Bacteria 1225
602 Ga0501036_0400470 3300049572 Bacteria 1145
603 Ga0501037_0035884 3300049573 Bacteria 3653
604 Ga0501038_0003005 3300049574 Bacteria 15719
605 Ga0501039_0023178 3300049575 Bacteria 4763
606 Ga0501039_0301207 3300049575 Bacteria 1260
607 Ga0501040_0325912 3300049576 Bacteria 1099
608 Ga0501041_0012167 3300049577 Bacteria 5095
609 Ga0501041_0079287 3300049577 Bacteria 2021
610 Ga0501046_0045549 3300049580 Bacteria 3484
611 Ga0501068_0014392 3300049584 Bacteria 4521
612 Ga0501069_0007465 3300049585 Bacteria 5740
613 Ga0501070_0011785 3300049586 Bacteria 7384
614 Ga0501070_0284936 3300049586 Bacteria 1348
615 Ga0501071_0098250 3300049587 Bacteria 2156
616 Ga0501071_0110644 3300049587 Bacteria 2030
617 Ga0501072_0226375 3300049588 Bacteria 1490
618 Ga0501073_0001742 3300049589 Bacteria 16172
619 Ga0501074_0018468 3300049590 Bacteria 5065
620 Ga0501074_0286963 3300049590 Bacteria 1170
621 Ga0501075_0060268 3300049591 Bacteria 2859
622 Ga0501075_0060913 3300049591 Bacteria 2843
623 Ga0501075_0119692 3300049591 Bacteria 2003
624 Ga0501075_0148509 3300049591 Bacteria 1787
625 Ga0501075_0171171 3300049591 Bacteria 1657
626 Ga0501076_0052296 3300049592 Bacteria 3235
627 Ga0501079_0177200 3300049741 Bacteria 1663
628 Ga0501079_0262353 3300049741 Bacteria 1350
629 Ga0501079_0333290 3300049741 Bacteria 1188
630 Ga0501079_0629888 3300049741 Bacteria 844
631 Ga0501080_0007118 3300049742 Bacteria 10101
632 Ga0501080_0393390 3300049742 Bacteria 1248
633 Ga0501081_0097064 3300049743 Bacteria 2079
634 Ga0501081_0205307 3300049743 Bacteria 1430
635 Ga0501035_0022868 3300049822 Bacteria 5740
636 Ga0501035_0513176 3300049822 Bacteria 985
637 Ga0501045_0060856 3300049824 Bacteria 2769
638 Ga0501045_0066299 3300049824 Bacteria 2651
639 Ga0501045_0277867 3300049824 Bacteria 1247
640 nmdc:mga07m45_483_c3 3300050496 Bacteria 8601
641 nmdc:mga0n895_277458_c1 3300050512 Bacteria 1700
642 Ga0495601_0004806 3300053077 Bacteria 7831
643 Ga0495601_0087589 3300053077 Bacteria 2002
644 Ga0495612_0001359 3300053078 Bacteria 10074
645 Ga0500635_0001451 3300053080 Bacteria 5702
646 Ga0495595_0106859 3300053084 Bacteria 1354
647 Ga0495619_0308931 3300053085 Bacteria 1095
648 Ga0500559_0006137 3300053136 Bacteria 5439
649 Ga0500573_0045604 3300053140 Bacteria 2527
650 Ga0501084_0070438 3300054114 Bacteria 2928
651 Ga0501084_0320424 3300054114 Bacteria 1309
652 Ga0501082_0008847 3300060353 Bacteria 8685
653 Ga0501082_0124424 3300060353 Bacteria 2236
654 Ga0501082_0399574 3300060353 Bacteria 1199
655 Ga0466962_0010285 3300061719 Bacteria 4493
656 Ga0530510_0013686 3300061734 Bacteria 5710
657 Ga0530510_0025812 3300061734 Bacteria 4203
658 Ga0530510_0329474 3300061734 Bacteria 1145

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013105 Ga0157369_10115783 Ga0157369_101157832 188
2 3300046462 Ga0495651_0142219 Ga0495651_0142219_255_842 193
3 3300046477 Ga0495664_0364245 Ga0495664_0364245_56_643 193
4 3300046514 Ga0495618_0182141 Ga0495618_0182141_381_968 193
5 3300046516 Ga0495628_0018418 Ga0495628_0018418_3095_3682 193
6 3300046529 Ga0495652_0114984 Ga0495652_0114984_1126_1713 193
7 3300046533 Ga0495640_0383102 Ga0495640_0383102_144_731 193
8 3300046642 Ga0495634_0042598 Ga0495634_0042598_1180_1767 193
9 3300046663 Ga0495635_0008189 Ga0495635_0008189_2936_3523 193
10 3300046679 Ga0495623_0089415 Ga0495623_0089415_1150_1737 193
11 3300046689 Ga0495613_0046753 Ga0495613_0046753_487_1074 193
12 3300046690 Ga0495624_0180882 Ga0495624_0180882_26_613 193
13 3300047317 Ga0495604_0031210 Ga0495604_0031210_3332_3919 193
14 3300047322 Ga0495680_0042566 Ga0495680_0042566_2732_3319 193
15 3300047673 Ga0495593_0115136 Ga0495593_0115136_144_731 193
16 3300048089 Ga0495614_0051565 Ga0495614_0051565_1127_1714 193
17 3300035170 Ga0373943_0118116 Ga0373943_0118116_11_649 197
18 3300042136 Ga0450900_010917 Ga0450900_010917_112_798 199
19 3300039450 Ga0436363_1147650 Ga0436363_1147650_12_674 206
20 3300005468 Ga0070707_100023484 Ga0070707_1000234842 208
21 3300025922 Ga0207646_10024398 Ga0207646_100243982 208
22 3300025899 Ga0207642_10055496 Ga0207642_100554961 211
23 3300049741 Ga0501079_0333290 Ga0501079_0333290_522_1166 211
24 3300013105 Ga0157369_10322720 Ga0157369_103227202 216
25 3300014968 Ga0157379_10149443 Ga0157379_101494432 216
26 3300048911 Ga0496108_0299762 Ga0496108_0299762_283_984 216
27 3300048929 Ga0496126_0020870 Ga0496126_0020870_2215_2916 216
28 3300005445 Ga0070708_100007981 Ga0070708_1000079816 218
29 3300005518 Ga0070699_100002157 Ga0070699_10000215711 218
30 3300005536 Ga0070697_100001147 Ga0070697_1000011477 218
31 3300011119 Ga0105246_10210491 Ga0105246_102104911 218
32 3300013100 Ga0157373_10029187 Ga0157373_100291874 218
33 3300013297 Ga0157378_10251152 Ga0157378_102511522 218
34 3300013307 Ga0157372_10500938 Ga0157372_105009382 218
35 3300014326 Ga0157380_10220040 Ga0157380_102200402 218
36 3300021388 Ga0213875_10002224 Ga0213875_100022247 218
37 3300028380 Ga0268265_10102326 Ga0268265_101023263 218
38 3300034816 Ga0373930_0012475 Ga0373930_0012475_282_989 218
39 3300034957 Ga0373938_0013493 Ga0373938_0013493_565_1272 218
40 3300035084 Ga0373928_0008832 Ga0373928_0008832_214_921 218
41 3300035088 Ga0373940_0018304 Ga0373940_0018304_691_1398 218
42 3300035091 Ga0373951_0004542 Ga0373951_0004542_1292_1999 218
43 3300035092 Ga0373952_0021663 Ga0373952_0021663_25_732 218
44 3300035113 Ga0373936_0054683 Ga0373936_0054683_80_787 218
45 3300035114 Ga0373939_0017948 Ga0373939_0017948_643_1350 218
46 3300035170 Ga0373943_0000118 Ga0373943_0000118_11233_11940 218
47 3300035170 Ga0373943_0203576 Ga0373943_0203576_103_810 218
48 3300035171 Ga0373946_0000064 Ga0373946_0000064_5207_5914 218
49 3300035207 Ga0373942_0006369 Ga0373942_0006369_342_1049 218
50 3300035241 Ga0373961_0137319 Ga0373961_0137319_68_775 218
51 3300035691 Ga0373931_0096849 Ga0373931_0096849_77_784 218
52 3300035692 Ga0373935_0013165 Ga0373935_0013165_664_1371 218
53 3300035725 Ga0373947_0004139 Ga0373947_0004139_3488_4195 218
54 3300036401 Ga0373937_0799362 Ga0373937_0799362_96_803 218
55 3300037068 Ga0373925_0004725 Ga0373925_0004725_5268_5975 218
56 3300037068 Ga0373925_0174475 Ga0373925_0174475_907_1614 218
57 3300037068 Ga0373925_0217651 Ga0373925_0217651_129_836 218
58 3300037853 Ga0436364_0714989 Ga0436364_0714989_1008_1715 218
59 3300037853 Ga0436364_1201093 Ga0436364_1201093_687_1394 218
60 3300039437 Ga0436365_1711073 Ga0436365_1711073_485_1192 218
61 3300044712 Ga0453684_0021789 Ga0453684_0021789_8601_9293 218
62 3300044712 Ga0453684_0030047 Ga0453684_0030047_256_948 218
63 3300046473 Ga0495582_0030507 Ga0495582_0030507_1790_2497 218
64 3300046477 Ga0495664_0116181 Ga0495664_0116181_341_1048 218
65 3300046517 Ga0495630_0165258 Ga0495630_0165258_263_970 218
66 3300046543 Ga0495645_0100735 Ga0495645_0100735_1072_1779 218
67 3300046559 Ga0495667_0010392 Ga0495667_0010392_5210_5917 218
68 3300046690 Ga0495624_0058759 Ga0495624_0058759_130_837 218
69 3300047319 Ga0495674_0021787 Ga0495674_0021787_3750_4457 218
70 3300047319 Ga0495674_0098171 Ga0495674_0098171_300_1007 218
71 3300047471 Ga0495684_0003355 Ga0495684_0003355_7877_8584 218
72 3300048904 Ga0496101_0104075 Ga0496101_0104075_776_1483 218
73 3300048905 Ga0496102_0313347 Ga0496102_0313347_223_930 218
74 3300048907 Ga0496104_0155040 Ga0496104_0155040_1202_1909 218
75 3300048909 Ga0496106_0058056 Ga0496106_0058056_1645_2352 218
76 3300048911 Ga0496108_0201225 Ga0496108_0201225_500_1207 218
77 3300048912 Ga0496109_0061867 Ga0496109_0061867_1721_2428 218
78 3300048913 Ga0496110_0084127 Ga0496110_0084127_1200_1907 218
79 3300048914 Ga0496111_0021903 Ga0496111_0021903_500_1207 218
80 3300048915 Ga0496112_0699436 Ga0496112_0699436_73_780 218
81 3300048917 Ga0496114_0103689 Ga0496114_0103689_646_1353 218
82 3300048918 Ga0496115_0043395 Ga0496115_0043395_635_1342 218
83 3300050512 nmdc:mga0n895_277458_c1 nmdc:mga0n895_277458_c1_535_1242 218
84 3300035086 Ga0373934_0032823 Ga0373934_0032823_380_1090 219
85 3300035113 Ga0373936_0014586 Ga0373936_0014586_1464_2174 219
86 3300035117 Ga0373953_0018744 Ga0373953_0018744_433_1143 219
87 3300035172 Ga0373955_0010519 Ga0373955_0010519_2035_2745 219
88 3300035724 Ga0373933_0007307 Ga0373933_0007307_1273_1983 219
89 3300036401 Ga0373937_0081292 Ga0373937_0081292_909_1619 219
90 3300046454 Ga0495592_0063648 Ga0495592_0063648_810_1520 219
91 3300046463 Ga0495653_0053241 Ga0495653_0053241_987_1697 219
92 3300046511 Ga0495608_0033128 Ga0495608_0033128_1534_2244 219
93 3300046514 Ga0495618_0177665 Ga0495618_0177665_526_1236 219
94 3300046529 Ga0495652_0014103 Ga0495652_0014103_5190_5900 219
95 3300046536 Ga0495587_0090531 Ga0495587_0090531_906_1616 219
96 3300046559 Ga0495667_0026147 Ga0495667_0026147_2417_3127 219
97 3300046642 Ga0495634_0019234 Ga0495634_0019234_215_925 219
98 3300046663 Ga0495635_0018839 Ga0495635_0018839_55_765 219
99 3300046675 Ga0495657_0027021 Ga0495657_0027021_724_1434 219
100 3300046679 Ga0495623_0169363 Ga0495623_0169363_488_1198 219
101 3300046809 Ga0495600_0018011 Ga0495600_0018011_2638_3348 219
102 3300047317 Ga0495604_0096794 Ga0495604_0096794_833_1543 219
103 3300047319 Ga0495674_0134701 Ga0495674_0134701_1032_1742 219
104 3300047322 Ga0495680_0004658 Ga0495680_0004658_11517_12227 219
105 3300048088 Ga0495602_0071518 Ga0495602_0071518_692_1402 219
106 3300028556 Ga0265337_1000890 Ga0265337_10008902 220
107 3300028558 Ga0265326_10002580 Ga0265326_100025804 220
108 3300028563 Ga0265319_1005166 Ga0265319_10051664 220
109 3300028573 Ga0265334_10001536 Ga0265334_100015363 220
110 3300028577 Ga0265318_10026143 Ga0265318_100261432 220
111 3300028653 Ga0265323_10004739 Ga0265323_100047394 220
112 3300028654 Ga0265322_10020397 Ga0265322_100203972 220
113 3300028666 Ga0265336_10003476 Ga0265336_100034764 220
114 3300028800 Ga0265338_10003568 Ga0265338_1000356817 220
115 3300029957 Ga0265324_10005061 Ga0265324_100050612 220
116 3300031238 Ga0265332_10005452 Ga0265332_100054524 220
117 3300031240 Ga0265320_10006560 Ga0265320_100065604 220
118 3300031241 Ga0265325_10009908 Ga0265325_100099083 220
119 3300031249 Ga0265339_10057908 Ga0265339_100579082 220
120 3300031250 Ga0265331_10051701 Ga0265331_100517012 220
121 3300031344 Ga0265316_10017133 Ga0265316_100171332 220
122 3300031711 Ga0265314_10007401 Ga0265314_100074015 220
123 3300031712 Ga0265342_10015905 Ga0265342_100159054 220
124 3300049590 Ga0501074_0018468 Ga0501074_0018468_3841_4563 220
125 3300005337 Ga0070682_100097036 Ga0070682_1000970362 221
126 3300005344 Ga0070661_100114064 Ga0070661_1001140642 221
127 3300005435 Ga0070714_100482497 Ga0070714_1004824972 221
128 3300005436 Ga0070713_100325102 Ga0070713_1003251022 221
129 3300005455 Ga0070663_100382956 Ga0070663_1003829562 221
130 3300005466 Ga0070685_10311721 Ga0070685_103117212 221
131 3300005471 Ga0070698_100065306 Ga0070698_1000653061 221
132 3300006028 Ga0070717_10111193 Ga0070717_101111932 221
133 3300006175 Ga0070712_100056178 Ga0070712_1000561783 221
134 3300009148 Ga0105243_10717979 Ga0105243_107179792 221
135 3300009174 Ga0105241_10522641 Ga0105241_105226412 221
136 3300025898 Ga0207692_10045671 Ga0207692_100456712 221
137 3300025915 Ga0207693_10043437 Ga0207693_100434374 221
138 3300025915 Ga0207693_10085515 Ga0207693_100855153 221
139 3300025916 Ga0207663_10047499 Ga0207663_100474993 221
140 3300025920 Ga0207649_10161525 Ga0207649_101615252 221
141 3300025928 Ga0207700_10003998 Ga0207700_100039982 221
142 3300025929 Ga0207664_10294211 Ga0207664_102942112 221
143 3300026067 Ga0207678_10302611 Ga0207678_103026112 221
144 3300026095 Ga0207676_10169852 Ga0207676_101698521 221
145 3300028794 Ga0307515_10164821 Ga0307515_101648211 221
146 3300031995 Ga0307409_100123981 Ga0307409_1001239812 221
147 3300032002 Ga0307416_100261089 Ga0307416_1002610892 221
148 3300032002 Ga0307416_100774357 Ga0307416_1007743571 221
149 3300032126 Ga0307415_100333541 Ga0307415_1003335412 221
150 3300032126 Ga0307415_100744514 Ga0307415_1007445142 221
151 3300035086 Ga0373934_0113999 Ga0373934_0113999_235_966 221
152 3300035111 Ga0373923_0071137 Ga0373923_0071137_209_940 221
153 3300035118 Ga0373954_0043482 Ga0373954_0043482_138_869 221
154 3300035119 Ga0373956_0022915 Ga0373956_0022915_1355_2086 221
155 3300035692 Ga0373935_0136842 Ga0373935_0136842_170_901 221
156 3300035724 Ga0373933_0058840 Ga0373933_0058840_1232_1963 221
157 3300035725 Ga0373947_0249742 Ga0373947_0249742_52_783 221
158 3300036401 Ga0373937_0699042 Ga0373937_0699042_199_930 221
159 3300044842 Ga0466957_0108034 Ga0466957_0108034_510_1241 221
160 3300046463 Ga0495653_0385915 Ga0495653_0385915_33_764 221
161 3300046476 Ga0495662_0100385 Ga0495662_0100385_494_1225 221
162 3300046477 Ga0495664_0034763 Ga0495664_0034763_2160_2891 221
163 3300046511 Ga0495608_0037387 Ga0495608_0037387_727_1458 221
164 3300046514 Ga0495618_0031755 Ga0495618_0031755_201_893 221
165 3300046516 Ga0495628_0008261 Ga0495628_0008261_3860_4552 221
166 3300046529 Ga0495652_0060340 Ga0495652_0060340_303_1034 221
167 3300046531 Ga0495665_0205504 Ga0495665_0205504_106_837 221
168 3300046536 Ga0495587_0024169 Ga0495587_0024169_2824_3555 221
169 3300046642 Ga0495634_0093116 Ga0495634_0093116_636_1367 221
170 3300046680 Ga0495646_0053566 Ga0495646_0053566_51_782 221
171 3300047317 Ga0495604_0095533 Ga0495604_0095533_1216_1947 221
172 3300047321 Ga0495676_0166628 Ga0495676_0166628_510_1241 221
173 3300047444 Ga0495675_0159428 Ga0495675_0159428_235_966 221
174 3300053077 Ga0495601_0004806 Ga0495601_0004806_1138_1830 221
175 3300053077 Ga0495601_0087589 Ga0495601_0087589_1124_1855 221
176 3300005344 Ga0070661_100478516 Ga0070661_1004785162 222
177 3300005345 Ga0070692_10191526 Ga0070692_101915261 222
178 3300005366 Ga0070659_100415591 Ga0070659_1004155911 222
179 3300005471 Ga0070698_100028908 Ga0070698_1000289084 222
180 3300005530 Ga0070679_100197993 Ga0070679_1001979932 222
181 3300037853 Ga0436364_1280826 Ga0436364_1280826_87753_88487 222
182 3300045049 Ga0466959_0588872 Ga0466959_0588872_55_735 222
183 iso_pu_bacteria 2904479285 2904482916 222
184 3300005445 Ga0070708_100033356 Ga0070708_1000333562 223
185 3300005536 Ga0070697_100698357 Ga0070697_1006983571 223
186 3300006175 Ga0070712_100696732 Ga0070712_1006967322 223
187 3300020077 Ga0206351_10067632 Ga0206351_100676322 223
188 3300021384 Ga0213876_10019401 Ga0213876_100194012 223
189 3300026116 Ga0207674_10377251 Ga0207674_103772512 223
190 3300026142 Ga0207698_10444634 Ga0207698_104446342 223
191 3300039437 Ga0436365_0254126 Ga0436365_0254126_3763_4515 223
192 3300049572 Ga0501036_0354639 Ga0501036_0354639_379_1155 223
193 3300049591 Ga0501075_0148509 Ga0501075_0148509_647_1423 223
194 3300049743 Ga0501081_0205307 Ga0501081_0205307_287_1063 223
195 iso_pu_bacteria 2687453743 2689996102 223
196 3300005435 Ga0070714_100001586 Ga0070714_1000015865 224
197 3300005436 Ga0070713_100006721 Ga0070713_1000067213 224
198 3300025928 Ga0207700_10004506 Ga0207700_100045064 224
199 3300025929 Ga0207664_10019809 Ga0207664_100198092 224
200 3300025941 Ga0207711_10076701 Ga0207711_100767012 224
201 3300031995 Ga0307409_100254455 Ga0307409_1002544552 224
202 3300035113 Ga0373936_0031908 Ga0373936_0031908_31_756 224
203 3300039447 Ga0436361_0671223 Ga0436361_0671223_839_1564 224
204 3300049572 Ga0501036_0141781 Ga0501036_0141781_857_1591 224
205 3300049572 Ga0501036_0400470 Ga0501036_0400470_257_1000 224
206 3300049575 Ga0501039_0301207 Ga0501039_0301207_25_759 224
207 3300049576 Ga0501040_0325912 Ga0501040_0325912_25_759 224
208 3300049577 Ga0501041_0079287 Ga0501041_0079287_144_878 224
209 3300049587 Ga0501071_0110644 Ga0501071_0110644_638_1381 224
210 3300049588 Ga0501072_0226375 Ga0501072_0226375_25_759 224
211 3300049590 Ga0501074_0286963 Ga0501074_0286963_301_1035 224
212 3300049591 Ga0501075_0060913 Ga0501075_0060913_1710_2453 224
213 3300049591 Ga0501075_0171171 Ga0501075_0171171_339_1073 224
214 3300049741 Ga0501079_0177200 Ga0501079_0177200_867_1601 224
215 3300049822 Ga0501035_0513176 Ga0501035_0513176_103_837 224
216 3300049824 Ga0501045_0060856 Ga0501045_0060856_1553_2296 224
217 3300049824 Ga0501045_0277867 Ga0501045_0277867_390_1124 224
218 3300054114 Ga0501084_0070438 Ga0501084_0070438_1743_2486 224
219 3300060353 Ga0501082_0399574 Ga0501082_0399574_383_1126 224
220 3300005445 Ga0070708_100005323 Ga0070708_1000053233 225
221 3300005467 Ga0070706_100162596 Ga0070706_1001625961 225
222 3300005471 Ga0070698_100012375 Ga0070698_1000123756 225
223 3300005548 Ga0070665_100216207 Ga0070665_1002162072 225
224 3300005563 Ga0068855_100001676 Ga0068855_10000167610 225
225 3300005578 Ga0068854_100018637 Ga0068854_1000186373 225
226 3300005616 Ga0068852_100024458 Ga0068852_1000244582 225
227 3300009093 Ga0105240_10274635 Ga0105240_102746352 225
228 3300009147 Ga0114129_10989098 Ga0114129_109890982 225
229 3300009174 Ga0105241_10001456 Ga0105241_100014569 225
230 3300009177 Ga0105248_10120406 Ga0105248_101204062 225
231 3300009551 Ga0105238_10074576 Ga0105238_100745764 225
232 3300013296 Ga0157374_10150884 Ga0157374_101508845 225
233 3300014968 Ga0157379_10067463 Ga0157379_100674632 225
234 3300022467 Ga0224712_10004037 Ga0224712_100040372 225
235 3300025904 Ga0207647_10010385 Ga0207647_100103853 225
236 3300025910 Ga0207684_10532369 Ga0207684_105323691 225
237 3300025911 Ga0207654_10338767 Ga0207654_103387671 225
238 3300025913 Ga0207695_10006051 Ga0207695_100060514 225
239 3300025914 Ga0207671_10000084 Ga0207671_1000008473 225
240 3300025949 Ga0207667_10080392 Ga0207667_100803922 225
241 3300025981 Ga0207640_10184253 Ga0207640_101842532 225
242 3300026067 Ga0207678_10028132 Ga0207678_100281322 225
243 3300026078 Ga0207702_10246431 Ga0207702_102464312 225
244 3300026121 Ga0207683_10344205 Ga0207683_103442052 225
245 3300028379 Ga0268266_10095417 Ga0268266_100954173 225
246 3300028800 Ga0265338_10000581 Ga0265338_1000058120 225
247 3300031507 Ga0307509_10004585 Ga0307509_100045855 225
248 3300031901 Ga0307406_10044655 Ga0307406_100446552 225
249 3300031995 Ga0307409_100357417 Ga0307409_1003574172 225
250 3300032004 Ga0307414_10550945 Ga0307414_105509452 225
251 3300035695 Ga0373927_0001651 Ga0373927_0001651_4847_5575 225
252 3300037853 Ga0436364_0967013 Ga0436364_0967013_60_818 225
253 3300037853 Ga0436364_0999853 Ga0436364_0999853_40854_41585 225
254 3300039450 Ga0436363_1683620 Ga0436363_1683620_1017_1772 225
255 3300044673 Ga0453683_0073765 Ga0453683_0073765_135_875 225
256 3300044693 Ga0466961_0035660 Ga0466961_0035660_2258_2947 225
257 3300044693 Ga0466961_0132771 Ga0466961_0132771_459_1145 225
258 3300044765 Ga0466970_0008040 Ga0466970_0008040_4306_4992 225
259 3300045049 Ga0466959_0346126 Ga0466959_0346126_103_789 225
260 3300045051 Ga0451576_0015606 Ga0451576_0015606_1073_1813 225
261 3300045836 Ga0466958_0384807 Ga0466958_0384807_179_865 225
262 3300045976 Ga0466967_0023662 Ga0466967_0023662_2859_3587 225
263 3300046462 Ga0495651_0000901 Ga0495651_0000901_21628_22314 225
264 3300046462 Ga0495651_0355171 Ga0495651_0355171_255_941 225
265 3300046463 Ga0495653_0045907 Ga0495653_0045907_2096_2818 225
266 3300046472 Ga0495580_0138599 Ga0495580_0138599_109_831 225
267 3300046474 Ga0495605_0028762 Ga0495605_0028762_2090_2812 225
268 3300046476 Ga0495662_0039050 Ga0495662_0039050_922_1644 225
269 3300046477 Ga0495664_0009856 Ga0495664_0009856_2905_3627 225
270 3300046511 Ga0495608_0022570 Ga0495608_0022570_2146_2868 225
271 3300046515 Ga0495620_0011584 Ga0495620_0011584_3463_4185 225
272 3300046516 Ga0495628_0000976 Ga0495628_0000976_16817_17503 225
273 3300046517 Ga0495630_0019516 Ga0495630_0019516_3498_4220 225
274 3300046522 Ga0495643_0003845 Ga0495643_0003845_7078_7800 225
275 3300046526 Ga0495666_0019387 Ga0495666_0019387_1602_2324 225
276 3300046529 Ga0495652_0000666 Ga0495652_0000666_36667_37353 225
277 3300046529 Ga0495652_0013433 Ga0495652_0013433_2479_3219 225
278 3300046529 Ga0495652_0192406 Ga0495652_0192406_198_920 225
279 3300046531 Ga0495665_0018513 Ga0495665_0018513_2779_3501 225
280 3300046533 Ga0495640_0051381 Ga0495640_0051381_921_1643 225
281 3300046535 Ga0495586_0012684 Ga0495586_0012684_1000_1722 225
282 3300046536 Ga0495587_0382665 Ga0495587_0382665_47_769 225
283 3300046559 Ga0495667_0015143 Ga0495667_0015143_198_920 225
284 3300046616 Ga0495668_0010852 Ga0495668_0010852_2623_3345 225
285 3300046642 Ga0495634_0105737 Ga0495634_0105737_951_1673 225
286 3300046663 Ga0495635_0007797 Ga0495635_0007797_1561_2301 225
287 3300046663 Ga0495635_0107822 Ga0495635_0107822_545_1267 225
288 3300046675 Ga0495657_0136401 Ga0495657_0136401_47_769 225
289 3300046678 Ga0495599_0129050 Ga0495599_0129050_668_1390 225
290 3300046680 Ga0495646_0011146 Ga0495646_0011146_4709_5449 225
291 3300046680 Ga0495646_0011654 Ga0495646_0011654_2146_2868 225
292 3300046689 Ga0495613_0012221 Ga0495613_0012221_2229_2966 225
293 3300046689 Ga0495613_0015907 Ga0495613_0015907_4691_5413 225
294 3300046794 Ga0495589_0009718 Ga0495589_0009718_2139_2861 225
295 3300046809 Ga0495600_0005924 Ga0495600_0005924_672_1358 225
296 3300046809 Ga0495600_0058358 Ga0495600_0058358_399_1139 225
297 3300046809 Ga0495600_0102771 Ga0495600_0102771_952_1674 225
298 3300046810 Ga0495660_0009826 Ga0495660_0009826_854_1576 225
299 3300047315 Ga0495581_0027460 Ga0495581_0027460_446_1168 225
300 3300047317 Ga0495604_0006567 Ga0495604_0006567_318_1004 225
301 3300047317 Ga0495604_0024117 Ga0495604_0024117_3498_4220 225
302 3300047318 Ga0495636_0137372 Ga0495636_0137372_53_775 225
303 3300047319 Ga0495674_0063841 Ga0495674_0063841_458_1180 225
304 3300047443 Ga0495687_025223 Ga0495687_025223_677_1399 225
305 3300047444 Ga0495675_0311100 Ga0495675_0311100_198_920 225
306 3300047447 Ga0495685_084099 Ga0495685_084099_305_1027 225
307 3300047673 Ga0495593_0007860 Ga0495593_0007860_3193_3915 225
308 3300048088 Ga0495602_0197182 Ga0495602_0197182_746_1486 225
309 3300049568 Ga0501031_0322954 Ga0501031_0322954_64_801 225
310 3300049569 Ga0501032_0004860 Ga0501032_0004860_4807_5544 225
311 3300049570 Ga0501033_0010129 Ga0501033_0010129_2764_3501 225
312 3300049572 Ga0501036_0024415 Ga0501036_0024415_119_856 225
313 3300049572 Ga0501036_0173581 Ga0501036_0173581_363_1106 225
314 3300049573 Ga0501037_0035884 Ga0501037_0035884_503_1240 225
315 3300049574 Ga0501038_0003005 Ga0501038_0003005_4807_5544 225
316 3300049575 Ga0501039_0023178 Ga0501039_0023178_951_1688 225
317 3300049577 Ga0501041_0012167 Ga0501041_0012167_119_856 225
318 3300049580 Ga0501046_0045549 Ga0501046_0045549_2245_2982 225
319 3300049584 Ga0501068_0014392 Ga0501068_0014392_1004_1741 225
320 3300049585 Ga0501069_0007465 Ga0501069_0007465_1269_2006 225
321 3300049586 Ga0501070_0011785 Ga0501070_0011785_634_1371 225
322 3300049586 Ga0501070_0284936 Ga0501070_0284936_334_1062 225
323 3300049587 Ga0501071_0098250 Ga0501071_0098250_603_1340 225
324 3300049589 Ga0501073_0001742 Ga0501073_0001742_6515_7252 225
325 3300049591 Ga0501075_0060268 Ga0501075_0060268_945_1682 225
326 3300049591 Ga0501075_0119692 Ga0501075_0119692_1036_1764 225
327 3300049592 Ga0501076_0052296 Ga0501076_0052296_2380_3117 225
328 3300049741 Ga0501079_0262353 Ga0501079_0262353_238_954 225
329 3300049741 Ga0501079_0629888 Ga0501079_0629888_39_776 225
330 3300049742 Ga0501080_0007118 Ga0501080_0007118_8498_9235 225
331 3300049742 Ga0501080_0393390 Ga0501080_0393390_179_907 225
332 3300049743 Ga0501081_0097064 Ga0501081_0097064_1143_1871 225
333 3300049822 Ga0501035_0022868 Ga0501035_0022868_1647_2384 225
334 3300049824 Ga0501045_0066299 Ga0501045_0066299_1170_1898 225
335 3300053078 Ga0495612_0001359 Ga0495612_0001359_296_1036 225
336 3300053085 Ga0495619_0308931 Ga0495619_0308931_41_781 225
337 3300053140 Ga0500573_0045604 Ga0500573_0045604_1341_2165 225
338 3300054114 Ga0501084_0320424 Ga0501084_0320424_497_1225 225
339 3300060353 Ga0501082_0008847 Ga0501082_0008847_2245_2982 225
340 3300060353 Ga0501082_0124424 Ga0501082_0124424_1290_2018 225
341 3300061734 Ga0530510_0025812 Ga0530510_0025812_2653_3390 225
342 3300061734 Ga0530510_0329474 Ga0530510_0329474_234_962 225
343 3300035116 Ga0373945_0032032 Ga0373945_0032032_639_1427 226
344 3300005330 Ga0070690_100151133 Ga0070690_1001511332 227
345 3300005334 Ga0068869_100034845 Ga0068869_1000348453 227
346 3300005335 Ga0070666_10018555 Ga0070666_100185552 227
347 3300005336 Ga0070680_100161957 Ga0070680_1001619572 227
348 3300005339 Ga0070660_100087903 Ga0070660_1000879032 227
349 3300005344 Ga0070661_100017561 Ga0070661_1000175613 227
350 3300005347 Ga0070668_100065709 Ga0070668_1000657093 227
351 3300005353 Ga0070669_100184840 Ga0070669_1001848402 227
352 3300005355 Ga0070671_100042441 Ga0070671_1000424412 227
353 3300005356 Ga0070674_100123820 Ga0070674_1001238203 227
354 3300005366 Ga0070659_100037104 Ga0070659_1000371042 227
355 3300005406 Ga0070703_10010562 Ga0070703_100105623 227
356 3300005434 Ga0070709_10373420 Ga0070709_103734201 227
357 3300005435 Ga0070714_100000876 Ga0070714_1000008762 227
358 3300005435 Ga0070714_100272661 Ga0070714_1002726612 227
359 3300005436 Ga0070713_100057368 Ga0070713_1000573682 227
360 3300005436 Ga0070713_100429734 Ga0070713_1004297342 227
361 3300005436 Ga0070713_100488287 Ga0070713_1004882871 227
362 3300005437 Ga0070710_10103645 Ga0070710_101036452 227
363 3300005438 Ga0070701_10062795 Ga0070701_100627952 227
364 3300005439 Ga0070711_100080096 Ga0070711_1000800962 227
365 3300005439 Ga0070711_100118570 Ga0070711_1001185702 227
366 3300005440 Ga0070705_100106474 Ga0070705_1001064742 227
367 3300005445 Ga0070708_100401507 Ga0070708_1004015071 227
368 3300005455 Ga0070663_100010807 Ga0070663_1000108072 227
369 3300005456 Ga0070678_100111779 Ga0070678_1001117793 227
370 3300005467 Ga0070706_100145682 Ga0070706_1001456822 227
371 3300005467 Ga0070706_100164403 Ga0070706_1001644032 227
372 3300005468 Ga0070707_100103569 Ga0070707_1001035692 227
373 3300005471 Ga0070698_100037748 Ga0070698_1000377484 227
374 3300005471 Ga0070698_100256125 Ga0070698_1002561251 227
375 3300005530 Ga0070679_100104663 Ga0070679_1001046633 227
376 3300005535 Ga0070684_100048798 Ga0070684_1000487982 227
377 3300005539 Ga0068853_100228758 Ga0068853_1002287582 227
378 3300005544 Ga0070686_100098508 Ga0070686_1000985082 227
379 3300005545 Ga0070695_100056033 Ga0070695_1000560332 227
380 3300005547 Ga0070693_100079586 Ga0070693_1000795862 227
381 3300005563 Ga0068855_100303616 Ga0068855_1003036162 227
382 3300005564 Ga0070664_100188970 Ga0070664_1001889701 227
383 3300005617 Ga0068859_100089026 Ga0068859_1000890263 227
384 3300005618 Ga0068864_100054091 Ga0068864_1000540912 227
385 3300005718 Ga0068866_10077820 Ga0068866_100778202 227
386 3300005719 Ga0068861_100028719 Ga0068861_1000287193 227
387 3300005834 Ga0068851_10021955 Ga0068851_100219552 227
388 3300005841 Ga0068863_100050102 Ga0068863_1000501023 227
389 3300005842 Ga0068858_100143485 Ga0068858_1001434852 227
390 3300005844 Ga0068862_100042397 Ga0068862_1000423972 227
391 3300005983 Ga0081540_1000769 Ga0081540_100076919 227
392 3300006028 Ga0070717_10041878 Ga0070717_100418782 227
393 3300006028 Ga0070717_10067949 Ga0070717_100679493 227
394 3300006028 Ga0070717_10394771 Ga0070717_103947712 227
395 3300006028 Ga0070717_10441832 Ga0070717_104418322 227
396 3300006175 Ga0070712_100322581 Ga0070712_1003225812 227
397 3300006175 Ga0070712_100473217 Ga0070712_1004732172 227
398 3300006871 Ga0075434_100474985 Ga0075434_1004749852 227
399 3300006871 Ga0075434_100500853 Ga0075434_1005008532 227
400 3300006881 Ga0068865_100101152 Ga0068865_1001011522 227
401 3300006914 Ga0075436_100238231 Ga0075436_1002382312 227
402 3300006931 Ga0097620_100089027 Ga0097620_1000890273 227
403 3300009036 Ga0105244_10069702 Ga0105244_100697022 227
404 3300009101 Ga0105247_10079417 Ga0105247_100794172 227
405 3300009177 Ga0105248_10359409 Ga0105248_103594092 227
406 3300009545 Ga0105237_10261410 Ga0105237_102614102 227
407 3300012490 Ga0157322_1000682 Ga0157322_10006822 227
408 3300014325 Ga0163163_10375230 Ga0163163_103752302 227
409 3300014969 Ga0157376_10136666 Ga0157376_101366662 227
410 3300017792 Ga0163161_10048776 Ga0163161_100487762 227
411 3300020082 Ga0206353_10541231 Ga0206353_105412312 227
412 3300021388 Ga0213875_10000180 Ga0213875_1000018041 227
413 3300025885 Ga0207653_10002079 Ga0207653_100020795 227
414 3300025898 Ga0207692_10037899 Ga0207692_100378992 227
415 3300025898 Ga0207692_10045419 Ga0207692_100454192 227
416 3300025898 Ga0207692_10129278 Ga0207692_101292781 227
417 3300025900 Ga0207710_10046697 Ga0207710_100466971 227
418 3300025905 Ga0207685_10190191 Ga0207685_101901911 227
419 3300025906 Ga0207699_10033398 Ga0207699_100333982 227
420 3300025906 Ga0207699_10047451 Ga0207699_100474511 227
421 3300025906 Ga0207699_10066781 Ga0207699_100667812 227
422 3300025910 Ga0207684_10106339 Ga0207684_101063391 227
423 3300025910 Ga0207684_10223284 Ga0207684_102232842 227
424 3300025912 Ga0207707_10199373 Ga0207707_101993732 227
425 3300025915 Ga0207693_10022351 Ga0207693_100223512 227
426 3300025915 Ga0207693_10244014 Ga0207693_102440142 227
427 3300025916 Ga0207663_10029675 Ga0207663_100296752 227
428 3300025918 Ga0207662_10018371 Ga0207662_100183714 227
429 3300025919 Ga0207657_10002556 Ga0207657_1000255613 227
430 3300025920 Ga0207649_10036392 Ga0207649_100363922 227
431 3300025923 Ga0207681_10166301 Ga0207681_101663012 227
432 3300025925 Ga0207650_10028939 Ga0207650_100289393 227
433 3300025926 Ga0207659_10173776 Ga0207659_101737762 227
434 3300025928 Ga0207700_10007477 Ga0207700_100074773 227
435 3300025928 Ga0207700_10107548 Ga0207700_101075483 227
436 3300025928 Ga0207700_10158358 Ga0207700_101583582 227
437 3300025928 Ga0207700_10871172 Ga0207700_108711721 227
438 3300025929 Ga0207664_10007560 Ga0207664_100075606 227
439 3300025929 Ga0207664_10028105 Ga0207664_100281053 227
440 3300025929 Ga0207664_10031619 Ga0207664_100316192 227
441 3300025929 Ga0207664_10543189 Ga0207664_105431892 227
442 3300025933 Ga0207706_10062137 Ga0207706_100621372 227
443 3300025937 Ga0207669_10059732 Ga0207669_100597322 227
444 3300025939 Ga0207665_10123437 Ga0207665_101234372 227
445 3300025942 Ga0207689_10005327 Ga0207689_100053275 227
446 3300025945 Ga0207679_10091598 Ga0207679_100915983 227
447 3300026067 Ga0207678_10005019 Ga0207678_100050196 227
448 3300026078 Ga0207702_10072917 Ga0207702_100729172 227
449 3300026088 Ga0207641_10557956 Ga0207641_105579562 227
450 3300026089 Ga0207648_10022368 Ga0207648_100223684 227
451 3300026116 Ga0207674_10007623 Ga0207674_100076237 227
452 3300026116 Ga0207674_10633395 Ga0207674_106333952 227
453 3300026118 Ga0207675_100011354 Ga0207675_1000113542 227
454 3300026121 Ga0207683_10003247 Ga0207683_100032476 227
455 3300026142 Ga0207698_10146877 Ga0207698_101468772 227
456 3300028556 Ga0265337_1000156 Ga0265337_100015610 227
457 3300028563 Ga0265319_1008551 Ga0265319_10085512 227
458 3300028573 Ga0265334_10008570 Ga0265334_100085704 227
459 3300028653 Ga0265323_10039397 Ga0265323_100393972 227
460 3300028666 Ga0265336_10075655 Ga0265336_100756552 227
461 3300028800 Ga0265338_10000996 Ga0265338_100009967 227
462 3300029957 Ga0265324_10003273 Ga0265324_100032734 227
463 3300031238 Ga0265332_10005023 Ga0265332_100050234 227
464 3300031240 Ga0265320_10002524 Ga0265320_100025245 227
465 3300031241 Ga0265325_10103641 Ga0265325_101036412 227
466 3300031712 Ga0265342_10007254 Ga0265342_100072544 227
467 3300034817 Ga0373948_0016015 Ga0373948_0016015_30_821 227
468 3300035111 Ga0373923_0036948 Ga0373923_0036948_786_1577 227
469 3300035111 Ga0373923_0091444 Ga0373923_0091444_403_1194 227
470 3300035112 Ga0373932_0011366 Ga0373932_0011366_504_1295 227
471 3300035113 Ga0373936_0009348 Ga0373936_0009348_2078_2869 227
472 3300035116 Ga0373945_0121571 Ga0373945_0121571_198_989 227
473 3300035118 Ga0373954_0051002 Ga0373954_0051002_700_1491 227
474 3300035119 Ga0373956_0014027 Ga0373956_0014027_1853_2644 227
475 3300035120 Ga0373957_0050081 Ga0373957_0050081_525_1316 227
476 3300035171 Ga0373946_0028886 Ga0373946_0028886_1093_1884 227
477 3300035172 Ga0373955_0132200 Ga0373955_0132200_86_880 227
478 3300035410 Ga0373924_0027144 Ga0373924_0027144_1099_1890 227
479 3300035695 Ga0373927_0093123 Ga0373927_0093123_477_1268 227
480 3300035724 Ga0373933_0205982 Ga0373933_0205982_131_925 227
481 3300036401 Ga0373937_0079458 Ga0373937_0079458_275_1069 227
482 3300037853 Ga0436364_0804297 Ga0436364_0804297_35_829 227
483 3300039450 Ga0436363_1021423 Ga0436363_1021423_626_1405 227
484 3300046459 Ga0495629_0350239 Ga0495629_0350239_127_918 227
485 3300046461 Ga0495641_0120520 Ga0495641_0120520_21_812 227
486 3300046462 Ga0495651_0003670 Ga0495651_0003670_6392_7186 227
487 3300046473 Ga0495582_0058786 Ga0495582_0058786_702_1493 227
488 3300046475 Ga0495639_0090310 Ga0495639_0090310_460_1251 227
489 3300046477 Ga0495664_0096713 Ga0495664_0096713_667_1461 227
490 3300046511 Ga0495608_0126268 Ga0495608_0126268_386_1177 227
491 3300046517 Ga0495630_0220634 Ga0495630_0220634_80_871 227
492 3300046529 Ga0495652_0112952 Ga0495652_0112952_1229_2020 227
493 3300046531 Ga0495665_0035736 Ga0495665_0035736_227_1018 227
494 3300046535 Ga0495586_0062286 Ga0495586_0062286_603_1394 227
495 3300046536 Ga0495587_0143033 Ga0495587_0143033_238_1032 227
496 3300046642 Ga0495634_0113034 Ga0495634_0113034_534_1325 227
497 3300046663 Ga0495635_0142254 Ga0495635_0142254_417_1208 227
498 3300046675 Ga0495657_0052560 Ga0495657_0052560_1316_2110 227
499 3300046679 Ga0495623_0058570 Ga0495623_0058570_519_1310 227
500 3300046679 Ga0495623_0171045 Ga0495623_0171045_152_946 227
501 3300046690 Ga0495624_0072602 Ga0495624_0072602_1268_2059 227
502 3300046809 Ga0495600_0335008 Ga0495600_0335008_21_812 227
503 3300047315 Ga0495581_0042772 Ga0495581_0042772_1201_1992 227
504 3300047317 Ga0495604_0056816 Ga0495604_0056816_1715_2506 227
505 3300047322 Ga0495680_0056095 Ga0495680_0056095_1783_2577 227
506 3300047322 Ga0495680_0189864 Ga0495680_0189864_108_899 227
507 3300047471 Ga0495684_0166508 Ga0495684_0166508_271_1062 227
508 3300047673 Ga0495593_0130719 Ga0495593_0130719_403_1194 227
509 3300048088 Ga0495602_0072266 Ga0495602_0072266_1643_2434 227
510 3300048088 Ga0495602_0320687 Ga0495602_0320687_228_1022 227
511 3300048089 Ga0495614_0039688 Ga0495614_0039688_184_975 227
512 3300048910 Ga0496107_0107455 Ga0496107_0107455_490_1281 227
513 3300053084 Ga0495595_0106859 Ga0495595_0106859_179_970 227
514 3300061734 Ga0530510_0013686 Ga0530510_0013686_2600_3349 227
515 3300005327 Ga0070658_10055978 Ga0070658_100559783 228
516 3300005329 Ga0070683_100022020 Ga0070683_1000220203 228
517 3300005336 Ga0070680_100032072 Ga0070680_1000320723 228
518 3300005345 Ga0070692_10115207 Ga0070692_101152071 228
519 3300005435 Ga0070714_100150716 Ga0070714_1001507162 228
520 3300005436 Ga0070713_100162319 Ga0070713_1001623192 228
521 3300005436 Ga0070713_100374945 Ga0070713_1003749452 228
522 3300005530 Ga0070679_100137297 Ga0070679_1001372973 228
523 3300005530 Ga0070679_100274364 Ga0070679_1002743642 228
524 3300005530 Ga0070679_100842605 Ga0070679_1008426051 228
525 3300005548 Ga0070665_100040225 Ga0070665_1000402252 228
526 3300005563 Ga0068855_100002198 Ga0068855_10000219814 228
527 3300005577 Ga0068857_100255375 Ga0068857_1002553752 228
528 3300005577 Ga0068857_100259848 Ga0068857_1002598482 228
529 3300005614 Ga0068856_100371215 Ga0068856_1003712151 228
530 3300005616 Ga0068852_100498034 Ga0068852_1004980342 228
531 3300006844 Ga0075428_100497153 Ga0075428_1004971531 228
532 3300007076 Ga0075435_100117249 Ga0075435_1001172493 228
533 3300013105 Ga0157369_10074902 Ga0157369_100749022 228
534 3300020081 Ga0206354_10199349 Ga0206354_101993492 228
535 3300020082 Ga0206353_10624408 Ga0206353_106244082 228
536 3300020082 Ga0206353_11329215 Ga0206353_113292152 228
537 3300021388 Ga0213875_10006402 Ga0213875_100064022 228
538 3300022467 Ga0224712_10015787 Ga0224712_100157872 228
539 3300025909 Ga0207705_10102847 Ga0207705_101028472 228
540 3300025913 Ga0207695_10569824 Ga0207695_105698241 228
541 3300025917 Ga0207660_10099281 Ga0207660_100992812 228
542 3300025921 Ga0207652_10081806 Ga0207652_100818062 228
543 3300025921 Ga0207652_10405978 Ga0207652_104059782 228
544 3300025928 Ga0207700_10041439 Ga0207700_100414392 228
545 3300025929 Ga0207664_10006557 Ga0207664_100065576 228
546 3300025929 Ga0207664_10132699 Ga0207664_101326992 228
547 3300025944 Ga0207661_10117840 Ga0207661_101178403 228
548 3300025949 Ga0207667_10004482 Ga0207667_1000448210 228
549 3300026067 Ga0207678_10020796 Ga0207678_100207962 228
550 3300026067 Ga0207678_10073596 Ga0207678_100735962 228
551 3300026078 Ga0207702_10277046 Ga0207702_102770462 228
552 3300026116 Ga0207674_10010776 Ga0207674_100107768 228
553 3300026116 Ga0207674_10081071 Ga0207674_100810712 228
554 3300026116 Ga0207674_10351876 Ga0207674_103518762 228
555 3300028379 Ga0268266_10044396 Ga0268266_100443963 228
556 3300033545 Ga0316214_1005208 Ga0316214_10052082 228
557 3300037068 Ga0373925_0000033 Ga0373925_0000033_45237_46022 228
558 3300047447 Ga0495685_063671 Ga0495685_063671_406_1194 228
559 3300003752 Ga0055539_1000392 Ga0055539_100039210 229
560 3300003756 Ga0055533_1000024 Ga0055533_1000024115 229
561 3300003759 Ga0055525_1001464 Ga0055525_10014644 229
562 3300005434 Ga0070709_10003529 Ga0070709_100035294 229
563 3300005436 Ga0070713_100020650 Ga0070713_1000206504 229
564 3300005468 Ga0070707_100074077 Ga0070707_1000740772 229
565 3300006028 Ga0070717_10166280 Ga0070717_101662802 229
566 3300006173 Ga0070716_100063638 Ga0070716_1000636382 229
567 3300025226 Ga0209674_100007 Ga0209674_100007160 229
568 3300025230 Ga0209563_100060 Ga0209563_100060109 229
569 3300025253 Ga0209677_100088 Ga0209677_10008893 229
570 3300025906 Ga0207699_10000158 Ga0207699_1000015817 229
571 3300025922 Ga0207646_10072601 Ga0207646_100726013 229
572 3300025928 Ga0207700_10001842 Ga0207700_100018422 229
573 3300025929 Ga0207664_10012393 Ga0207664_100123932 229
574 3300005435 Ga0070714_100065964 Ga0070714_1000659642 230
575 3300006028 Ga0070717_10067295 Ga0070717_100672952 230
576 3300025250 Ga0209026_1012460 Ga0209026_10124601 230
577 3300025929 Ga0207664_10099500 Ga0207664_100995002 230
578 3300037588 Ga0316581_0072420 Ga0316581_0072420_245_997 230
579 3300042876 Ga0451577_0007523 Ga0451577_0007523_7634_8359 230
580 3300042876 Ga0451577_0053690 Ga0451577_0053690_2091_2855 230
581 3300044656 Ga0466969_0008397 Ga0466969_0008397_4018_4812 230
582 3300044712 Ga0453684_0000744 Ga0453684_0000744_68477_69241 230
583 3300044712 Ga0453684_0002501 Ga0453684_0002501_31323_32069 230
584 3300044712 Ga0453684_0004636 Ga0453684_0004636_26677_27402 230
585 3300044712 Ga0453684_0214514 Ga0453684_0214514_1180_1905 230
586 3300044712 Ga0453684_0225182 Ga0453684_0225182_425_1150 230
587 3300045051 Ga0451576_0489452 Ga0451576_0489452_64_789 230
588 3300046506 Ga0495583_0000200 Ga0495583_0000200_61884_62582 230
589 3300046507 Ga0495606_0001544 Ga0495606_0001544_18911_19609 230
590 3300046660 Ga0495625_0003764 Ga0495625_0003764_10027_10725 230
591 3300046684 Ga0495669_0014203 Ga0495669_0014203_297_995 230
592 3300046694 Ga0495649_0000068 Ga0495649_0000068_66351_67049 230
593 3300046794 Ga0495589_0114553 Ga0495589_0114553_367_1065 230
594 3300002705 JGI25156J39149_1000612 JGI25156J39149_100061210 231
595 3300002738 JGI25154J39366_1001968 JGI25154J39366_10019685 231
596 3300002741 JGI25157J39369_1000312 JGI25157J39369_100031210 231
597 3300003752 Ga0055539_1006949 Ga0055539_10069492 231
598 3300003761 Ga0055535_1000156 Ga0055535_10001567 231
599 3300003763 Ga0055529_1000382 Ga0055529_100038224 231
600 3300005327 Ga0070658_10107053 Ga0070658_101070533 231
601 3300005330 Ga0070690_100029883 Ga0070690_1000298832 231
602 3300005334 Ga0068869_100245611 Ga0068869_1002456111 231
603 3300005364 Ga0070673_100013302 Ga0070673_1000133023 231
604 3300005366 Ga0070659_100472767 Ga0070659_1004727671 231
605 3300005563 Ga0068855_100206229 Ga0068855_1002062292 231
606 3300005577 Ga0068857_100004386 Ga0068857_1000043869 231
607 3300005578 Ga0068854_100001850 Ga0068854_1000018504 231
608 3300005614 Ga0068856_100001613 Ga0068856_10000161314 231
609 3300006353 Ga0075370_10002313 Ga0075370_100023134 231
610 3300009093 Ga0105240_10036971 Ga0105240_100369712 231
611 3300009093 Ga0105240_10204891 Ga0105240_102048912 231
612 3300009093 Ga0105240_10636821 Ga0105240_106368211 231
613 3300009148 Ga0105243_10027867 Ga0105243_100278673 231
614 3300009551 Ga0105238_10053247 Ga0105238_100532472 231
615 3300009551 Ga0105238_10238330 Ga0105238_102383301 231
616 3300010375 Ga0105239_10015868 Ga0105239_100158684 231
617 3300013105 Ga0157369_10016813 Ga0157369_100168134 231
618 3300025231 Ga0207427_100282 Ga0207427_10028231 231
619 3300025242 Ga0209258_100608 Ga0209258_10060820 231
620 3300025242 Ga0209258_101271 Ga0209258_1012719 231
621 3300025246 Ga0209646_1000056 Ga0209646_100005664 231
622 3300025250 Ga0209026_1000009 Ga0209026_1000009264 231
623 3300025253 Ga0209677_100112 Ga0209677_10011261 231
624 3300025256 Ga0209759_1000035 Ga0209759_1000035199 231
625 3300025256 Ga0209759_1001596 Ga0209759_100159611 231
626 3300025272 Ga0209455_1000108 Ga0209455_1000108150 231
627 3300025303 Ga0209051_1013374 Ga0209051_10133743 231
628 3300025909 Ga0207705_10029672 Ga0207705_100296722 231
629 3300025913 Ga0207695_10019920 Ga0207695_100199205 231
630 3300025913 Ga0207695_10071935 Ga0207695_100719353 231
631 3300025935 Ga0207709_10004398 Ga0207709_100043982 231
632 3300025942 Ga0207689_10061084 Ga0207689_100610843 231
633 3300025949 Ga0207667_10025343 Ga0207667_100253435 231
634 3300025960 Ga0207651_10020387 Ga0207651_100203873 231
635 3300025981 Ga0207640_10007857 Ga0207640_100078574 231
636 3300025981 Ga0207640_10232588 Ga0207640_102325881 231
637 3300026078 Ga0207702_10001270 Ga0207702_1000127014 231
638 3300026116 Ga0207674_10004701 Ga0207674_100047018 231
639 3300026118 Ga0207675_100087291 Ga0207675_1000872913 231
640 3300026142 Ga0207698_10291352 Ga0207698_102913522 231
641 3300026142 Ga0207698_10654889 Ga0207698_106548892 231
642 3300028666 Ga0265336_10000039 Ga0265336_1000003945 231
643 3300029957 Ga0265324_10000223 Ga0265324_100002236 231
644 3300031507 Ga0307509_10196248 Ga0307509_101962482 231
645 3300031730 Ga0307516_10001841 Ga0307516_1000184114 231
646 3300037466 Ga0395898_0039736 Ga0395898_0039736_2798_3493 231
647 3300038443 Ga0395901_0082437 Ga0395901_0082437_2308_3003 231
648 3300044656 Ga0466969_0031508 Ga0466969_0031508_34_753 231
649 3300044684 Ga0466966_0001971 Ga0466966_0001971_5976_6695 231
650 3300044693 Ga0466961_0019461 Ga0466961_0019461_2211_2930 231
651 3300044842 Ga0466957_0041014 Ga0466957_0041014_650_1369 231
652 3300045836 Ga0466958_0014412 Ga0466958_0014412_2311_3030 231
653 3300045976 Ga0466967_0841704 Ga0466967_0841704_171_875 231
654 3300046471 Ga0495650_0007772 Ga0495650_0007772_703_1419 231
655 3300046475 Ga0495639_0007408 Ga0495639_0007408_341_1069 231
656 3300046529 Ga0495652_0259229 Ga0495652_0259229_238_966 231
657 3300050496 nmdc:mga07m45_483_c3 nmdc:mga07m45_483_c3_5241_5957 231
658 3300053080 Ga0500635_0001451 Ga0500635_0001451_3843_4559 231
659 3300053136 Ga0500559_0006137 Ga0500559_0006137_2618_3334 231
660 3300061719 Ga0466962_0010285 Ga0466962_0010285_2220_2939 231

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

37

195

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xu1-assembly1.cif.gz_A structure of a non-canonical abc transporter from streptococcus pneumoniae r6 0.9739 3 225
1f3o-assembly1.cif.gz_A-2 crystal structure of mj0796 atp-binding cassette 0.972 6 223
2pcj-assembly1.cif.gz_B crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 0.971 3 224
5xu1-assembly1.cif.gz_B structure of a non-canonical abc transporter from streptococcus pneumoniae r6 0.9646 3 228
5ws4-assembly1.cif.gz_B crystal structure of tripartite-type abc transporter macb from acinetobacter baumannii 0.9637 3 225
ID Description Score Start End Superfamily
af_P75957_1_229_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9762 1 228 3.40.50.300
5xu1A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9739 3 225 3.40.50.300
af_A4I4M8_123_401_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.972 32 224 3.40.50.300
af_P14175_33_289_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9716 25 225 3.40.50.300
af_Q4DP20_46_317_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9693 3 225 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A089I4Y8-F1-model_v4 ABC transporter ATP-binding protein 0.9863 6 225 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A3M1CG20-F1-model_v4 ABC transporter ATP-binding protein 0.9795 6 231 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A5C6DXG8-F1-model_v4 Macrolide export ATP-binding/permease protein MacB (EC 3.6.3.-) 0.9785 2 224 GO:0005524
GO:0016887
AF-A0A6I5GX10-F1-model_v4 Betaine/proline/choline family ABC transporter ATP-binding protein 0.9761 39 225 GO:0005524
GO:0016020
GO:0016887
GO:0031460
AF-A0A2N6MPE8-F1-model_v4 deleted 0.976 6 224

Feature Viewer

pLDDT pTM Quality
93.24 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map