F473322
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 660 | 344 | 658 | 245 |
Family's Representative Sequence
| Representative Sequence | 3300006028|Ga0070717_10067295|Ga0070717_100672952 |
| Length | 275 |
| Sequence | VTQVAAAPAPSSLDVDVVVAESIHKTYRVSRPPREVLRGVSLRVHDGEFVALMGPSGCGKSTLLHILGGLEPADAGTVRIRDTDVYALDDERRSRFRRDHIGFVFQSFNLLPTLTAAENVALPLRLRNSSRLRVRDRISRRAVQDRVAALMDQLNLRGLQGHGPDEISGGEQQRVAIARALAAAPSLLLADEPTGNLDWTTGHDVMNLLARLCRSEHQTTILVTHDARVAAYADRVLVMRDGEIVDSVELARDQAAAGAFPDPAPLIARLSKLEL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2687453743 | Frankia colletiae Cc1.17 | Isolate | Nodule |
| 2 | 2904479285 | Comamonas sediminis 4487 | Isolate | Rhizosphere |
| 3 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 4 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 5 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 6 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 7 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 8 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 9 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 10 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 11 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 47 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 52 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 54 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 55 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 56 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 57 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 58 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 59 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 60 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 61 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 62 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 63 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 64 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 65 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 66 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 70 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 71 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 72 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 73 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 74 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 76 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300012490 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 | Metagenome | Rhizosphere |
| 88 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 99 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 100 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 101 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 102 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 103 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 104 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 109 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 110 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 112 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 163 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 164 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 165 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 166 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 167 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 168 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 169 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 170 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 171 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 172 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 173 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 174 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 175 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 176 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 177 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 178 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 179 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 180 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 181 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 182 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 183 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 184 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 185 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 186 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 187 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 188 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 189 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 190 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 191 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 192 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 193 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 194 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 195 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 196 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 197 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 198 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 199 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 200 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 201 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 202 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 203 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 204 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 205 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 206 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 207 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 208 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 209 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 210 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 211 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 212 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 213 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 214 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 215 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 216 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 217 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 218 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 219 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 220 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 221 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 222 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 223 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 224 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 225 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 226 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 227 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 228 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 229 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 230 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 231 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 232 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 233 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 234 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 235 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 236 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 237 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 238 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 239 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 296 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 297 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 298 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 299 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 300 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 301 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 302 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 303 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 304 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 305 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 306 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 307 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 308 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 333 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 337 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 340 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 341 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 344 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.64 |
| Metatranscriptomes | 1.06 |
| Isolates | 0.3 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.03 |
| Nodule | 0.15 |
| Rhizoplane | 1.97 |
| Rhizosphere | 90.45 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.39 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25156J39149_1000612 | 3300002705 | Bacteria | 19787 |
| 2 | JGI25154J39366_1001968 | 3300002738 | Bacteria | 6045 |
| 3 | JGI25157J39369_1000312 | 3300002741 | Bacteria | 35057 |
| 4 | Ga0055539_1000392 | 3300003752 | Bacteria | 17667 |
| 5 | Ga0055539_1006949 | 3300003752 | Bacteria | 1439 |
| 6 | Ga0055533_1000024 | 3300003756 | Bacteria | 338067 |
| 7 | Ga0055525_1001464 | 3300003759 | Bacteria | 4191 |
| 8 | Ga0055535_1000156 | 3300003761 | Bacteria | 72919 |
| 9 | Ga0055529_1000382 | 3300003763 | Bacteria | 48005 |
| 10 | Ga0070658_10055978 | 3300005327 | Bacteria | 3205 |
| 11 | Ga0070658_10107053 | 3300005327 | Bacteria | 2313 |
| 12 | Ga0070683_100022020 | 3300005329 | Bacteria | 5690 |
| 13 | Ga0070690_100029883 | 3300005330 | Bacteria | 3384 |
| 14 | Ga0070690_100151133 | 3300005330 | Bacteria | 1584 |
| 15 | Ga0068869_100034845 | 3300005334 | Bacteria | 3564 |
| 16 | Ga0068869_100245611 | 3300005334 | Bacteria | 1427 |
| 17 | Ga0070666_10018555 | 3300005335 | Bacteria | 4476 |
| 18 | Ga0070680_100032072 | 3300005336 | Bacteria | 4226 |
| 19 | Ga0070680_100161957 | 3300005336 | Bacteria | 1880 |
| 20 | Ga0070682_100097036 | 3300005337 | Bacteria | 1939 |
| 21 | Ga0070660_100087903 | 3300005339 | Bacteria | 2446 |
| 22 | Ga0070661_100017561 | 3300005344 | Bacteria | 5078 |
| 23 | Ga0070661_100114064 | 3300005344 | Bacteria | 2020 |
| 24 | Ga0070661_100478516 | 3300005344 | Bacteria | 994 |
| 25 | Ga0070692_10115207 | 3300005345 | Bacteria | 1492 |
| 26 | Ga0070692_10191526 | 3300005345 | Bacteria | 1192 |
| 27 | Ga0070668_100065709 | 3300005347 | Bacteria | 2814 |
| 28 | Ga0070669_100184840 | 3300005353 | Bacteria | 1632 |
| 29 | Ga0070671_100042441 | 3300005355 | Bacteria | 3780 |
| 30 | Ga0070674_100123820 | 3300005356 | Bacteria | 1917 |
| 31 | Ga0070673_100013302 | 3300005364 | Bacteria | 5685 |
| 32 | Ga0070659_100037104 | 3300005366 | Bacteria | 3799 |
| 33 | Ga0070659_100415591 | 3300005366 | Bacteria | 1137 |
| 34 | Ga0070659_100472767 | 3300005366 | Bacteria | 1066 |
| 35 | Ga0070703_10010562 | 3300005406 | Bacteria | 2604 |
| 36 | Ga0070709_10003529 | 3300005434 | Bacteria | 8405 |
| 37 | Ga0070709_10373420 | 3300005434 | Bacteria | 1058 |
| 38 | Ga0070714_100000876 | 3300005435 | Bacteria | 21365 |
| 39 | Ga0070714_100001586 | 3300005435 | Bacteria | 16520 |
| 40 | Ga0070714_100065964 | 3300005435 | Bacteria | 3119 |
| 41 | Ga0070714_100150716 | 3300005435 | Bacteria | 2095 |
| 42 | Ga0070714_100272661 | 3300005435 | Bacteria | 1569 |
| 43 | Ga0070714_100482497 | 3300005435 | Bacteria | 1180 |
| 44 | Ga0070713_100006721 | 3300005436 | Bacteria | 8005 |
| 45 | Ga0070713_100020650 | 3300005436 | Bacteria | 5053 |
| 46 | Ga0070713_100057368 | 3300005436 | Bacteria | 3242 |
| 47 | Ga0070713_100162319 | 3300005436 | Bacteria | 1995 |
| 48 | Ga0070713_100325102 | 3300005436 | Bacteria | 1421 |
| 49 | Ga0070713_100374945 | 3300005436 | Bacteria | 1324 |
| 50 | Ga0070713_100429734 | 3300005436 | Bacteria | 1237 |
| 51 | Ga0070713_100488287 | 3300005436 | Bacteria | 1161 |
| 52 | Ga0070710_10103645 | 3300005437 | Bacteria | 1698 |
| 53 | Ga0070701_10062795 | 3300005438 | Bacteria | 1964 |
| 54 | Ga0070711_100080096 | 3300005439 | Bacteria | 2324 |
| 55 | Ga0070711_100118570 | 3300005439 | Bacteria | 1953 |
| 56 | Ga0070705_100106474 | 3300005440 | Bacteria | 1782 |
| 57 | Ga0070708_100005323 | 3300005445 | Bacteria | 10203 |
| 58 | Ga0070708_100007981 | 3300005445 | Bacteria | 8480 |
| 59 | Ga0070708_100033356 | 3300005445 | Bacteria | 4473 |
| 60 | Ga0070708_100401507 | 3300005445 | Bacteria | 1292 |
| 61 | Ga0070663_100010807 | 3300005455 | Bacteria | 5702 |
| 62 | Ga0070663_100382956 | 3300005455 | Bacteria | 1146 |
| 63 | Ga0070678_100111779 | 3300005456 | Bacteria | 2138 |
| 64 | Ga0070685_10311721 | 3300005466 | Bacteria | 1064 |
| 65 | Ga0070706_100145682 | 3300005467 | Bacteria | 2211 |
| 66 | Ga0070706_100162596 | 3300005467 | Bacteria | 2085 |
| 67 | Ga0070706_100164403 | 3300005467 | Bacteria | 2072 |
| 68 | Ga0070707_100023484 | 3300005468 | Bacteria | 5834 |
| 69 | Ga0070707_100074077 | 3300005468 | Bacteria | 3283 |
| 70 | Ga0070707_100103569 | 3300005468 | Bacteria | 2758 |
| 71 | Ga0070698_100012375 | 3300005471 | Bacteria | 9035 |
| 72 | Ga0070698_100028908 | 3300005471 | Bacteria | 5755 |
| 73 | Ga0070698_100037748 | 3300005471 | Bacteria | 4980 |
| 74 | Ga0070698_100065306 | 3300005471 | Bacteria | 3664 |
| 75 | Ga0070698_100256125 | 3300005471 | Bacteria | 1682 |
| 76 | Ga0070699_100002157 | 3300005518 | Bacteria | 17795 |
| 77 | Ga0070679_100104663 | 3300005530 | Bacteria | 2816 |
| 78 | Ga0070679_100137297 | 3300005530 | Bacteria | 2426 |
| 79 | Ga0070679_100197993 | 3300005530 | Bacteria | 1976 |
| 80 | Ga0070679_100274364 | 3300005530 | Bacteria | 1640 |
| 81 | Ga0070679_100842605 | 3300005530 | Bacteria | 860 |
| 82 | Ga0070684_100048798 | 3300005535 | Bacteria | 3673 |
| 83 | Ga0070697_100001147 | 3300005536 | Bacteria | 20063 |
| 84 | Ga0070697_100698357 | 3300005536 | Bacteria | 895 |
| 85 | Ga0068853_100228758 | 3300005539 | Bacteria | 1700 |
| 86 | Ga0070686_100098508 | 3300005544 | Bacteria | 1970 |
| 87 | Ga0070695_100056033 | 3300005545 | Bacteria | 2542 |
| 88 | Ga0070693_100079586 | 3300005547 | Bacteria | 1950 |
| 89 | Ga0070665_100040225 | 3300005548 | Bacteria | 4700 |
| 90 | Ga0070665_100216207 | 3300005548 | Bacteria | 1917 |
| 91 | Ga0068855_100001676 | 3300005563 | Bacteria | 27723 |
| 92 | Ga0068855_100002198 | 3300005563 | Bacteria | 24123 |
| 93 | Ga0068855_100206229 | 3300005563 | Bacteria | 2211 |
| 94 | Ga0068855_100303616 | 3300005563 | Bacteria | 1767 |
| 95 | Ga0070664_100188970 | 3300005564 | Bacteria | 1834 |
| 96 | Ga0068857_100004386 | 3300005577 | Bacteria | 11926 |
| 97 | Ga0068857_100255375 | 3300005577 | Bacteria | 1608 |
| 98 | Ga0068857_100259848 | 3300005577 | Bacteria | 1593 |
| 99 | Ga0068854_100001850 | 3300005578 | Bacteria | 12888 |
| 100 | Ga0068854_100018637 | 3300005578 | Bacteria | 4664 |
| 101 | Ga0068856_100001613 | 3300005614 | Bacteria | 23596 |
| 102 | Ga0068856_100371215 | 3300005614 | Bacteria | 1450 |
| 103 | Ga0068852_100024458 | 3300005616 | Bacteria | 4881 |
| 104 | Ga0068852_100498034 | 3300005616 | Bacteria | 1213 |
| 105 | Ga0068859_100089026 | 3300005617 | Bacteria | 3136 |
| 106 | Ga0068864_100054091 | 3300005618 | Bacteria | 3464 |
| 107 | Ga0068866_10077820 | 3300005718 | Bacteria | 1773 |
| 108 | Ga0068861_100028719 | 3300005719 | Bacteria | 4060 |
| 109 | Ga0068851_10021955 | 3300005834 | Bacteria | 3103 |
| 110 | Ga0068863_100050102 | 3300005841 | Bacteria | 3960 |
| 111 | Ga0068858_100143485 | 3300005842 | Bacteria | 2242 |
| 112 | Ga0068862_100042397 | 3300005844 | Bacteria | 3876 |
| 113 | Ga0081540_1000769 | 3300005983 | Bacteria | 29441 |
| 114 | Ga0070717_10041878 | 3300006028 | Bacteria | 3734 |
| 115 | Ga0070717_10067295 | 3300006028 | Bacteria | 2980 |
| 116 | Ga0070717_10067949 | 3300006028 | Bacteria | 2966 |
| 117 | Ga0070717_10111193 | 3300006028 | Bacteria | 2337 |
| 118 | Ga0070717_10166280 | 3300006028 | Bacteria | 1916 |
| 119 | Ga0070717_10394771 | 3300006028 | Bacteria | 1242 |
| 120 | Ga0070717_10441832 | 3300006028 | Bacteria | 1171 |
| 121 | Ga0070716_100063638 | 3300006173 | Bacteria | 2142 |
| 122 | Ga0070712_100056178 | 3300006175 | Bacteria | 2760 |
| 123 | Ga0070712_100322581 | 3300006175 | Bacteria | 1256 |
| 124 | Ga0070712_100473217 | 3300006175 | Bacteria | 1046 |
| 125 | Ga0070712_100696732 | 3300006175 | Bacteria | 866 |
| 126 | Ga0075370_10002313 | 3300006353 | Bacteria | 8794 |
| 127 | Ga0075428_100497153 | 3300006844 | Bacteria | 1305 |
| 128 | Ga0075434_100474985 | 3300006871 | Bacteria | 1271 |
| 129 | Ga0075434_100500853 | 3300006871 | Bacteria | 1235 |
| 130 | Ga0068865_100101152 | 3300006881 | Bacteria | 2110 |
| 131 | Ga0075436_100238231 | 3300006914 | Bacteria | 1293 |
| 132 | Ga0097620_100089027 | 3300006931 | Bacteria | 3136 |
| 133 | Ga0075435_100117249 | 3300007076 | Bacteria | 2219 |
| 134 | Ga0105244_10069702 | 3300009036 | Bacteria | 1755 |
| 135 | Ga0105240_10036971 | 3300009093 | Bacteria | 6275 |
| 136 | Ga0105240_10204891 | 3300009093 | Bacteria | 2309 |
| 137 | Ga0105240_10274635 | 3300009093 | Bacteria | 1939 |
| 138 | Ga0105240_10636821 | 3300009093 | Bacteria | 1170 |
| 139 | Ga0105247_10079417 | 3300009101 | Bacteria | 2065 |
| 140 | Ga0114129_10989098 | 3300009147 | Bacteria | 1060 |
| 141 | Ga0105243_10027867 | 3300009148 | Bacteria | 4333 |
| 142 | Ga0105243_10717979 | 3300009148 | Bacteria | 976 |
| 143 | Ga0105241_10001456 | 3300009174 | Bacteria | 18150 |
| 144 | Ga0105241_10522641 | 3300009174 | Bacteria | 1061 |
| 145 | Ga0105248_10120406 | 3300009177 | Bacteria | 2961 |
| 146 | Ga0105248_10359409 | 3300009177 | Bacteria | 1639 |
| 147 | Ga0105237_10261410 | 3300009545 | Bacteria | 1733 |
| 148 | Ga0105238_10053247 | 3300009551 | Bacteria | 4067 |
| 149 | Ga0105238_10074576 | 3300009551 | Bacteria | 3385 |
| 150 | Ga0105238_10238330 | 3300009551 | Bacteria | 1796 |
| 151 | Ga0105239_10015868 | 3300010375 | Bacteria | 8337 |
| 152 | Ga0105246_10210491 | 3300011119 | Bacteria | 1517 |
| 153 | Ga0157322_1000682 | 3300012490 | Bacteria | 1400 |
| 154 | Ga0157373_10029187 | 3300013100 | Bacteria | 3975 |
| 155 | Ga0157369_10016813 | 3300013105 | Bacteria | 8222 |
| 156 | Ga0157369_10074902 | 3300013105 | Bacteria | 3630 |
| 157 | Ga0157369_10115783 | 3300013105 | Bacteria | 2847 |
| 158 | Ga0157369_10322720 | 3300013105 | Bacteria | 1605 |
| 159 | Ga0157374_10150884 | 3300013296 | Bacteria | 2260 |
| 160 | Ga0157378_10251152 | 3300013297 | Bacteria | 1693 |
| 161 | Ga0157372_10500938 | 3300013307 | Bacteria | 1416 |
| 162 | Ga0163163_10375230 | 3300014325 | Bacteria | 1479 |
| 163 | Ga0157380_10220040 | 3300014326 | Bacteria | 1698 |
| 164 | Ga0157379_10067463 | 3300014968 | Bacteria | 3197 |
| 165 | Ga0157379_10149443 | 3300014968 | Bacteria | 2107 |
| 166 | Ga0157376_10136666 | 3300014969 | Bacteria | 2194 |
| 167 | Ga0163161_10048776 | 3300017792 | Bacteria | 3058 |
| 168 | Ga0206351_10067632 | 3300020077 | Bacteria | 1220 |
| 169 | Ga0206354_10199349 | 3300020081 | Bacteria | 1124 |
| 170 | Ga0206353_10541231 | 3300020082 | Bacteria | 2196 |
| 171 | Ga0206353_10624408 | 3300020082 | Bacteria | 3865 |
| 172 | Ga0206353_11329215 | 3300020082 | Bacteria | 1540 |
| 173 | Ga0213876_10019401 | 3300021384 | Bacteria | 3592 |
| 174 | Ga0213875_10000180 | 3300021388 | Bacteria | 64310 |
| 175 | Ga0213875_10002224 | 3300021388 | Bacteria | 11796 |
| 176 | Ga0213875_10006402 | 3300021388 | Bacteria | 6186 |
| 177 | Ga0224712_10004037 | 3300022467 | Bacteria | 3909 |
| 178 | Ga0224712_10015787 | 3300022467 | Bacteria | 2465 |
| 179 | Ga0209674_100007 | 3300025226 | Bacteria | 1077082 |
| 180 | Ga0209563_100060 | 3300025230 | Bacteria | 284876 |
| 181 | Ga0207427_100282 | 3300025231 | Bacteria | 37116 |
| 182 | Ga0209258_100608 | 3300025242 | Bacteria | 28992 |
| 183 | Ga0209258_101271 | 3300025242 | Bacteria | 9530 |
| 184 | Ga0209646_1000056 | 3300025246 | Bacteria | 269860 |
| 185 | Ga0209026_1000009 | 3300025250 | Bacteria | 531812 |
| 186 | Ga0209026_1012460 | 3300025250 | Bacteria | 1482 |
| 187 | Ga0209677_100088 | 3300025253 | Bacteria | 108817 |
| 188 | Ga0209677_100112 | 3300025253 | Bacteria | 85460 |
| 189 | Ga0209759_1000035 | 3300025256 | Bacteria | 264254 |
| 190 | Ga0209759_1001596 | 3300025256 | Bacteria | 12277 |
| 191 | Ga0209455_1000108 | 3300025272 | Bacteria | 193021 |
| 192 | Ga0209051_1013374 | 3300025303 | Bacteria | 3911 |
| 193 | Ga0207653_10002079 | 3300025885 | Bacteria | 6375 |
| 194 | Ga0207692_10037899 | 3300025898 | Bacteria | 2361 |
| 195 | Ga0207692_10045419 | 3300025898 | Bacteria | 2197 |
| 196 | Ga0207692_10045671 | 3300025898 | Bacteria | 2192 |
| 197 | Ga0207692_10129278 | 3300025898 | Bacteria | 1424 |
| 198 | Ga0207642_10055496 | 3300025899 | Bacteria | 1812 |
| 199 | Ga0207710_10046697 | 3300025900 | Bacteria | 1934 |
| 200 | Ga0207647_10010385 | 3300025904 | Bacteria | 6576 |
| 201 | Ga0207685_10190191 | 3300025905 | Bacteria | 958 |
| 202 | Ga0207699_10000158 | 3300025906 | Bacteria | 42258 |
| 203 | Ga0207699_10033398 | 3300025906 | Bacteria | 2908 |
| 204 | Ga0207699_10047451 | 3300025906 | Bacteria | 2519 |
| 205 | Ga0207699_10066781 | 3300025906 | Bacteria | 2184 |
| 206 | Ga0207705_10029672 | 3300025909 | Bacteria | 3899 |
| 207 | Ga0207705_10102847 | 3300025909 | Bacteria | 2103 |
| 208 | Ga0207684_10106339 | 3300025910 | Bacteria | 2400 |
| 209 | Ga0207684_10223284 | 3300025910 | Bacteria | 1626 |
| 210 | Ga0207684_10532369 | 3300025910 | Bacteria | 1006 |
| 211 | Ga0207654_10338767 | 3300025911 | Bacteria | 1033 |
| 212 | Ga0207707_10199373 | 3300025912 | Bacteria | 1745 |
| 213 | Ga0207695_10006051 | 3300025913 | Bacteria | 15793 |
| 214 | Ga0207695_10019920 | 3300025913 | Bacteria | 7705 |
| 215 | Ga0207695_10071935 | 3300025913 | Bacteria | 3531 |
| 216 | Ga0207695_10569824 | 3300025913 | Bacteria | 1014 |
| 217 | Ga0207671_10000084 | 3300025914 | Bacteria | 143562 |
| 218 | Ga0207693_10022351 | 3300025915 | Bacteria | 5026 |
| 219 | Ga0207693_10043437 | 3300025915 | Bacteria | 3536 |
| 220 | Ga0207693_10085515 | 3300025915 | Bacteria | 2470 |
| 221 | Ga0207693_10244014 | 3300025915 | Bacteria | 1410 |
| 222 | Ga0207663_10029675 | 3300025916 | Bacteria | 3215 |
| 223 | Ga0207663_10047499 | 3300025916 | Bacteria | 2650 |
| 224 | Ga0207660_10099281 | 3300025917 | Bacteria | 2172 |
| 225 | Ga0207662_10018371 | 3300025918 | Bacteria | 3967 |
| 226 | Ga0207657_10002556 | 3300025919 | Bacteria | 19687 |
| 227 | Ga0207649_10036392 | 3300025920 | Bacteria | 2964 |
| 228 | Ga0207649_10161525 | 3300025920 | Bacteria | 1553 |
| 229 | Ga0207652_10081806 | 3300025921 | Bacteria | 2825 |
| 230 | Ga0207652_10405978 | 3300025921 | Bacteria | 1229 |
| 231 | Ga0207646_10024398 | 3300025922 | Bacteria | 5540 |
| 232 | Ga0207646_10072601 | 3300025922 | Bacteria | 3074 |
| 233 | Ga0207681_10166301 | 3300025923 | Bacteria | 1668 |
| 234 | Ga0207650_10028939 | 3300025925 | Bacteria | 3978 |
| 235 | Ga0207659_10173776 | 3300025926 | Bacteria | 1701 |
| 236 | Ga0207700_10001842 | 3300025928 | Bacteria | 12019 |
| 237 | Ga0207700_10003998 | 3300025928 | Bacteria | 8635 |
| 238 | Ga0207700_10004506 | 3300025928 | Bacteria | 8228 |
| 239 | Ga0207700_10007477 | 3300025928 | Bacteria | 6679 |
| 240 | Ga0207700_10041439 | 3300025928 | Bacteria | 3369 |
| 241 | Ga0207700_10107548 | 3300025928 | Bacteria | 2238 |
| 242 | Ga0207700_10158358 | 3300025928 | Bacteria | 1878 |
| 243 | Ga0207700_10871172 | 3300025928 | Bacteria | 806 |
| 244 | Ga0207664_10006557 | 3300025929 | Bacteria | 8018 |
| 245 | Ga0207664_10007560 | 3300025929 | Bacteria | 7541 |
| 246 | Ga0207664_10012393 | 3300025929 | Bacteria | 6093 |
| 247 | Ga0207664_10019809 | 3300025929 | Bacteria | 4979 |
| 248 | Ga0207664_10028105 | 3300025929 | Bacteria | 4271 |
| 249 | Ga0207664_10031619 | 3300025929 | Bacteria | 4050 |
| 250 | Ga0207664_10099500 | 3300025929 | Bacteria | 2400 |
| 251 | Ga0207664_10132699 | 3300025929 | Bacteria | 2098 |
| 252 | Ga0207664_10294211 | 3300025929 | Bacteria | 1427 |
| 253 | Ga0207664_10543189 | 3300025929 | Bacteria | 1042 |
| 254 | Ga0207706_10062137 | 3300025933 | Bacteria | 3290 |
| 255 | Ga0207709_10004398 | 3300025935 | Bacteria | 8155 |
| 256 | Ga0207669_10059732 | 3300025937 | Bacteria | 2334 |
| 257 | Ga0207665_10123437 | 3300025939 | Bacteria | 1831 |
| 258 | Ga0207711_10076701 | 3300025941 | Bacteria | 2911 |
| 259 | Ga0207689_10005327 | 3300025942 | Bacteria | 11530 |
| 260 | Ga0207689_10061084 | 3300025942 | Bacteria | 3099 |
| 261 | Ga0207661_10117840 | 3300025944 | Bacteria | 2256 |
| 262 | Ga0207679_10091598 | 3300025945 | Bacteria | 2353 |
| 263 | Ga0207667_10004482 | 3300025949 | Bacteria | 17103 |
| 264 | Ga0207667_10025343 | 3300025949 | Bacteria | 6493 |
| 265 | Ga0207667_10080392 | 3300025949 | Bacteria | 3377 |
| 266 | Ga0207651_10020387 | 3300025960 | Bacteria | 4000 |
| 267 | Ga0207640_10007857 | 3300025981 | Bacteria | 5886 |
| 268 | Ga0207640_10184253 | 3300025981 | Bacteria | 1568 |
| 269 | Ga0207640_10232588 | 3300025981 | Bacteria | 1419 |
| 270 | Ga0207678_10005019 | 3300026067 | Bacteria | 11874 |
| 271 | Ga0207678_10020796 | 3300026067 | Bacteria | 5752 |
| 272 | Ga0207678_10028132 | 3300026067 | Bacteria | 4909 |
| 273 | Ga0207678_10073596 | 3300026067 | Bacteria | 2928 |
| 274 | Ga0207678_10302611 | 3300026067 | Bacteria | 1374 |
| 275 | Ga0207702_10001270 | 3300026078 | Bacteria | 25363 |
| 276 | Ga0207702_10072917 | 3300026078 | Bacteria | 2960 |
| 277 | Ga0207702_10246431 | 3300026078 | Bacteria | 1676 |
| 278 | Ga0207702_10277046 | 3300026078 | Bacteria | 1584 |
| 279 | Ga0207641_10557956 | 3300026088 | Bacteria | 1117 |
| 280 | Ga0207648_10022368 | 3300026089 | Bacteria | 5679 |
| 281 | Ga0207676_10169852 | 3300026095 | Bacteria | 1899 |
| 282 | Ga0207674_10004701 | 3300026116 | Bacteria | 16372 |
| 283 | Ga0207674_10007623 | 3300026116 | Bacteria | 12607 |
| 284 | Ga0207674_10010776 | 3300026116 | Bacteria | 10313 |
| 285 | Ga0207674_10081071 | 3300026116 | Bacteria | 3247 |
| 286 | Ga0207674_10351876 | 3300026116 | Bacteria | 1424 |
| 287 | Ga0207674_10377251 | 3300026116 | Bacteria | 1371 |
| 288 | Ga0207674_10633395 | 3300026116 | Bacteria | 1032 |
| 289 | Ga0207675_100011354 | 3300026118 | Bacteria | 8335 |
| 290 | Ga0207675_100087291 | 3300026118 | Bacteria | 2929 |
| 291 | Ga0207683_10003247 | 3300026121 | Bacteria | 14185 |
| 292 | Ga0207683_10344205 | 3300026121 | Bacteria | 1368 |
| 293 | Ga0207698_10146877 | 3300026142 | Bacteria | 2040 |
| 294 | Ga0207698_10291352 | 3300026142 | Bacteria | 1515 |
| 295 | Ga0207698_10444634 | 3300026142 | Bacteria | 1250 |
| 296 | Ga0207698_10654889 | 3300026142 | Bacteria | 1041 |
| 297 | Ga0268266_10044396 | 3300028379 | Bacteria | 3800 |
| 298 | Ga0268266_10095417 | 3300028379 | Bacteria | 2612 |
| 299 | Ga0268265_10102326 | 3300028380 | Bacteria | 2317 |
| 300 | Ga0265337_1000156 | 3300028556 | Bacteria | 34716 |
| 301 | Ga0265337_1000890 | 3300028556 | Bacteria | 15716 |
| 302 | Ga0265326_10002580 | 3300028558 | Bacteria | 6092 |
| 303 | Ga0265319_1005166 | 3300028563 | Bacteria | 6308 |
| 304 | Ga0265319_1008551 | 3300028563 | Bacteria | 4469 |
| 305 | Ga0265334_10001536 | 3300028573 | Bacteria | 11162 |
| 306 | Ga0265334_10008570 | 3300028573 | Bacteria | 4343 |
| 307 | Ga0265318_10026143 | 3300028577 | Bacteria | 2300 |
| 308 | Ga0265323_10004739 | 3300028653 | Bacteria | 5833 |
| 309 | Ga0265323_10039397 | 3300028653 | Bacteria | 1723 |
| 310 | Ga0265322_10020397 | 3300028654 | Bacteria | 1900 |
| 311 | Ga0265336_10000039 | 3300028666 | Bacteria | 149376 |
| 312 | Ga0265336_10003476 | 3300028666 | Bacteria | 6166 |
| 313 | Ga0265336_10075655 | 3300028666 | Bacteria | 1006 |
| 314 | Ga0307515_10164821 | 3300028794 | Bacteria | 2240 |
| 315 | Ga0265338_10000581 | 3300028800 | Bacteria | 64325 |
| 316 | Ga0265338_10000996 | 3300028800 | Bacteria | 47684 |
| 317 | Ga0265338_10003568 | 3300028800 | Bacteria | 21755 |
| 318 | Ga0265324_10000223 | 3300029957 | Bacteria | 43654 |
| 319 | Ga0265324_10003273 | 3300029957 | Bacteria | 7792 |
| 320 | Ga0265324_10005061 | 3300029957 | Bacteria | 5776 |
| 321 | Ga0265332_10005023 | 3300031238 | Bacteria | 6148 |
| 322 | Ga0265332_10005452 | 3300031238 | Bacteria | 5866 |
| 323 | Ga0265320_10002524 | 3300031240 | Bacteria | 12717 |
| 324 | Ga0265320_10006560 | 3300031240 | Bacteria | 7321 |
| 325 | Ga0265325_10009908 | 3300031241 | Bacteria | 5544 |
| 326 | Ga0265325_10103641 | 3300031241 | Bacteria | 1390 |
| 327 | Ga0265339_10057908 | 3300031249 | Bacteria | 2094 |
| 328 | Ga0265331_10051701 | 3300031250 | Bacteria | 1966 |
| 329 | Ga0265316_10017133 | 3300031344 | Bacteria | 6271 |
| 330 | Ga0307509_10004585 | 3300031507 | Bacteria | 19813 |
| 331 | Ga0307509_10196248 | 3300031507 | Bacteria | 1862 |
| 332 | Ga0265314_10007401 | 3300031711 | Bacteria | 9519 |
| 333 | Ga0265342_10007254 | 3300031712 | Bacteria | 8146 |
| 334 | Ga0265342_10015905 | 3300031712 | Bacteria | 4934 |
| 335 | Ga0307516_10001841 | 3300031730 | Bacteria | 29116 |
| 336 | Ga0307406_10044655 | 3300031901 | Bacteria | 2778 |
| 337 | Ga0307409_100123981 | 3300031995 | Bacteria | 2194 |
| 338 | Ga0307409_100254455 | 3300031995 | Bacteria | 1608 |
| 339 | Ga0307409_100357417 | 3300031995 | Bacteria | 1380 |
| 340 | Ga0307416_100261089 | 3300032002 | Bacteria | 1693 |
| 341 | Ga0307416_100774357 | 3300032002 | Bacteria | 1054 |
| 342 | Ga0307414_10550945 | 3300032004 | Bacteria | 1028 |
| 343 | Ga0307415_100333541 | 3300032126 | Bacteria | 1270 |
| 344 | Ga0307415_100744514 | 3300032126 | Bacteria | 889 |
| 345 | Ga0316214_1005208 | 3300033545 | Bacteria | 1696 |
| 346 | Ga0373930_0012475 | 3300034816 | Bacteria | 1551 |
| 347 | Ga0373948_0016015 | 3300034817 | Bacteria | 1382 |
| 348 | Ga0373938_0013493 | 3300034957 | Bacteria | 1551 |
| 349 | Ga0373928_0008832 | 3300035084 | Bacteria | 1962 |
| 350 | Ga0373934_0032823 | 3300035086 | Bacteria | 2037 |
| 351 | Ga0373934_0113999 | 3300035086 | Bacteria | 1097 |
| 352 | Ga0373940_0018304 | 3300035088 | Bacteria | 1756 |
| 353 | Ga0373951_0004542 | 3300035091 | Bacteria | 3289 |
| 354 | Ga0373952_0021663 | 3300035092 | Bacteria | 1358 |
| 355 | Ga0373923_0036948 | 3300035111 | Bacteria | 1996 |
| 356 | Ga0373923_0071137 | 3300035111 | Bacteria | 1494 |
| 357 | Ga0373923_0091444 | 3300035111 | Bacteria | 1331 |
| 358 | Ga0373932_0011366 | 3300035112 | Bacteria | 2174 |
| 359 | Ga0373936_0009348 | 3300035113 | Bacteria | 3694 |
| 360 | Ga0373936_0014586 | 3300035113 | Bacteria | 3007 |
| 361 | Ga0373936_0031908 | 3300035113 | Bacteria | 2082 |
| 362 | Ga0373936_0054683 | 3300035113 | Bacteria | 1620 |
| 363 | Ga0373939_0017948 | 3300035114 | Bacteria | 1887 |
| 364 | Ga0373945_0032032 | 3300035116 | Bacteria | 1861 |
| 365 | Ga0373945_0121571 | 3300035116 | Bacteria | 1038 |
| 366 | Ga0373953_0018744 | 3300035117 | Bacteria | 2565 |
| 367 | Ga0373954_0043482 | 3300035118 | Bacteria | 2095 |
| 368 | Ga0373954_0051002 | 3300035118 | Bacteria | 1942 |
| 369 | Ga0373956_0014027 | 3300035119 | Bacteria | 3342 |
| 370 | Ga0373956_0022915 | 3300035119 | Bacteria | 2676 |
| 371 | Ga0373957_0050081 | 3300035120 | Bacteria | 1595 |
| 372 | Ga0373943_0000118 | 3300035170 | Bacteria | 29527 |
| 373 | Ga0373943_0118116 | 3300035170 | Bacteria | 1407 |
| 374 | Ga0373943_0203576 | 3300035170 | Bacteria | 1096 |
| 375 | Ga0373946_0000064 | 3300035171 | Bacteria | 28039 |
| 376 | Ga0373946_0028886 | 3300035171 | Bacteria | 2202 |
| 377 | Ga0373955_0010519 | 3300035172 | Bacteria | 4373 |
| 378 | Ga0373955_0132200 | 3300035172 | Bacteria | 1457 |
| 379 | Ga0373942_0006369 | 3300035207 | Bacteria | 2725 |
| 380 | Ga0373961_0137319 | 3300035241 | Bacteria | 823 |
| 381 | Ga0373924_0027144 | 3300035410 | Bacteria | 2275 |
| 382 | Ga0373931_0096849 | 3300035691 | Bacteria | 1653 |
| 383 | Ga0373935_0013165 | 3300035692 | Bacteria | 4986 |
| 384 | Ga0373935_0136842 | 3300035692 | Bacteria | 1651 |
| 385 | Ga0373927_0001651 | 3300035695 | Bacteria | 16718 |
| 386 | Ga0373927_0093123 | 3300035695 | Bacteria | 1957 |
| 387 | Ga0373933_0007307 | 3300035724 | Bacteria | 6025 |
| 388 | Ga0373933_0058840 | 3300035724 | Bacteria | 2313 |
| 389 | Ga0373933_0205982 | 3300035724 | Bacteria | 1259 |
| 390 | Ga0373947_0004139 | 3300035725 | Bacteria | 8530 |
| 391 | Ga0373947_0249742 | 3300035725 | Bacteria | 1173 |
| 392 | Ga0373937_0079458 | 3300036401 | Bacteria | 3031 |
| 393 | Ga0373937_0081292 | 3300036401 | Bacteria | 2997 |
| 394 | Ga0373937_0699042 | 3300036401 | Bacteria | 960 |
| 395 | Ga0373937_0799362 | 3300036401 | Bacteria | 891 |
| 396 | Ga0373925_0000033 | 3300037068 | Bacteria | 144636 |
| 397 | Ga0373925_0004725 | 3300037068 | Bacteria | 10268 |
| 398 | Ga0373925_0174475 | 3300037068 | Bacteria | 1698 |
| 399 | Ga0373925_0217651 | 3300037068 | Bacteria | 1523 |
| 400 | Ga0395898_0039736 | 3300037466 | Bacteria | 4655 |
| 401 | Ga0316581_0072420 | 3300037588 | Bacteria | 1059 |
| 402 | Ga0436364_0714989 | 3300037853 | Bacteria | 4672 |
| 403 | Ga0436364_0804297 | 3300037853 | Bacteria | 871 |
| 404 | Ga0436364_0967013 | 3300037853 | Bacteria | 873 |
| 405 | Ga0436364_0999853 | 3300037853 | Bacteria | 64321 |
| 406 | Ga0436364_1201093 | 3300037853 | Bacteria | 6371 |
| 407 | Ga0436364_1280826 | 3300037853 | Bacteria | 93394 |
| 408 | Ga0395901_0082437 | 3300038443 | Bacteria | 3360 |
| 409 | Ga0436365_0254126 | 3300039437 | Bacteria | 67152 |
| 410 | Ga0436365_1711073 | 3300039437 | Bacteria | 1247 |
| 411 | Ga0436361_0671223 | 3300039447 | Bacteria | 1977 |
| 412 | Ga0436363_1021423 | 3300039450 | Bacteria | 1950 |
| 413 | Ga0436363_1147650 | 3300039450 | Bacteria | 684 |
| 414 | Ga0436363_1683620 | 3300039450 | Bacteria | 3638 |
| 415 | Ga0450900_010917 | 3300042136 | Bacteria | 1172 |
| 416 | Ga0451577_0007523 | 3300042876 | Bacteria | 10696 |
| 417 | Ga0451577_0053690 | 3300042876 | Bacteria | 3597 |
| 418 | Ga0466969_0008397 | 3300044656 | Bacteria | 5477 |
| 419 | Ga0466969_0031508 | 3300044656 | Bacteria | 2698 |
| 420 | Ga0453683_0073765 | 3300044673 | Bacteria | 2136 |
| 421 | Ga0466966_0001971 | 3300044684 | Bacteria | 13298 |
| 422 | Ga0466961_0019461 | 3300044693 | Bacteria | 4366 |
| 423 | Ga0466961_0035660 | 3300044693 | Bacteria | 3193 |
| 424 | Ga0466961_0132771 | 3300044693 | Bacteria | 1560 |
| 425 | Ga0453684_0000744 | 3300044712 | Bacteria | 113684 |
| 426 | Ga0453684_0002501 | 3300044712 | Bacteria | 44341 |
| 427 | Ga0453684_0004636 | 3300044712 | Bacteria | 28581 |
| 428 | Ga0453684_0021789 | 3300044712 | Bacteria | 9548 |
| 429 | Ga0453684_0030047 | 3300044712 | Bacteria | 7690 |
| 430 | Ga0453684_0214514 | 3300044712 | Bacteria | 2234 |
| 431 | Ga0453684_0225182 | 3300044712 | Bacteria | 2169 |
| 432 | Ga0466970_0008040 | 3300044765 | Bacteria | 5295 |
| 433 | Ga0466957_0041014 | 3300044842 | Bacteria | 2799 |
| 434 | Ga0466957_0108034 | 3300044842 | Bacteria | 1762 |
| 435 | Ga0466959_0346126 | 3300045049 | Bacteria | 1014 |
| 436 | Ga0466959_0588872 | 3300045049 | Bacteria | 749 |
| 437 | Ga0451576_0015606 | 3300045051 | Bacteria | 8409 |
| 438 | Ga0451576_0489452 | 3300045051 | Bacteria | 1292 |
| 439 | Ga0466958_0014412 | 3300045836 | Bacteria | 4514 |
| 440 | Ga0466958_0384807 | 3300045836 | Bacteria | 905 |
| 441 | Ga0466967_0023662 | 3300045976 | Bacteria | 5038 |
| 442 | Ga0466967_0841704 | 3300045976 | Bacteria | 911 |
| 443 | Ga0495592_0063648 | 3300046454 | Bacteria | 2705 |
| 444 | Ga0495629_0350239 | 3300046459 | Bacteria | 1007 |
| 445 | Ga0495641_0120520 | 3300046461 | Bacteria | 1170 |
| 446 | Ga0495651_0000901 | 3300046462 | Bacteria | 23049 |
| 447 | Ga0495651_0003670 | 3300046462 | Bacteria | 11756 |
| 448 | Ga0495651_0142219 | 3300046462 | Bacteria | 1738 |
| 449 | Ga0495651_0355171 | 3300046462 | Bacteria | 967 |
| 450 | Ga0495653_0045907 | 3300046463 | Bacteria | 3384 |
| 451 | Ga0495653_0053241 | 3300046463 | Bacteria | 3097 |
| 452 | Ga0495653_0385915 | 3300046463 | Bacteria | 893 |
| 453 | Ga0495650_0007772 | 3300046471 | Bacteria | 6380 |
| 454 | Ga0495580_0138599 | 3300046472 | Bacteria | 1687 |
| 455 | Ga0495582_0030507 | 3300046473 | Bacteria | 2960 |
| 456 | Ga0495582_0058786 | 3300046473 | Bacteria | 2120 |
| 457 | Ga0495605_0028762 | 3300046474 | Bacteria | 2867 |
| 458 | Ga0495639_0007408 | 3300046475 | Bacteria | 4713 |
| 459 | Ga0495639_0090310 | 3300046475 | Bacteria | 1436 |
| 460 | Ga0495662_0039050 | 3300046476 | Bacteria | 2293 |
| 461 | Ga0495662_0100385 | 3300046476 | Bacteria | 1416 |
| 462 | Ga0495664_0009856 | 3300046477 | Bacteria | 5356 |
| 463 | Ga0495664_0034763 | 3300046477 | Bacteria | 2965 |
| 464 | Ga0495664_0096713 | 3300046477 | Bacteria | 1777 |
| 465 | Ga0495664_0116181 | 3300046477 | Bacteria | 1617 |
| 466 | Ga0495664_0364245 | 3300046477 | Bacteria | 870 |
| 467 | Ga0495583_0000200 | 3300046506 | Bacteria | 100827 |
| 468 | Ga0495606_0001544 | 3300046507 | Bacteria | 30344 |
| 469 | Ga0495608_0022570 | 3300046511 | Bacteria | 4315 |
| 470 | Ga0495608_0033128 | 3300046511 | Bacteria | 3494 |
| 471 | Ga0495608_0037387 | 3300046511 | Bacteria | 3264 |
| 472 | Ga0495608_0126268 | 3300046511 | Bacteria | 1638 |
| 473 | Ga0495618_0031755 | 3300046514 | Bacteria | 3306 |
| 474 | Ga0495618_0177665 | 3300046514 | Bacteria | 1353 |
| 475 | Ga0495618_0182141 | 3300046514 | Bacteria | 1334 |
| 476 | Ga0495620_0011584 | 3300046515 | Bacteria | 4595 |
| 477 | Ga0495628_0000976 | 3300046516 | Bacteria | 26153 |
| 478 | Ga0495628_0008261 | 3300046516 | Bacteria | 8947 |
| 479 | Ga0495628_0018418 | 3300046516 | Bacteria | 5784 |
| 480 | Ga0495630_0019516 | 3300046517 | Bacteria | 4983 |
| 481 | Ga0495630_0165258 | 3300046517 | Bacteria | 1685 |
| 482 | Ga0495630_0220634 | 3300046517 | Bacteria | 1447 |
| 483 | Ga0495643_0003845 | 3300046522 | Bacteria | 10819 |
| 484 | Ga0495666_0019387 | 3300046526 | Bacteria | 3375 |
| 485 | Ga0495652_0000666 | 3300046529 | Bacteria | 39838 |
| 486 | Ga0495652_0013433 | 3300046529 | Bacteria | 7370 |
| 487 | Ga0495652_0014103 | 3300046529 | Bacteria | 7177 |
| 488 | Ga0495652_0060340 | 3300046529 | Bacteria | 3205 |
| 489 | Ga0495652_0112952 | 3300046529 | Bacteria | 2181 |
| 490 | Ga0495652_0114984 | 3300046529 | Bacteria | 2157 |
| 491 | Ga0495652_0192406 | 3300046529 | Bacteria | 1555 |
| 492 | Ga0495652_0259229 | 3300046529 | Bacteria | 1284 |
| 493 | Ga0495665_0018513 | 3300046531 | Bacteria | 3742 |
| 494 | Ga0495665_0035736 | 3300046531 | Bacteria | 2653 |
| 495 | Ga0495665_0205504 | 3300046531 | Bacteria | 1020 |
| 496 | Ga0495640_0051381 | 3300046533 | Bacteria | 2833 |
| 497 | Ga0495640_0383102 | 3300046533 | Bacteria | 865 |
| 498 | Ga0495586_0012684 | 3300046535 | Bacteria | 4469 |
| 499 | Ga0495586_0062286 | 3300046535 | Bacteria | 2030 |
| 500 | Ga0495587_0024169 | 3300046536 | Bacteria | 3727 |
| 501 | Ga0495587_0090531 | 3300046536 | Bacteria | 1767 |
| 502 | Ga0495587_0143033 | 3300046536 | Bacteria | 1364 |
| 503 | Ga0495587_0382665 | 3300046536 | Bacteria | 782 |
| 504 | Ga0495645_0100735 | 3300046543 | Bacteria | 2054 |
| 505 | Ga0495667_0010392 | 3300046559 | Bacteria | 6299 |
| 506 | Ga0495667_0015143 | 3300046559 | Bacteria | 5206 |
| 507 | Ga0495667_0026147 | 3300046559 | Bacteria | 3932 |
| 508 | Ga0495668_0010852 | 3300046616 | Bacteria | 5486 |
| 509 | Ga0495634_0019234 | 3300046642 | Bacteria | 4854 |
| 510 | Ga0495634_0042598 | 3300046642 | Bacteria | 3079 |
| 511 | Ga0495634_0093116 | 3300046642 | Bacteria | 1954 |
| 512 | Ga0495634_0105737 | 3300046642 | Bacteria | 1814 |
| 513 | Ga0495634_0113034 | 3300046642 | Bacteria | 1744 |
| 514 | Ga0495625_0003764 | 3300046660 | Bacteria | 14726 |
| 515 | Ga0495635_0007797 | 3300046663 | Bacteria | 7475 |
| 516 | Ga0495635_0008189 | 3300046663 | Bacteria | 7301 |
| 517 | Ga0495635_0018839 | 3300046663 | Bacteria | 4817 |
| 518 | Ga0495635_0107822 | 3300046663 | Bacteria | 1902 |
| 519 | Ga0495635_0142254 | 3300046663 | Bacteria | 1633 |
| 520 | Ga0495657_0027021 | 3300046675 | Bacteria | 4056 |
| 521 | Ga0495657_0052560 | 3300046675 | Bacteria | 2730 |
| 522 | Ga0495657_0136401 | 3300046675 | Bacteria | 1532 |
| 523 | Ga0495599_0129050 | 3300046678 | Bacteria | 1570 |
| 524 | Ga0495623_0058570 | 3300046679 | Bacteria | 2421 |
| 525 | Ga0495623_0089415 | 3300046679 | Bacteria | 1893 |
| 526 | Ga0495623_0169363 | 3300046679 | Bacteria | 1277 |
| 527 | Ga0495623_0171045 | 3300046679 | Bacteria | 1269 |
| 528 | Ga0495646_0011146 | 3300046680 | Bacteria | 5709 |
| 529 | Ga0495646_0011654 | 3300046680 | Bacteria | 5587 |
| 530 | Ga0495646_0053566 | 3300046680 | Bacteria | 2432 |
| 531 | Ga0495669_0014203 | 3300046684 | Bacteria | 3405 |
| 532 | Ga0495613_0012221 | 3300046689 | Bacteria | 6380 |
| 533 | Ga0495613_0015907 | 3300046689 | Bacteria | 5601 |
| 534 | Ga0495613_0046753 | 3300046689 | Bacteria | 3199 |
| 535 | Ga0495624_0058759 | 3300046690 | Bacteria | 2414 |
| 536 | Ga0495624_0072602 | 3300046690 | Bacteria | 2140 |
| 537 | Ga0495624_0180882 | 3300046690 | Bacteria | 1285 |
| 538 | Ga0495649_0000068 | 3300046694 | Bacteria | 92317 |
| 539 | Ga0495589_0009718 | 3300046794 | Bacteria | 4997 |
| 540 | Ga0495589_0114553 | 3300046794 | Bacteria | 1300 |
| 541 | Ga0495600_0005924 | 3300046809 | Bacteria | 7395 |
| 542 | Ga0495600_0018011 | 3300046809 | Bacteria | 4497 |
| 543 | Ga0495600_0058358 | 3300046809 | Bacteria | 2521 |
| 544 | Ga0495600_0102771 | 3300046809 | Bacteria | 1862 |
| 545 | Ga0495600_0335008 | 3300046809 | Bacteria | 949 |
| 546 | Ga0495660_0009826 | 3300046810 | Bacteria | 5570 |
| 547 | Ga0495581_0027460 | 3300047315 | Bacteria | 3301 |
| 548 | Ga0495581_0042772 | 3300047315 | Bacteria | 2622 |
| 549 | Ga0495604_0006567 | 3300047317 | Bacteria | 9221 |
| 550 | Ga0495604_0024117 | 3300047317 | Bacteria | 4855 |
| 551 | Ga0495604_0031210 | 3300047317 | Bacteria | 4228 |
| 552 | Ga0495604_0056816 | 3300047317 | Bacteria | 3010 |
| 553 | Ga0495604_0095533 | 3300047317 | Bacteria | 2195 |
| 554 | Ga0495604_0096794 | 3300047317 | Bacteria | 2177 |
| 555 | Ga0495636_0137372 | 3300047318 | Bacteria | 1090 |
| 556 | Ga0495674_0021787 | 3300047319 | Bacteria | 5922 |
| 557 | Ga0495674_0063841 | 3300047319 | Bacteria | 3202 |
| 558 | Ga0495674_0098171 | 3300047319 | Bacteria | 2494 |
| 559 | Ga0495674_0134701 | 3300047319 | Bacteria | 2080 |
| 560 | Ga0495676_0166628 | 3300047321 | Bacteria | 1554 |
| 561 | Ga0495680_0004658 | 3300047322 | Bacteria | 13060 |
| 562 | Ga0495680_0042566 | 3300047322 | Bacteria | 3602 |
| 563 | Ga0495680_0056095 | 3300047322 | Bacteria | 3051 |
| 564 | Ga0495680_0189864 | 3300047322 | Bacteria | 1478 |
| 565 | Ga0495687_025223 | 3300047443 | Bacteria | 2814 |
| 566 | Ga0495675_0159428 | 3300047444 | Bacteria | 1390 |
| 567 | Ga0495675_0311100 | 3300047444 | Bacteria | 933 |
| 568 | Ga0495685_063671 | 3300047447 | Bacteria | 1241 |
| 569 | Ga0495685_084099 | 3300047447 | Bacteria | 1058 |
| 570 | Ga0495684_0003355 | 3300047471 | Bacteria | 12572 |
| 571 | Ga0495684_0166508 | 3300047471 | Bacteria | 1641 |
| 572 | Ga0495593_0007860 | 3300047673 | Bacteria | 6212 |
| 573 | Ga0495593_0115136 | 3300047673 | Bacteria | 1371 |
| 574 | Ga0495593_0130719 | 3300047673 | Bacteria | 1274 |
| 575 | Ga0495602_0071518 | 3300048088 | Bacteria | 2962 |
| 576 | Ga0495602_0072266 | 3300048088 | Bacteria | 2942 |
| 577 | Ga0495602_0197182 | 3300048088 | Bacteria | 1539 |
| 578 | Ga0495602_0320687 | 3300048088 | Bacteria | 1127 |
| 579 | Ga0495614_0039688 | 3300048089 | Bacteria | 2020 |
| 580 | Ga0495614_0051565 | 3300048089 | Bacteria | 1763 |
| 581 | Ga0496101_0104075 | 3300048904 | Bacteria | 2128 |
| 582 | Ga0496102_0313347 | 3300048905 | Bacteria | 1478 |
| 583 | Ga0496104_0155040 | 3300048907 | Bacteria | 2198 |
| 584 | Ga0496106_0058056 | 3300048909 | Bacteria | 2928 |
| 585 | Ga0496107_0107455 | 3300048910 | Bacteria | 2049 |
| 586 | Ga0496108_0201225 | 3300048911 | Bacteria | 1728 |
| 587 | Ga0496108_0299762 | 3300048911 | Bacteria | 1400 |
| 588 | Ga0496109_0061867 | 3300048912 | Bacteria | 3423 |
| 589 | Ga0496110_0084127 | 3300048913 | Bacteria | 2839 |
| 590 | Ga0496111_0021903 | 3300048914 | Bacteria | 4467 |
| 591 | Ga0496112_0699436 | 3300048915 | Bacteria | 941 |
| 592 | Ga0496114_0103689 | 3300048917 | Bacteria | 2431 |
| 593 | Ga0496115_0043395 | 3300048918 | Bacteria | 3586 |
| 594 | Ga0496126_0020870 | 3300048929 | Bacteria | 6412 |
| 595 | Ga0501031_0322954 | 3300049568 | Bacteria | 1000 |
| 596 | Ga0501032_0004860 | 3300049569 | Bacteria | 10063 |
| 597 | Ga0501033_0010129 | 3300049570 | Bacteria | 7235 |
| 598 | Ga0501036_0024415 | 3300049572 | Bacteria | 5095 |
| 599 | Ga0501036_0141781 | 3300049572 | Bacteria | 2028 |
| 600 | Ga0501036_0173581 | 3300049572 | Bacteria | 1816 |
| 601 | Ga0501036_0354639 | 3300049572 | Bacteria | 1225 |
| 602 | Ga0501036_0400470 | 3300049572 | Bacteria | 1145 |
| 603 | Ga0501037_0035884 | 3300049573 | Bacteria | 3653 |
| 604 | Ga0501038_0003005 | 3300049574 | Bacteria | 15719 |
| 605 | Ga0501039_0023178 | 3300049575 | Bacteria | 4763 |
| 606 | Ga0501039_0301207 | 3300049575 | Bacteria | 1260 |
| 607 | Ga0501040_0325912 | 3300049576 | Bacteria | 1099 |
| 608 | Ga0501041_0012167 | 3300049577 | Bacteria | 5095 |
| 609 | Ga0501041_0079287 | 3300049577 | Bacteria | 2021 |
| 610 | Ga0501046_0045549 | 3300049580 | Bacteria | 3484 |
| 611 | Ga0501068_0014392 | 3300049584 | Bacteria | 4521 |
| 612 | Ga0501069_0007465 | 3300049585 | Bacteria | 5740 |
| 613 | Ga0501070_0011785 | 3300049586 | Bacteria | 7384 |
| 614 | Ga0501070_0284936 | 3300049586 | Bacteria | 1348 |
| 615 | Ga0501071_0098250 | 3300049587 | Bacteria | 2156 |
| 616 | Ga0501071_0110644 | 3300049587 | Bacteria | 2030 |
| 617 | Ga0501072_0226375 | 3300049588 | Bacteria | 1490 |
| 618 | Ga0501073_0001742 | 3300049589 | Bacteria | 16172 |
| 619 | Ga0501074_0018468 | 3300049590 | Bacteria | 5065 |
| 620 | Ga0501074_0286963 | 3300049590 | Bacteria | 1170 |
| 621 | Ga0501075_0060268 | 3300049591 | Bacteria | 2859 |
| 622 | Ga0501075_0060913 | 3300049591 | Bacteria | 2843 |
| 623 | Ga0501075_0119692 | 3300049591 | Bacteria | 2003 |
| 624 | Ga0501075_0148509 | 3300049591 | Bacteria | 1787 |
| 625 | Ga0501075_0171171 | 3300049591 | Bacteria | 1657 |
| 626 | Ga0501076_0052296 | 3300049592 | Bacteria | 3235 |
| 627 | Ga0501079_0177200 | 3300049741 | Bacteria | 1663 |
| 628 | Ga0501079_0262353 | 3300049741 | Bacteria | 1350 |
| 629 | Ga0501079_0333290 | 3300049741 | Bacteria | 1188 |
| 630 | Ga0501079_0629888 | 3300049741 | Bacteria | 844 |
| 631 | Ga0501080_0007118 | 3300049742 | Bacteria | 10101 |
| 632 | Ga0501080_0393390 | 3300049742 | Bacteria | 1248 |
| 633 | Ga0501081_0097064 | 3300049743 | Bacteria | 2079 |
| 634 | Ga0501081_0205307 | 3300049743 | Bacteria | 1430 |
| 635 | Ga0501035_0022868 | 3300049822 | Bacteria | 5740 |
| 636 | Ga0501035_0513176 | 3300049822 | Bacteria | 985 |
| 637 | Ga0501045_0060856 | 3300049824 | Bacteria | 2769 |
| 638 | Ga0501045_0066299 | 3300049824 | Bacteria | 2651 |
| 639 | Ga0501045_0277867 | 3300049824 | Bacteria | 1247 |
| 640 | nmdc:mga07m45_483_c3 | 3300050496 | Bacteria | 8601 |
| 641 | nmdc:mga0n895_277458_c1 | 3300050512 | Bacteria | 1700 |
| 642 | Ga0495601_0004806 | 3300053077 | Bacteria | 7831 |
| 643 | Ga0495601_0087589 | 3300053077 | Bacteria | 2002 |
| 644 | Ga0495612_0001359 | 3300053078 | Bacteria | 10074 |
| 645 | Ga0500635_0001451 | 3300053080 | Bacteria | 5702 |
| 646 | Ga0495595_0106859 | 3300053084 | Bacteria | 1354 |
| 647 | Ga0495619_0308931 | 3300053085 | Bacteria | 1095 |
| 648 | Ga0500559_0006137 | 3300053136 | Bacteria | 5439 |
| 649 | Ga0500573_0045604 | 3300053140 | Bacteria | 2527 |
| 650 | Ga0501084_0070438 | 3300054114 | Bacteria | 2928 |
| 651 | Ga0501084_0320424 | 3300054114 | Bacteria | 1309 |
| 652 | Ga0501082_0008847 | 3300060353 | Bacteria | 8685 |
| 653 | Ga0501082_0124424 | 3300060353 | Bacteria | 2236 |
| 654 | Ga0501082_0399574 | 3300060353 | Bacteria | 1199 |
| 655 | Ga0466962_0010285 | 3300061719 | Bacteria | 4493 |
| 656 | Ga0530510_0013686 | 3300061734 | Bacteria | 5710 |
| 657 | Ga0530510_0025812 | 3300061734 | Bacteria | 4203 |
| 658 | Ga0530510_0329474 | 3300061734 | Bacteria | 1145 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013105 | Ga0157369_10115783 | Ga0157369_101157832 | 188 |
| 2 | 3300046462 | Ga0495651_0142219 | Ga0495651_0142219_255_842 | 193 |
| 3 | 3300046477 | Ga0495664_0364245 | Ga0495664_0364245_56_643 | 193 |
| 4 | 3300046514 | Ga0495618_0182141 | Ga0495618_0182141_381_968 | 193 |
| 5 | 3300046516 | Ga0495628_0018418 | Ga0495628_0018418_3095_3682 | 193 |
| 6 | 3300046529 | Ga0495652_0114984 | Ga0495652_0114984_1126_1713 | 193 |
| 7 | 3300046533 | Ga0495640_0383102 | Ga0495640_0383102_144_731 | 193 |
| 8 | 3300046642 | Ga0495634_0042598 | Ga0495634_0042598_1180_1767 | 193 |
| 9 | 3300046663 | Ga0495635_0008189 | Ga0495635_0008189_2936_3523 | 193 |
| 10 | 3300046679 | Ga0495623_0089415 | Ga0495623_0089415_1150_1737 | 193 |
| 11 | 3300046689 | Ga0495613_0046753 | Ga0495613_0046753_487_1074 | 193 |
| 12 | 3300046690 | Ga0495624_0180882 | Ga0495624_0180882_26_613 | 193 |
| 13 | 3300047317 | Ga0495604_0031210 | Ga0495604_0031210_3332_3919 | 193 |
| 14 | 3300047322 | Ga0495680_0042566 | Ga0495680_0042566_2732_3319 | 193 |
| 15 | 3300047673 | Ga0495593_0115136 | Ga0495593_0115136_144_731 | 193 |
| 16 | 3300048089 | Ga0495614_0051565 | Ga0495614_0051565_1127_1714 | 193 |
| 17 | 3300035170 | Ga0373943_0118116 | Ga0373943_0118116_11_649 | 197 |
| 18 | 3300042136 | Ga0450900_010917 | Ga0450900_010917_112_798 | 199 |
| 19 | 3300039450 | Ga0436363_1147650 | Ga0436363_1147650_12_674 | 206 |
| 20 | 3300005468 | Ga0070707_100023484 | Ga0070707_1000234842 | 208 |
| 21 | 3300025922 | Ga0207646_10024398 | Ga0207646_100243982 | 208 |
| 22 | 3300025899 | Ga0207642_10055496 | Ga0207642_100554961 | 211 |
| 23 | 3300049741 | Ga0501079_0333290 | Ga0501079_0333290_522_1166 | 211 |
| 24 | 3300013105 | Ga0157369_10322720 | Ga0157369_103227202 | 216 |
| 25 | 3300014968 | Ga0157379_10149443 | Ga0157379_101494432 | 216 |
| 26 | 3300048911 | Ga0496108_0299762 | Ga0496108_0299762_283_984 | 216 |
| 27 | 3300048929 | Ga0496126_0020870 | Ga0496126_0020870_2215_2916 | 216 |
| 28 | 3300005445 | Ga0070708_100007981 | Ga0070708_1000079816 | 218 |
| 29 | 3300005518 | Ga0070699_100002157 | Ga0070699_10000215711 | 218 |
| 30 | 3300005536 | Ga0070697_100001147 | Ga0070697_1000011477 | 218 |
| 31 | 3300011119 | Ga0105246_10210491 | Ga0105246_102104911 | 218 |
| 32 | 3300013100 | Ga0157373_10029187 | Ga0157373_100291874 | 218 |
| 33 | 3300013297 | Ga0157378_10251152 | Ga0157378_102511522 | 218 |
| 34 | 3300013307 | Ga0157372_10500938 | Ga0157372_105009382 | 218 |
| 35 | 3300014326 | Ga0157380_10220040 | Ga0157380_102200402 | 218 |
| 36 | 3300021388 | Ga0213875_10002224 | Ga0213875_100022247 | 218 |
| 37 | 3300028380 | Ga0268265_10102326 | Ga0268265_101023263 | 218 |
| 38 | 3300034816 | Ga0373930_0012475 | Ga0373930_0012475_282_989 | 218 |
| 39 | 3300034957 | Ga0373938_0013493 | Ga0373938_0013493_565_1272 | 218 |
| 40 | 3300035084 | Ga0373928_0008832 | Ga0373928_0008832_214_921 | 218 |
| 41 | 3300035088 | Ga0373940_0018304 | Ga0373940_0018304_691_1398 | 218 |
| 42 | 3300035091 | Ga0373951_0004542 | Ga0373951_0004542_1292_1999 | 218 |
| 43 | 3300035092 | Ga0373952_0021663 | Ga0373952_0021663_25_732 | 218 |
| 44 | 3300035113 | Ga0373936_0054683 | Ga0373936_0054683_80_787 | 218 |
| 45 | 3300035114 | Ga0373939_0017948 | Ga0373939_0017948_643_1350 | 218 |
| 46 | 3300035170 | Ga0373943_0000118 | Ga0373943_0000118_11233_11940 | 218 |
| 47 | 3300035170 | Ga0373943_0203576 | Ga0373943_0203576_103_810 | 218 |
| 48 | 3300035171 | Ga0373946_0000064 | Ga0373946_0000064_5207_5914 | 218 |
| 49 | 3300035207 | Ga0373942_0006369 | Ga0373942_0006369_342_1049 | 218 |
| 50 | 3300035241 | Ga0373961_0137319 | Ga0373961_0137319_68_775 | 218 |
| 51 | 3300035691 | Ga0373931_0096849 | Ga0373931_0096849_77_784 | 218 |
| 52 | 3300035692 | Ga0373935_0013165 | Ga0373935_0013165_664_1371 | 218 |
| 53 | 3300035725 | Ga0373947_0004139 | Ga0373947_0004139_3488_4195 | 218 |
| 54 | 3300036401 | Ga0373937_0799362 | Ga0373937_0799362_96_803 | 218 |
| 55 | 3300037068 | Ga0373925_0004725 | Ga0373925_0004725_5268_5975 | 218 |
| 56 | 3300037068 | Ga0373925_0174475 | Ga0373925_0174475_907_1614 | 218 |
| 57 | 3300037068 | Ga0373925_0217651 | Ga0373925_0217651_129_836 | 218 |
| 58 | 3300037853 | Ga0436364_0714989 | Ga0436364_0714989_1008_1715 | 218 |
| 59 | 3300037853 | Ga0436364_1201093 | Ga0436364_1201093_687_1394 | 218 |
| 60 | 3300039437 | Ga0436365_1711073 | Ga0436365_1711073_485_1192 | 218 |
| 61 | 3300044712 | Ga0453684_0021789 | Ga0453684_0021789_8601_9293 | 218 |
| 62 | 3300044712 | Ga0453684_0030047 | Ga0453684_0030047_256_948 | 218 |
| 63 | 3300046473 | Ga0495582_0030507 | Ga0495582_0030507_1790_2497 | 218 |
| 64 | 3300046477 | Ga0495664_0116181 | Ga0495664_0116181_341_1048 | 218 |
| 65 | 3300046517 | Ga0495630_0165258 | Ga0495630_0165258_263_970 | 218 |
| 66 | 3300046543 | Ga0495645_0100735 | Ga0495645_0100735_1072_1779 | 218 |
| 67 | 3300046559 | Ga0495667_0010392 | Ga0495667_0010392_5210_5917 | 218 |
| 68 | 3300046690 | Ga0495624_0058759 | Ga0495624_0058759_130_837 | 218 |
| 69 | 3300047319 | Ga0495674_0021787 | Ga0495674_0021787_3750_4457 | 218 |
| 70 | 3300047319 | Ga0495674_0098171 | Ga0495674_0098171_300_1007 | 218 |
| 71 | 3300047471 | Ga0495684_0003355 | Ga0495684_0003355_7877_8584 | 218 |
| 72 | 3300048904 | Ga0496101_0104075 | Ga0496101_0104075_776_1483 | 218 |
| 73 | 3300048905 | Ga0496102_0313347 | Ga0496102_0313347_223_930 | 218 |
| 74 | 3300048907 | Ga0496104_0155040 | Ga0496104_0155040_1202_1909 | 218 |
| 75 | 3300048909 | Ga0496106_0058056 | Ga0496106_0058056_1645_2352 | 218 |
| 76 | 3300048911 | Ga0496108_0201225 | Ga0496108_0201225_500_1207 | 218 |
| 77 | 3300048912 | Ga0496109_0061867 | Ga0496109_0061867_1721_2428 | 218 |
| 78 | 3300048913 | Ga0496110_0084127 | Ga0496110_0084127_1200_1907 | 218 |
| 79 | 3300048914 | Ga0496111_0021903 | Ga0496111_0021903_500_1207 | 218 |
| 80 | 3300048915 | Ga0496112_0699436 | Ga0496112_0699436_73_780 | 218 |
| 81 | 3300048917 | Ga0496114_0103689 | Ga0496114_0103689_646_1353 | 218 |
| 82 | 3300048918 | Ga0496115_0043395 | Ga0496115_0043395_635_1342 | 218 |
| 83 | 3300050512 | nmdc:mga0n895_277458_c1 | nmdc:mga0n895_277458_c1_535_1242 | 218 |
| 84 | 3300035086 | Ga0373934_0032823 | Ga0373934_0032823_380_1090 | 219 |
| 85 | 3300035113 | Ga0373936_0014586 | Ga0373936_0014586_1464_2174 | 219 |
| 86 | 3300035117 | Ga0373953_0018744 | Ga0373953_0018744_433_1143 | 219 |
| 87 | 3300035172 | Ga0373955_0010519 | Ga0373955_0010519_2035_2745 | 219 |
| 88 | 3300035724 | Ga0373933_0007307 | Ga0373933_0007307_1273_1983 | 219 |
| 89 | 3300036401 | Ga0373937_0081292 | Ga0373937_0081292_909_1619 | 219 |
| 90 | 3300046454 | Ga0495592_0063648 | Ga0495592_0063648_810_1520 | 219 |
| 91 | 3300046463 | Ga0495653_0053241 | Ga0495653_0053241_987_1697 | 219 |
| 92 | 3300046511 | Ga0495608_0033128 | Ga0495608_0033128_1534_2244 | 219 |
| 93 | 3300046514 | Ga0495618_0177665 | Ga0495618_0177665_526_1236 | 219 |
| 94 | 3300046529 | Ga0495652_0014103 | Ga0495652_0014103_5190_5900 | 219 |
| 95 | 3300046536 | Ga0495587_0090531 | Ga0495587_0090531_906_1616 | 219 |
| 96 | 3300046559 | Ga0495667_0026147 | Ga0495667_0026147_2417_3127 | 219 |
| 97 | 3300046642 | Ga0495634_0019234 | Ga0495634_0019234_215_925 | 219 |
| 98 | 3300046663 | Ga0495635_0018839 | Ga0495635_0018839_55_765 | 219 |
| 99 | 3300046675 | Ga0495657_0027021 | Ga0495657_0027021_724_1434 | 219 |
| 100 | 3300046679 | Ga0495623_0169363 | Ga0495623_0169363_488_1198 | 219 |
| 101 | 3300046809 | Ga0495600_0018011 | Ga0495600_0018011_2638_3348 | 219 |
| 102 | 3300047317 | Ga0495604_0096794 | Ga0495604_0096794_833_1543 | 219 |
| 103 | 3300047319 | Ga0495674_0134701 | Ga0495674_0134701_1032_1742 | 219 |
| 104 | 3300047322 | Ga0495680_0004658 | Ga0495680_0004658_11517_12227 | 219 |
| 105 | 3300048088 | Ga0495602_0071518 | Ga0495602_0071518_692_1402 | 219 |
| 106 | 3300028556 | Ga0265337_1000890 | Ga0265337_10008902 | 220 |
| 107 | 3300028558 | Ga0265326_10002580 | Ga0265326_100025804 | 220 |
| 108 | 3300028563 | Ga0265319_1005166 | Ga0265319_10051664 | 220 |
| 109 | 3300028573 | Ga0265334_10001536 | Ga0265334_100015363 | 220 |
| 110 | 3300028577 | Ga0265318_10026143 | Ga0265318_100261432 | 220 |
| 111 | 3300028653 | Ga0265323_10004739 | Ga0265323_100047394 | 220 |
| 112 | 3300028654 | Ga0265322_10020397 | Ga0265322_100203972 | 220 |
| 113 | 3300028666 | Ga0265336_10003476 | Ga0265336_100034764 | 220 |
| 114 | 3300028800 | Ga0265338_10003568 | Ga0265338_1000356817 | 220 |
| 115 | 3300029957 | Ga0265324_10005061 | Ga0265324_100050612 | 220 |
| 116 | 3300031238 | Ga0265332_10005452 | Ga0265332_100054524 | 220 |
| 117 | 3300031240 | Ga0265320_10006560 | Ga0265320_100065604 | 220 |
| 118 | 3300031241 | Ga0265325_10009908 | Ga0265325_100099083 | 220 |
| 119 | 3300031249 | Ga0265339_10057908 | Ga0265339_100579082 | 220 |
| 120 | 3300031250 | Ga0265331_10051701 | Ga0265331_100517012 | 220 |
| 121 | 3300031344 | Ga0265316_10017133 | Ga0265316_100171332 | 220 |
| 122 | 3300031711 | Ga0265314_10007401 | Ga0265314_100074015 | 220 |
| 123 | 3300031712 | Ga0265342_10015905 | Ga0265342_100159054 | 220 |
| 124 | 3300049590 | Ga0501074_0018468 | Ga0501074_0018468_3841_4563 | 220 |
| 125 | 3300005337 | Ga0070682_100097036 | Ga0070682_1000970362 | 221 |
| 126 | 3300005344 | Ga0070661_100114064 | Ga0070661_1001140642 | 221 |
| 127 | 3300005435 | Ga0070714_100482497 | Ga0070714_1004824972 | 221 |
| 128 | 3300005436 | Ga0070713_100325102 | Ga0070713_1003251022 | 221 |
| 129 | 3300005455 | Ga0070663_100382956 | Ga0070663_1003829562 | 221 |
| 130 | 3300005466 | Ga0070685_10311721 | Ga0070685_103117212 | 221 |
| 131 | 3300005471 | Ga0070698_100065306 | Ga0070698_1000653061 | 221 |
| 132 | 3300006028 | Ga0070717_10111193 | Ga0070717_101111932 | 221 |
| 133 | 3300006175 | Ga0070712_100056178 | Ga0070712_1000561783 | 221 |
| 134 | 3300009148 | Ga0105243_10717979 | Ga0105243_107179792 | 221 |
| 135 | 3300009174 | Ga0105241_10522641 | Ga0105241_105226412 | 221 |
| 136 | 3300025898 | Ga0207692_10045671 | Ga0207692_100456712 | 221 |
| 137 | 3300025915 | Ga0207693_10043437 | Ga0207693_100434374 | 221 |
| 138 | 3300025915 | Ga0207693_10085515 | Ga0207693_100855153 | 221 |
| 139 | 3300025916 | Ga0207663_10047499 | Ga0207663_100474993 | 221 |
| 140 | 3300025920 | Ga0207649_10161525 | Ga0207649_101615252 | 221 |
| 141 | 3300025928 | Ga0207700_10003998 | Ga0207700_100039982 | 221 |
| 142 | 3300025929 | Ga0207664_10294211 | Ga0207664_102942112 | 221 |
| 143 | 3300026067 | Ga0207678_10302611 | Ga0207678_103026112 | 221 |
| 144 | 3300026095 | Ga0207676_10169852 | Ga0207676_101698521 | 221 |
| 145 | 3300028794 | Ga0307515_10164821 | Ga0307515_101648211 | 221 |
| 146 | 3300031995 | Ga0307409_100123981 | Ga0307409_1001239812 | 221 |
| 147 | 3300032002 | Ga0307416_100261089 | Ga0307416_1002610892 | 221 |
| 148 | 3300032002 | Ga0307416_100774357 | Ga0307416_1007743571 | 221 |
| 149 | 3300032126 | Ga0307415_100333541 | Ga0307415_1003335412 | 221 |
| 150 | 3300032126 | Ga0307415_100744514 | Ga0307415_1007445142 | 221 |
| 151 | 3300035086 | Ga0373934_0113999 | Ga0373934_0113999_235_966 | 221 |
| 152 | 3300035111 | Ga0373923_0071137 | Ga0373923_0071137_209_940 | 221 |
| 153 | 3300035118 | Ga0373954_0043482 | Ga0373954_0043482_138_869 | 221 |
| 154 | 3300035119 | Ga0373956_0022915 | Ga0373956_0022915_1355_2086 | 221 |
| 155 | 3300035692 | Ga0373935_0136842 | Ga0373935_0136842_170_901 | 221 |
| 156 | 3300035724 | Ga0373933_0058840 | Ga0373933_0058840_1232_1963 | 221 |
| 157 | 3300035725 | Ga0373947_0249742 | Ga0373947_0249742_52_783 | 221 |
| 158 | 3300036401 | Ga0373937_0699042 | Ga0373937_0699042_199_930 | 221 |
| 159 | 3300044842 | Ga0466957_0108034 | Ga0466957_0108034_510_1241 | 221 |
| 160 | 3300046463 | Ga0495653_0385915 | Ga0495653_0385915_33_764 | 221 |
| 161 | 3300046476 | Ga0495662_0100385 | Ga0495662_0100385_494_1225 | 221 |
| 162 | 3300046477 | Ga0495664_0034763 | Ga0495664_0034763_2160_2891 | 221 |
| 163 | 3300046511 | Ga0495608_0037387 | Ga0495608_0037387_727_1458 | 221 |
| 164 | 3300046514 | Ga0495618_0031755 | Ga0495618_0031755_201_893 | 221 |
| 165 | 3300046516 | Ga0495628_0008261 | Ga0495628_0008261_3860_4552 | 221 |
| 166 | 3300046529 | Ga0495652_0060340 | Ga0495652_0060340_303_1034 | 221 |
| 167 | 3300046531 | Ga0495665_0205504 | Ga0495665_0205504_106_837 | 221 |
| 168 | 3300046536 | Ga0495587_0024169 | Ga0495587_0024169_2824_3555 | 221 |
| 169 | 3300046642 | Ga0495634_0093116 | Ga0495634_0093116_636_1367 | 221 |
| 170 | 3300046680 | Ga0495646_0053566 | Ga0495646_0053566_51_782 | 221 |
| 171 | 3300047317 | Ga0495604_0095533 | Ga0495604_0095533_1216_1947 | 221 |
| 172 | 3300047321 | Ga0495676_0166628 | Ga0495676_0166628_510_1241 | 221 |
| 173 | 3300047444 | Ga0495675_0159428 | Ga0495675_0159428_235_966 | 221 |
| 174 | 3300053077 | Ga0495601_0004806 | Ga0495601_0004806_1138_1830 | 221 |
| 175 | 3300053077 | Ga0495601_0087589 | Ga0495601_0087589_1124_1855 | 221 |
| 176 | 3300005344 | Ga0070661_100478516 | Ga0070661_1004785162 | 222 |
| 177 | 3300005345 | Ga0070692_10191526 | Ga0070692_101915261 | 222 |
| 178 | 3300005366 | Ga0070659_100415591 | Ga0070659_1004155911 | 222 |
| 179 | 3300005471 | Ga0070698_100028908 | Ga0070698_1000289084 | 222 |
| 180 | 3300005530 | Ga0070679_100197993 | Ga0070679_1001979932 | 222 |
| 181 | 3300037853 | Ga0436364_1280826 | Ga0436364_1280826_87753_88487 | 222 |
| 182 | 3300045049 | Ga0466959_0588872 | Ga0466959_0588872_55_735 | 222 |
| 183 | iso_pu_bacteria | 2904479285 | 2904482916 | 222 |
| 184 | 3300005445 | Ga0070708_100033356 | Ga0070708_1000333562 | 223 |
| 185 | 3300005536 | Ga0070697_100698357 | Ga0070697_1006983571 | 223 |
| 186 | 3300006175 | Ga0070712_100696732 | Ga0070712_1006967322 | 223 |
| 187 | 3300020077 | Ga0206351_10067632 | Ga0206351_100676322 | 223 |
| 188 | 3300021384 | Ga0213876_10019401 | Ga0213876_100194012 | 223 |
| 189 | 3300026116 | Ga0207674_10377251 | Ga0207674_103772512 | 223 |
| 190 | 3300026142 | Ga0207698_10444634 | Ga0207698_104446342 | 223 |
| 191 | 3300039437 | Ga0436365_0254126 | Ga0436365_0254126_3763_4515 | 223 |
| 192 | 3300049572 | Ga0501036_0354639 | Ga0501036_0354639_379_1155 | 223 |
| 193 | 3300049591 | Ga0501075_0148509 | Ga0501075_0148509_647_1423 | 223 |
| 194 | 3300049743 | Ga0501081_0205307 | Ga0501081_0205307_287_1063 | 223 |
| 195 | iso_pu_bacteria | 2687453743 | 2689996102 | 223 |
| 196 | 3300005435 | Ga0070714_100001586 | Ga0070714_1000015865 | 224 |
| 197 | 3300005436 | Ga0070713_100006721 | Ga0070713_1000067213 | 224 |
| 198 | 3300025928 | Ga0207700_10004506 | Ga0207700_100045064 | 224 |
| 199 | 3300025929 | Ga0207664_10019809 | Ga0207664_100198092 | 224 |
| 200 | 3300025941 | Ga0207711_10076701 | Ga0207711_100767012 | 224 |
| 201 | 3300031995 | Ga0307409_100254455 | Ga0307409_1002544552 | 224 |
| 202 | 3300035113 | Ga0373936_0031908 | Ga0373936_0031908_31_756 | 224 |
| 203 | 3300039447 | Ga0436361_0671223 | Ga0436361_0671223_839_1564 | 224 |
| 204 | 3300049572 | Ga0501036_0141781 | Ga0501036_0141781_857_1591 | 224 |
| 205 | 3300049572 | Ga0501036_0400470 | Ga0501036_0400470_257_1000 | 224 |
| 206 | 3300049575 | Ga0501039_0301207 | Ga0501039_0301207_25_759 | 224 |
| 207 | 3300049576 | Ga0501040_0325912 | Ga0501040_0325912_25_759 | 224 |
| 208 | 3300049577 | Ga0501041_0079287 | Ga0501041_0079287_144_878 | 224 |
| 209 | 3300049587 | Ga0501071_0110644 | Ga0501071_0110644_638_1381 | 224 |
| 210 | 3300049588 | Ga0501072_0226375 | Ga0501072_0226375_25_759 | 224 |
| 211 | 3300049590 | Ga0501074_0286963 | Ga0501074_0286963_301_1035 | 224 |
| 212 | 3300049591 | Ga0501075_0060913 | Ga0501075_0060913_1710_2453 | 224 |
| 213 | 3300049591 | Ga0501075_0171171 | Ga0501075_0171171_339_1073 | 224 |
| 214 | 3300049741 | Ga0501079_0177200 | Ga0501079_0177200_867_1601 | 224 |
| 215 | 3300049822 | Ga0501035_0513176 | Ga0501035_0513176_103_837 | 224 |
| 216 | 3300049824 | Ga0501045_0060856 | Ga0501045_0060856_1553_2296 | 224 |
| 217 | 3300049824 | Ga0501045_0277867 | Ga0501045_0277867_390_1124 | 224 |
| 218 | 3300054114 | Ga0501084_0070438 | Ga0501084_0070438_1743_2486 | 224 |
| 219 | 3300060353 | Ga0501082_0399574 | Ga0501082_0399574_383_1126 | 224 |
| 220 | 3300005445 | Ga0070708_100005323 | Ga0070708_1000053233 | 225 |
| 221 | 3300005467 | Ga0070706_100162596 | Ga0070706_1001625961 | 225 |
| 222 | 3300005471 | Ga0070698_100012375 | Ga0070698_1000123756 | 225 |
| 223 | 3300005548 | Ga0070665_100216207 | Ga0070665_1002162072 | 225 |
| 224 | 3300005563 | Ga0068855_100001676 | Ga0068855_10000167610 | 225 |
| 225 | 3300005578 | Ga0068854_100018637 | Ga0068854_1000186373 | 225 |
| 226 | 3300005616 | Ga0068852_100024458 | Ga0068852_1000244582 | 225 |
| 227 | 3300009093 | Ga0105240_10274635 | Ga0105240_102746352 | 225 |
| 228 | 3300009147 | Ga0114129_10989098 | Ga0114129_109890982 | 225 |
| 229 | 3300009174 | Ga0105241_10001456 | Ga0105241_100014569 | 225 |
| 230 | 3300009177 | Ga0105248_10120406 | Ga0105248_101204062 | 225 |
| 231 | 3300009551 | Ga0105238_10074576 | Ga0105238_100745764 | 225 |
| 232 | 3300013296 | Ga0157374_10150884 | Ga0157374_101508845 | 225 |
| 233 | 3300014968 | Ga0157379_10067463 | Ga0157379_100674632 | 225 |
| 234 | 3300022467 | Ga0224712_10004037 | Ga0224712_100040372 | 225 |
| 235 | 3300025904 | Ga0207647_10010385 | Ga0207647_100103853 | 225 |
| 236 | 3300025910 | Ga0207684_10532369 | Ga0207684_105323691 | 225 |
| 237 | 3300025911 | Ga0207654_10338767 | Ga0207654_103387671 | 225 |
| 238 | 3300025913 | Ga0207695_10006051 | Ga0207695_100060514 | 225 |
| 239 | 3300025914 | Ga0207671_10000084 | Ga0207671_1000008473 | 225 |
| 240 | 3300025949 | Ga0207667_10080392 | Ga0207667_100803922 | 225 |
| 241 | 3300025981 | Ga0207640_10184253 | Ga0207640_101842532 | 225 |
| 242 | 3300026067 | Ga0207678_10028132 | Ga0207678_100281322 | 225 |
| 243 | 3300026078 | Ga0207702_10246431 | Ga0207702_102464312 | 225 |
| 244 | 3300026121 | Ga0207683_10344205 | Ga0207683_103442052 | 225 |
| 245 | 3300028379 | Ga0268266_10095417 | Ga0268266_100954173 | 225 |
| 246 | 3300028800 | Ga0265338_10000581 | Ga0265338_1000058120 | 225 |
| 247 | 3300031507 | Ga0307509_10004585 | Ga0307509_100045855 | 225 |
| 248 | 3300031901 | Ga0307406_10044655 | Ga0307406_100446552 | 225 |
| 249 | 3300031995 | Ga0307409_100357417 | Ga0307409_1003574172 | 225 |
| 250 | 3300032004 | Ga0307414_10550945 | Ga0307414_105509452 | 225 |
| 251 | 3300035695 | Ga0373927_0001651 | Ga0373927_0001651_4847_5575 | 225 |
| 252 | 3300037853 | Ga0436364_0967013 | Ga0436364_0967013_60_818 | 225 |
| 253 | 3300037853 | Ga0436364_0999853 | Ga0436364_0999853_40854_41585 | 225 |
| 254 | 3300039450 | Ga0436363_1683620 | Ga0436363_1683620_1017_1772 | 225 |
| 255 | 3300044673 | Ga0453683_0073765 | Ga0453683_0073765_135_875 | 225 |
| 256 | 3300044693 | Ga0466961_0035660 | Ga0466961_0035660_2258_2947 | 225 |
| 257 | 3300044693 | Ga0466961_0132771 | Ga0466961_0132771_459_1145 | 225 |
| 258 | 3300044765 | Ga0466970_0008040 | Ga0466970_0008040_4306_4992 | 225 |
| 259 | 3300045049 | Ga0466959_0346126 | Ga0466959_0346126_103_789 | 225 |
| 260 | 3300045051 | Ga0451576_0015606 | Ga0451576_0015606_1073_1813 | 225 |
| 261 | 3300045836 | Ga0466958_0384807 | Ga0466958_0384807_179_865 | 225 |
| 262 | 3300045976 | Ga0466967_0023662 | Ga0466967_0023662_2859_3587 | 225 |
| 263 | 3300046462 | Ga0495651_0000901 | Ga0495651_0000901_21628_22314 | 225 |
| 264 | 3300046462 | Ga0495651_0355171 | Ga0495651_0355171_255_941 | 225 |
| 265 | 3300046463 | Ga0495653_0045907 | Ga0495653_0045907_2096_2818 | 225 |
| 266 | 3300046472 | Ga0495580_0138599 | Ga0495580_0138599_109_831 | 225 |
| 267 | 3300046474 | Ga0495605_0028762 | Ga0495605_0028762_2090_2812 | 225 |
| 268 | 3300046476 | Ga0495662_0039050 | Ga0495662_0039050_922_1644 | 225 |
| 269 | 3300046477 | Ga0495664_0009856 | Ga0495664_0009856_2905_3627 | 225 |
| 270 | 3300046511 | Ga0495608_0022570 | Ga0495608_0022570_2146_2868 | 225 |
| 271 | 3300046515 | Ga0495620_0011584 | Ga0495620_0011584_3463_4185 | 225 |
| 272 | 3300046516 | Ga0495628_0000976 | Ga0495628_0000976_16817_17503 | 225 |
| 273 | 3300046517 | Ga0495630_0019516 | Ga0495630_0019516_3498_4220 | 225 |
| 274 | 3300046522 | Ga0495643_0003845 | Ga0495643_0003845_7078_7800 | 225 |
| 275 | 3300046526 | Ga0495666_0019387 | Ga0495666_0019387_1602_2324 | 225 |
| 276 | 3300046529 | Ga0495652_0000666 | Ga0495652_0000666_36667_37353 | 225 |
| 277 | 3300046529 | Ga0495652_0013433 | Ga0495652_0013433_2479_3219 | 225 |
| 278 | 3300046529 | Ga0495652_0192406 | Ga0495652_0192406_198_920 | 225 |
| 279 | 3300046531 | Ga0495665_0018513 | Ga0495665_0018513_2779_3501 | 225 |
| 280 | 3300046533 | Ga0495640_0051381 | Ga0495640_0051381_921_1643 | 225 |
| 281 | 3300046535 | Ga0495586_0012684 | Ga0495586_0012684_1000_1722 | 225 |
| 282 | 3300046536 | Ga0495587_0382665 | Ga0495587_0382665_47_769 | 225 |
| 283 | 3300046559 | Ga0495667_0015143 | Ga0495667_0015143_198_920 | 225 |
| 284 | 3300046616 | Ga0495668_0010852 | Ga0495668_0010852_2623_3345 | 225 |
| 285 | 3300046642 | Ga0495634_0105737 | Ga0495634_0105737_951_1673 | 225 |
| 286 | 3300046663 | Ga0495635_0007797 | Ga0495635_0007797_1561_2301 | 225 |
| 287 | 3300046663 | Ga0495635_0107822 | Ga0495635_0107822_545_1267 | 225 |
| 288 | 3300046675 | Ga0495657_0136401 | Ga0495657_0136401_47_769 | 225 |
| 289 | 3300046678 | Ga0495599_0129050 | Ga0495599_0129050_668_1390 | 225 |
| 290 | 3300046680 | Ga0495646_0011146 | Ga0495646_0011146_4709_5449 | 225 |
| 291 | 3300046680 | Ga0495646_0011654 | Ga0495646_0011654_2146_2868 | 225 |
| 292 | 3300046689 | Ga0495613_0012221 | Ga0495613_0012221_2229_2966 | 225 |
| 293 | 3300046689 | Ga0495613_0015907 | Ga0495613_0015907_4691_5413 | 225 |
| 294 | 3300046794 | Ga0495589_0009718 | Ga0495589_0009718_2139_2861 | 225 |
| 295 | 3300046809 | Ga0495600_0005924 | Ga0495600_0005924_672_1358 | 225 |
| 296 | 3300046809 | Ga0495600_0058358 | Ga0495600_0058358_399_1139 | 225 |
| 297 | 3300046809 | Ga0495600_0102771 | Ga0495600_0102771_952_1674 | 225 |
| 298 | 3300046810 | Ga0495660_0009826 | Ga0495660_0009826_854_1576 | 225 |
| 299 | 3300047315 | Ga0495581_0027460 | Ga0495581_0027460_446_1168 | 225 |
| 300 | 3300047317 | Ga0495604_0006567 | Ga0495604_0006567_318_1004 | 225 |
| 301 | 3300047317 | Ga0495604_0024117 | Ga0495604_0024117_3498_4220 | 225 |
| 302 | 3300047318 | Ga0495636_0137372 | Ga0495636_0137372_53_775 | 225 |
| 303 | 3300047319 | Ga0495674_0063841 | Ga0495674_0063841_458_1180 | 225 |
| 304 | 3300047443 | Ga0495687_025223 | Ga0495687_025223_677_1399 | 225 |
| 305 | 3300047444 | Ga0495675_0311100 | Ga0495675_0311100_198_920 | 225 |
| 306 | 3300047447 | Ga0495685_084099 | Ga0495685_084099_305_1027 | 225 |
| 307 | 3300047673 | Ga0495593_0007860 | Ga0495593_0007860_3193_3915 | 225 |
| 308 | 3300048088 | Ga0495602_0197182 | Ga0495602_0197182_746_1486 | 225 |
| 309 | 3300049568 | Ga0501031_0322954 | Ga0501031_0322954_64_801 | 225 |
| 310 | 3300049569 | Ga0501032_0004860 | Ga0501032_0004860_4807_5544 | 225 |
| 311 | 3300049570 | Ga0501033_0010129 | Ga0501033_0010129_2764_3501 | 225 |
| 312 | 3300049572 | Ga0501036_0024415 | Ga0501036_0024415_119_856 | 225 |
| 313 | 3300049572 | Ga0501036_0173581 | Ga0501036_0173581_363_1106 | 225 |
| 314 | 3300049573 | Ga0501037_0035884 | Ga0501037_0035884_503_1240 | 225 |
| 315 | 3300049574 | Ga0501038_0003005 | Ga0501038_0003005_4807_5544 | 225 |
| 316 | 3300049575 | Ga0501039_0023178 | Ga0501039_0023178_951_1688 | 225 |
| 317 | 3300049577 | Ga0501041_0012167 | Ga0501041_0012167_119_856 | 225 |
| 318 | 3300049580 | Ga0501046_0045549 | Ga0501046_0045549_2245_2982 | 225 |
| 319 | 3300049584 | Ga0501068_0014392 | Ga0501068_0014392_1004_1741 | 225 |
| 320 | 3300049585 | Ga0501069_0007465 | Ga0501069_0007465_1269_2006 | 225 |
| 321 | 3300049586 | Ga0501070_0011785 | Ga0501070_0011785_634_1371 | 225 |
| 322 | 3300049586 | Ga0501070_0284936 | Ga0501070_0284936_334_1062 | 225 |
| 323 | 3300049587 | Ga0501071_0098250 | Ga0501071_0098250_603_1340 | 225 |
| 324 | 3300049589 | Ga0501073_0001742 | Ga0501073_0001742_6515_7252 | 225 |
| 325 | 3300049591 | Ga0501075_0060268 | Ga0501075_0060268_945_1682 | 225 |
| 326 | 3300049591 | Ga0501075_0119692 | Ga0501075_0119692_1036_1764 | 225 |
| 327 | 3300049592 | Ga0501076_0052296 | Ga0501076_0052296_2380_3117 | 225 |
| 328 | 3300049741 | Ga0501079_0262353 | Ga0501079_0262353_238_954 | 225 |
| 329 | 3300049741 | Ga0501079_0629888 | Ga0501079_0629888_39_776 | 225 |
| 330 | 3300049742 | Ga0501080_0007118 | Ga0501080_0007118_8498_9235 | 225 |
| 331 | 3300049742 | Ga0501080_0393390 | Ga0501080_0393390_179_907 | 225 |
| 332 | 3300049743 | Ga0501081_0097064 | Ga0501081_0097064_1143_1871 | 225 |
| 333 | 3300049822 | Ga0501035_0022868 | Ga0501035_0022868_1647_2384 | 225 |
| 334 | 3300049824 | Ga0501045_0066299 | Ga0501045_0066299_1170_1898 | 225 |
| 335 | 3300053078 | Ga0495612_0001359 | Ga0495612_0001359_296_1036 | 225 |
| 336 | 3300053085 | Ga0495619_0308931 | Ga0495619_0308931_41_781 | 225 |
| 337 | 3300053140 | Ga0500573_0045604 | Ga0500573_0045604_1341_2165 | 225 |
| 338 | 3300054114 | Ga0501084_0320424 | Ga0501084_0320424_497_1225 | 225 |
| 339 | 3300060353 | Ga0501082_0008847 | Ga0501082_0008847_2245_2982 | 225 |
| 340 | 3300060353 | Ga0501082_0124424 | Ga0501082_0124424_1290_2018 | 225 |
| 341 | 3300061734 | Ga0530510_0025812 | Ga0530510_0025812_2653_3390 | 225 |
| 342 | 3300061734 | Ga0530510_0329474 | Ga0530510_0329474_234_962 | 225 |
| 343 | 3300035116 | Ga0373945_0032032 | Ga0373945_0032032_639_1427 | 226 |
| 344 | 3300005330 | Ga0070690_100151133 | Ga0070690_1001511332 | 227 |
| 345 | 3300005334 | Ga0068869_100034845 | Ga0068869_1000348453 | 227 |
| 346 | 3300005335 | Ga0070666_10018555 | Ga0070666_100185552 | 227 |
| 347 | 3300005336 | Ga0070680_100161957 | Ga0070680_1001619572 | 227 |
| 348 | 3300005339 | Ga0070660_100087903 | Ga0070660_1000879032 | 227 |
| 349 | 3300005344 | Ga0070661_100017561 | Ga0070661_1000175613 | 227 |
| 350 | 3300005347 | Ga0070668_100065709 | Ga0070668_1000657093 | 227 |
| 351 | 3300005353 | Ga0070669_100184840 | Ga0070669_1001848402 | 227 |
| 352 | 3300005355 | Ga0070671_100042441 | Ga0070671_1000424412 | 227 |
| 353 | 3300005356 | Ga0070674_100123820 | Ga0070674_1001238203 | 227 |
| 354 | 3300005366 | Ga0070659_100037104 | Ga0070659_1000371042 | 227 |
| 355 | 3300005406 | Ga0070703_10010562 | Ga0070703_100105623 | 227 |
| 356 | 3300005434 | Ga0070709_10373420 | Ga0070709_103734201 | 227 |
| 357 | 3300005435 | Ga0070714_100000876 | Ga0070714_1000008762 | 227 |
| 358 | 3300005435 | Ga0070714_100272661 | Ga0070714_1002726612 | 227 |
| 359 | 3300005436 | Ga0070713_100057368 | Ga0070713_1000573682 | 227 |
| 360 | 3300005436 | Ga0070713_100429734 | Ga0070713_1004297342 | 227 |
| 361 | 3300005436 | Ga0070713_100488287 | Ga0070713_1004882871 | 227 |
| 362 | 3300005437 | Ga0070710_10103645 | Ga0070710_101036452 | 227 |
| 363 | 3300005438 | Ga0070701_10062795 | Ga0070701_100627952 | 227 |
| 364 | 3300005439 | Ga0070711_100080096 | Ga0070711_1000800962 | 227 |
| 365 | 3300005439 | Ga0070711_100118570 | Ga0070711_1001185702 | 227 |
| 366 | 3300005440 | Ga0070705_100106474 | Ga0070705_1001064742 | 227 |
| 367 | 3300005445 | Ga0070708_100401507 | Ga0070708_1004015071 | 227 |
| 368 | 3300005455 | Ga0070663_100010807 | Ga0070663_1000108072 | 227 |
| 369 | 3300005456 | Ga0070678_100111779 | Ga0070678_1001117793 | 227 |
| 370 | 3300005467 | Ga0070706_100145682 | Ga0070706_1001456822 | 227 |
| 371 | 3300005467 | Ga0070706_100164403 | Ga0070706_1001644032 | 227 |
| 372 | 3300005468 | Ga0070707_100103569 | Ga0070707_1001035692 | 227 |
| 373 | 3300005471 | Ga0070698_100037748 | Ga0070698_1000377484 | 227 |
| 374 | 3300005471 | Ga0070698_100256125 | Ga0070698_1002561251 | 227 |
| 375 | 3300005530 | Ga0070679_100104663 | Ga0070679_1001046633 | 227 |
| 376 | 3300005535 | Ga0070684_100048798 | Ga0070684_1000487982 | 227 |
| 377 | 3300005539 | Ga0068853_100228758 | Ga0068853_1002287582 | 227 |
| 378 | 3300005544 | Ga0070686_100098508 | Ga0070686_1000985082 | 227 |
| 379 | 3300005545 | Ga0070695_100056033 | Ga0070695_1000560332 | 227 |
| 380 | 3300005547 | Ga0070693_100079586 | Ga0070693_1000795862 | 227 |
| 381 | 3300005563 | Ga0068855_100303616 | Ga0068855_1003036162 | 227 |
| 382 | 3300005564 | Ga0070664_100188970 | Ga0070664_1001889701 | 227 |
| 383 | 3300005617 | Ga0068859_100089026 | Ga0068859_1000890263 | 227 |
| 384 | 3300005618 | Ga0068864_100054091 | Ga0068864_1000540912 | 227 |
| 385 | 3300005718 | Ga0068866_10077820 | Ga0068866_100778202 | 227 |
| 386 | 3300005719 | Ga0068861_100028719 | Ga0068861_1000287193 | 227 |
| 387 | 3300005834 | Ga0068851_10021955 | Ga0068851_100219552 | 227 |
| 388 | 3300005841 | Ga0068863_100050102 | Ga0068863_1000501023 | 227 |
| 389 | 3300005842 | Ga0068858_100143485 | Ga0068858_1001434852 | 227 |
| 390 | 3300005844 | Ga0068862_100042397 | Ga0068862_1000423972 | 227 |
| 391 | 3300005983 | Ga0081540_1000769 | Ga0081540_100076919 | 227 |
| 392 | 3300006028 | Ga0070717_10041878 | Ga0070717_100418782 | 227 |
| 393 | 3300006028 | Ga0070717_10067949 | Ga0070717_100679493 | 227 |
| 394 | 3300006028 | Ga0070717_10394771 | Ga0070717_103947712 | 227 |
| 395 | 3300006028 | Ga0070717_10441832 | Ga0070717_104418322 | 227 |
| 396 | 3300006175 | Ga0070712_100322581 | Ga0070712_1003225812 | 227 |
| 397 | 3300006175 | Ga0070712_100473217 | Ga0070712_1004732172 | 227 |
| 398 | 3300006871 | Ga0075434_100474985 | Ga0075434_1004749852 | 227 |
| 399 | 3300006871 | Ga0075434_100500853 | Ga0075434_1005008532 | 227 |
| 400 | 3300006881 | Ga0068865_100101152 | Ga0068865_1001011522 | 227 |
| 401 | 3300006914 | Ga0075436_100238231 | Ga0075436_1002382312 | 227 |
| 402 | 3300006931 | Ga0097620_100089027 | Ga0097620_1000890273 | 227 |
| 403 | 3300009036 | Ga0105244_10069702 | Ga0105244_100697022 | 227 |
| 404 | 3300009101 | Ga0105247_10079417 | Ga0105247_100794172 | 227 |
| 405 | 3300009177 | Ga0105248_10359409 | Ga0105248_103594092 | 227 |
| 406 | 3300009545 | Ga0105237_10261410 | Ga0105237_102614102 | 227 |
| 407 | 3300012490 | Ga0157322_1000682 | Ga0157322_10006822 | 227 |
| 408 | 3300014325 | Ga0163163_10375230 | Ga0163163_103752302 | 227 |
| 409 | 3300014969 | Ga0157376_10136666 | Ga0157376_101366662 | 227 |
| 410 | 3300017792 | Ga0163161_10048776 | Ga0163161_100487762 | 227 |
| 411 | 3300020082 | Ga0206353_10541231 | Ga0206353_105412312 | 227 |
| 412 | 3300021388 | Ga0213875_10000180 | Ga0213875_1000018041 | 227 |
| 413 | 3300025885 | Ga0207653_10002079 | Ga0207653_100020795 | 227 |
| 414 | 3300025898 | Ga0207692_10037899 | Ga0207692_100378992 | 227 |
| 415 | 3300025898 | Ga0207692_10045419 | Ga0207692_100454192 | 227 |
| 416 | 3300025898 | Ga0207692_10129278 | Ga0207692_101292781 | 227 |
| 417 | 3300025900 | Ga0207710_10046697 | Ga0207710_100466971 | 227 |
| 418 | 3300025905 | Ga0207685_10190191 | Ga0207685_101901911 | 227 |
| 419 | 3300025906 | Ga0207699_10033398 | Ga0207699_100333982 | 227 |
| 420 | 3300025906 | Ga0207699_10047451 | Ga0207699_100474511 | 227 |
| 421 | 3300025906 | Ga0207699_10066781 | Ga0207699_100667812 | 227 |
| 422 | 3300025910 | Ga0207684_10106339 | Ga0207684_101063391 | 227 |
| 423 | 3300025910 | Ga0207684_10223284 | Ga0207684_102232842 | 227 |
| 424 | 3300025912 | Ga0207707_10199373 | Ga0207707_101993732 | 227 |
| 425 | 3300025915 | Ga0207693_10022351 | Ga0207693_100223512 | 227 |
| 426 | 3300025915 | Ga0207693_10244014 | Ga0207693_102440142 | 227 |
| 427 | 3300025916 | Ga0207663_10029675 | Ga0207663_100296752 | 227 |
| 428 | 3300025918 | Ga0207662_10018371 | Ga0207662_100183714 | 227 |
| 429 | 3300025919 | Ga0207657_10002556 | Ga0207657_1000255613 | 227 |
| 430 | 3300025920 | Ga0207649_10036392 | Ga0207649_100363922 | 227 |
| 431 | 3300025923 | Ga0207681_10166301 | Ga0207681_101663012 | 227 |
| 432 | 3300025925 | Ga0207650_10028939 | Ga0207650_100289393 | 227 |
| 433 | 3300025926 | Ga0207659_10173776 | Ga0207659_101737762 | 227 |
| 434 | 3300025928 | Ga0207700_10007477 | Ga0207700_100074773 | 227 |
| 435 | 3300025928 | Ga0207700_10107548 | Ga0207700_101075483 | 227 |
| 436 | 3300025928 | Ga0207700_10158358 | Ga0207700_101583582 | 227 |
| 437 | 3300025928 | Ga0207700_10871172 | Ga0207700_108711721 | 227 |
| 438 | 3300025929 | Ga0207664_10007560 | Ga0207664_100075606 | 227 |
| 439 | 3300025929 | Ga0207664_10028105 | Ga0207664_100281053 | 227 |
| 440 | 3300025929 | Ga0207664_10031619 | Ga0207664_100316192 | 227 |
| 441 | 3300025929 | Ga0207664_10543189 | Ga0207664_105431892 | 227 |
| 442 | 3300025933 | Ga0207706_10062137 | Ga0207706_100621372 | 227 |
| 443 | 3300025937 | Ga0207669_10059732 | Ga0207669_100597322 | 227 |
| 444 | 3300025939 | Ga0207665_10123437 | Ga0207665_101234372 | 227 |
| 445 | 3300025942 | Ga0207689_10005327 | Ga0207689_100053275 | 227 |
| 446 | 3300025945 | Ga0207679_10091598 | Ga0207679_100915983 | 227 |
| 447 | 3300026067 | Ga0207678_10005019 | Ga0207678_100050196 | 227 |
| 448 | 3300026078 | Ga0207702_10072917 | Ga0207702_100729172 | 227 |
| 449 | 3300026088 | Ga0207641_10557956 | Ga0207641_105579562 | 227 |
| 450 | 3300026089 | Ga0207648_10022368 | Ga0207648_100223684 | 227 |
| 451 | 3300026116 | Ga0207674_10007623 | Ga0207674_100076237 | 227 |
| 452 | 3300026116 | Ga0207674_10633395 | Ga0207674_106333952 | 227 |
| 453 | 3300026118 | Ga0207675_100011354 | Ga0207675_1000113542 | 227 |
| 454 | 3300026121 | Ga0207683_10003247 | Ga0207683_100032476 | 227 |
| 455 | 3300026142 | Ga0207698_10146877 | Ga0207698_101468772 | 227 |
| 456 | 3300028556 | Ga0265337_1000156 | Ga0265337_100015610 | 227 |
| 457 | 3300028563 | Ga0265319_1008551 | Ga0265319_10085512 | 227 |
| 458 | 3300028573 | Ga0265334_10008570 | Ga0265334_100085704 | 227 |
| 459 | 3300028653 | Ga0265323_10039397 | Ga0265323_100393972 | 227 |
| 460 | 3300028666 | Ga0265336_10075655 | Ga0265336_100756552 | 227 |
| 461 | 3300028800 | Ga0265338_10000996 | Ga0265338_100009967 | 227 |
| 462 | 3300029957 | Ga0265324_10003273 | Ga0265324_100032734 | 227 |
| 463 | 3300031238 | Ga0265332_10005023 | Ga0265332_100050234 | 227 |
| 464 | 3300031240 | Ga0265320_10002524 | Ga0265320_100025245 | 227 |
| 465 | 3300031241 | Ga0265325_10103641 | Ga0265325_101036412 | 227 |
| 466 | 3300031712 | Ga0265342_10007254 | Ga0265342_100072544 | 227 |
| 467 | 3300034817 | Ga0373948_0016015 | Ga0373948_0016015_30_821 | 227 |
| 468 | 3300035111 | Ga0373923_0036948 | Ga0373923_0036948_786_1577 | 227 |
| 469 | 3300035111 | Ga0373923_0091444 | Ga0373923_0091444_403_1194 | 227 |
| 470 | 3300035112 | Ga0373932_0011366 | Ga0373932_0011366_504_1295 | 227 |
| 471 | 3300035113 | Ga0373936_0009348 | Ga0373936_0009348_2078_2869 | 227 |
| 472 | 3300035116 | Ga0373945_0121571 | Ga0373945_0121571_198_989 | 227 |
| 473 | 3300035118 | Ga0373954_0051002 | Ga0373954_0051002_700_1491 | 227 |
| 474 | 3300035119 | Ga0373956_0014027 | Ga0373956_0014027_1853_2644 | 227 |
| 475 | 3300035120 | Ga0373957_0050081 | Ga0373957_0050081_525_1316 | 227 |
| 476 | 3300035171 | Ga0373946_0028886 | Ga0373946_0028886_1093_1884 | 227 |
| 477 | 3300035172 | Ga0373955_0132200 | Ga0373955_0132200_86_880 | 227 |
| 478 | 3300035410 | Ga0373924_0027144 | Ga0373924_0027144_1099_1890 | 227 |
| 479 | 3300035695 | Ga0373927_0093123 | Ga0373927_0093123_477_1268 | 227 |
| 480 | 3300035724 | Ga0373933_0205982 | Ga0373933_0205982_131_925 | 227 |
| 481 | 3300036401 | Ga0373937_0079458 | Ga0373937_0079458_275_1069 | 227 |
| 482 | 3300037853 | Ga0436364_0804297 | Ga0436364_0804297_35_829 | 227 |
| 483 | 3300039450 | Ga0436363_1021423 | Ga0436363_1021423_626_1405 | 227 |
| 484 | 3300046459 | Ga0495629_0350239 | Ga0495629_0350239_127_918 | 227 |
| 485 | 3300046461 | Ga0495641_0120520 | Ga0495641_0120520_21_812 | 227 |
| 486 | 3300046462 | Ga0495651_0003670 | Ga0495651_0003670_6392_7186 | 227 |
| 487 | 3300046473 | Ga0495582_0058786 | Ga0495582_0058786_702_1493 | 227 |
| 488 | 3300046475 | Ga0495639_0090310 | Ga0495639_0090310_460_1251 | 227 |
| 489 | 3300046477 | Ga0495664_0096713 | Ga0495664_0096713_667_1461 | 227 |
| 490 | 3300046511 | Ga0495608_0126268 | Ga0495608_0126268_386_1177 | 227 |
| 491 | 3300046517 | Ga0495630_0220634 | Ga0495630_0220634_80_871 | 227 |
| 492 | 3300046529 | Ga0495652_0112952 | Ga0495652_0112952_1229_2020 | 227 |
| 493 | 3300046531 | Ga0495665_0035736 | Ga0495665_0035736_227_1018 | 227 |
| 494 | 3300046535 | Ga0495586_0062286 | Ga0495586_0062286_603_1394 | 227 |
| 495 | 3300046536 | Ga0495587_0143033 | Ga0495587_0143033_238_1032 | 227 |
| 496 | 3300046642 | Ga0495634_0113034 | Ga0495634_0113034_534_1325 | 227 |
| 497 | 3300046663 | Ga0495635_0142254 | Ga0495635_0142254_417_1208 | 227 |
| 498 | 3300046675 | Ga0495657_0052560 | Ga0495657_0052560_1316_2110 | 227 |
| 499 | 3300046679 | Ga0495623_0058570 | Ga0495623_0058570_519_1310 | 227 |
| 500 | 3300046679 | Ga0495623_0171045 | Ga0495623_0171045_152_946 | 227 |
| 501 | 3300046690 | Ga0495624_0072602 | Ga0495624_0072602_1268_2059 | 227 |
| 502 | 3300046809 | Ga0495600_0335008 | Ga0495600_0335008_21_812 | 227 |
| 503 | 3300047315 | Ga0495581_0042772 | Ga0495581_0042772_1201_1992 | 227 |
| 504 | 3300047317 | Ga0495604_0056816 | Ga0495604_0056816_1715_2506 | 227 |
| 505 | 3300047322 | Ga0495680_0056095 | Ga0495680_0056095_1783_2577 | 227 |
| 506 | 3300047322 | Ga0495680_0189864 | Ga0495680_0189864_108_899 | 227 |
| 507 | 3300047471 | Ga0495684_0166508 | Ga0495684_0166508_271_1062 | 227 |
| 508 | 3300047673 | Ga0495593_0130719 | Ga0495593_0130719_403_1194 | 227 |
| 509 | 3300048088 | Ga0495602_0072266 | Ga0495602_0072266_1643_2434 | 227 |
| 510 | 3300048088 | Ga0495602_0320687 | Ga0495602_0320687_228_1022 | 227 |
| 511 | 3300048089 | Ga0495614_0039688 | Ga0495614_0039688_184_975 | 227 |
| 512 | 3300048910 | Ga0496107_0107455 | Ga0496107_0107455_490_1281 | 227 |
| 513 | 3300053084 | Ga0495595_0106859 | Ga0495595_0106859_179_970 | 227 |
| 514 | 3300061734 | Ga0530510_0013686 | Ga0530510_0013686_2600_3349 | 227 |
| 515 | 3300005327 | Ga0070658_10055978 | Ga0070658_100559783 | 228 |
| 516 | 3300005329 | Ga0070683_100022020 | Ga0070683_1000220203 | 228 |
| 517 | 3300005336 | Ga0070680_100032072 | Ga0070680_1000320723 | 228 |
| 518 | 3300005345 | Ga0070692_10115207 | Ga0070692_101152071 | 228 |
| 519 | 3300005435 | Ga0070714_100150716 | Ga0070714_1001507162 | 228 |
| 520 | 3300005436 | Ga0070713_100162319 | Ga0070713_1001623192 | 228 |
| 521 | 3300005436 | Ga0070713_100374945 | Ga0070713_1003749452 | 228 |
| 522 | 3300005530 | Ga0070679_100137297 | Ga0070679_1001372973 | 228 |
| 523 | 3300005530 | Ga0070679_100274364 | Ga0070679_1002743642 | 228 |
| 524 | 3300005530 | Ga0070679_100842605 | Ga0070679_1008426051 | 228 |
| 525 | 3300005548 | Ga0070665_100040225 | Ga0070665_1000402252 | 228 |
| 526 | 3300005563 | Ga0068855_100002198 | Ga0068855_10000219814 | 228 |
| 527 | 3300005577 | Ga0068857_100255375 | Ga0068857_1002553752 | 228 |
| 528 | 3300005577 | Ga0068857_100259848 | Ga0068857_1002598482 | 228 |
| 529 | 3300005614 | Ga0068856_100371215 | Ga0068856_1003712151 | 228 |
| 530 | 3300005616 | Ga0068852_100498034 | Ga0068852_1004980342 | 228 |
| 531 | 3300006844 | Ga0075428_100497153 | Ga0075428_1004971531 | 228 |
| 532 | 3300007076 | Ga0075435_100117249 | Ga0075435_1001172493 | 228 |
| 533 | 3300013105 | Ga0157369_10074902 | Ga0157369_100749022 | 228 |
| 534 | 3300020081 | Ga0206354_10199349 | Ga0206354_101993492 | 228 |
| 535 | 3300020082 | Ga0206353_10624408 | Ga0206353_106244082 | 228 |
| 536 | 3300020082 | Ga0206353_11329215 | Ga0206353_113292152 | 228 |
| 537 | 3300021388 | Ga0213875_10006402 | Ga0213875_100064022 | 228 |
| 538 | 3300022467 | Ga0224712_10015787 | Ga0224712_100157872 | 228 |
| 539 | 3300025909 | Ga0207705_10102847 | Ga0207705_101028472 | 228 |
| 540 | 3300025913 | Ga0207695_10569824 | Ga0207695_105698241 | 228 |
| 541 | 3300025917 | Ga0207660_10099281 | Ga0207660_100992812 | 228 |
| 542 | 3300025921 | Ga0207652_10081806 | Ga0207652_100818062 | 228 |
| 543 | 3300025921 | Ga0207652_10405978 | Ga0207652_104059782 | 228 |
| 544 | 3300025928 | Ga0207700_10041439 | Ga0207700_100414392 | 228 |
| 545 | 3300025929 | Ga0207664_10006557 | Ga0207664_100065576 | 228 |
| 546 | 3300025929 | Ga0207664_10132699 | Ga0207664_101326992 | 228 |
| 547 | 3300025944 | Ga0207661_10117840 | Ga0207661_101178403 | 228 |
| 548 | 3300025949 | Ga0207667_10004482 | Ga0207667_1000448210 | 228 |
| 549 | 3300026067 | Ga0207678_10020796 | Ga0207678_100207962 | 228 |
| 550 | 3300026067 | Ga0207678_10073596 | Ga0207678_100735962 | 228 |
| 551 | 3300026078 | Ga0207702_10277046 | Ga0207702_102770462 | 228 |
| 552 | 3300026116 | Ga0207674_10010776 | Ga0207674_100107768 | 228 |
| 553 | 3300026116 | Ga0207674_10081071 | Ga0207674_100810712 | 228 |
| 554 | 3300026116 | Ga0207674_10351876 | Ga0207674_103518762 | 228 |
| 555 | 3300028379 | Ga0268266_10044396 | Ga0268266_100443963 | 228 |
| 556 | 3300033545 | Ga0316214_1005208 | Ga0316214_10052082 | 228 |
| 557 | 3300037068 | Ga0373925_0000033 | Ga0373925_0000033_45237_46022 | 228 |
| 558 | 3300047447 | Ga0495685_063671 | Ga0495685_063671_406_1194 | 228 |
| 559 | 3300003752 | Ga0055539_1000392 | Ga0055539_100039210 | 229 |
| 560 | 3300003756 | Ga0055533_1000024 | Ga0055533_1000024115 | 229 |
| 561 | 3300003759 | Ga0055525_1001464 | Ga0055525_10014644 | 229 |
| 562 | 3300005434 | Ga0070709_10003529 | Ga0070709_100035294 | 229 |
| 563 | 3300005436 | Ga0070713_100020650 | Ga0070713_1000206504 | 229 |
| 564 | 3300005468 | Ga0070707_100074077 | Ga0070707_1000740772 | 229 |
| 565 | 3300006028 | Ga0070717_10166280 | Ga0070717_101662802 | 229 |
| 566 | 3300006173 | Ga0070716_100063638 | Ga0070716_1000636382 | 229 |
| 567 | 3300025226 | Ga0209674_100007 | Ga0209674_100007160 | 229 |
| 568 | 3300025230 | Ga0209563_100060 | Ga0209563_100060109 | 229 |
| 569 | 3300025253 | Ga0209677_100088 | Ga0209677_10008893 | 229 |
| 570 | 3300025906 | Ga0207699_10000158 | Ga0207699_1000015817 | 229 |
| 571 | 3300025922 | Ga0207646_10072601 | Ga0207646_100726013 | 229 |
| 572 | 3300025928 | Ga0207700_10001842 | Ga0207700_100018422 | 229 |
| 573 | 3300025929 | Ga0207664_10012393 | Ga0207664_100123932 | 229 |
| 574 | 3300005435 | Ga0070714_100065964 | Ga0070714_1000659642 | 230 |
| 575 | 3300006028 | Ga0070717_10067295 | Ga0070717_100672952 | 230 |
| 576 | 3300025250 | Ga0209026_1012460 | Ga0209026_10124601 | 230 |
| 577 | 3300025929 | Ga0207664_10099500 | Ga0207664_100995002 | 230 |
| 578 | 3300037588 | Ga0316581_0072420 | Ga0316581_0072420_245_997 | 230 |
| 579 | 3300042876 | Ga0451577_0007523 | Ga0451577_0007523_7634_8359 | 230 |
| 580 | 3300042876 | Ga0451577_0053690 | Ga0451577_0053690_2091_2855 | 230 |
| 581 | 3300044656 | Ga0466969_0008397 | Ga0466969_0008397_4018_4812 | 230 |
| 582 | 3300044712 | Ga0453684_0000744 | Ga0453684_0000744_68477_69241 | 230 |
| 583 | 3300044712 | Ga0453684_0002501 | Ga0453684_0002501_31323_32069 | 230 |
| 584 | 3300044712 | Ga0453684_0004636 | Ga0453684_0004636_26677_27402 | 230 |
| 585 | 3300044712 | Ga0453684_0214514 | Ga0453684_0214514_1180_1905 | 230 |
| 586 | 3300044712 | Ga0453684_0225182 | Ga0453684_0225182_425_1150 | 230 |
| 587 | 3300045051 | Ga0451576_0489452 | Ga0451576_0489452_64_789 | 230 |
| 588 | 3300046506 | Ga0495583_0000200 | Ga0495583_0000200_61884_62582 | 230 |
| 589 | 3300046507 | Ga0495606_0001544 | Ga0495606_0001544_18911_19609 | 230 |
| 590 | 3300046660 | Ga0495625_0003764 | Ga0495625_0003764_10027_10725 | 230 |
| 591 | 3300046684 | Ga0495669_0014203 | Ga0495669_0014203_297_995 | 230 |
| 592 | 3300046694 | Ga0495649_0000068 | Ga0495649_0000068_66351_67049 | 230 |
| 593 | 3300046794 | Ga0495589_0114553 | Ga0495589_0114553_367_1065 | 230 |
| 594 | 3300002705 | JGI25156J39149_1000612 | JGI25156J39149_100061210 | 231 |
| 595 | 3300002738 | JGI25154J39366_1001968 | JGI25154J39366_10019685 | 231 |
| 596 | 3300002741 | JGI25157J39369_1000312 | JGI25157J39369_100031210 | 231 |
| 597 | 3300003752 | Ga0055539_1006949 | Ga0055539_10069492 | 231 |
| 598 | 3300003761 | Ga0055535_1000156 | Ga0055535_10001567 | 231 |
| 599 | 3300003763 | Ga0055529_1000382 | Ga0055529_100038224 | 231 |
| 600 | 3300005327 | Ga0070658_10107053 | Ga0070658_101070533 | 231 |
| 601 | 3300005330 | Ga0070690_100029883 | Ga0070690_1000298832 | 231 |
| 602 | 3300005334 | Ga0068869_100245611 | Ga0068869_1002456111 | 231 |
| 603 | 3300005364 | Ga0070673_100013302 | Ga0070673_1000133023 | 231 |
| 604 | 3300005366 | Ga0070659_100472767 | Ga0070659_1004727671 | 231 |
| 605 | 3300005563 | Ga0068855_100206229 | Ga0068855_1002062292 | 231 |
| 606 | 3300005577 | Ga0068857_100004386 | Ga0068857_1000043869 | 231 |
| 607 | 3300005578 | Ga0068854_100001850 | Ga0068854_1000018504 | 231 |
| 608 | 3300005614 | Ga0068856_100001613 | Ga0068856_10000161314 | 231 |
| 609 | 3300006353 | Ga0075370_10002313 | Ga0075370_100023134 | 231 |
| 610 | 3300009093 | Ga0105240_10036971 | Ga0105240_100369712 | 231 |
| 611 | 3300009093 | Ga0105240_10204891 | Ga0105240_102048912 | 231 |
| 612 | 3300009093 | Ga0105240_10636821 | Ga0105240_106368211 | 231 |
| 613 | 3300009148 | Ga0105243_10027867 | Ga0105243_100278673 | 231 |
| 614 | 3300009551 | Ga0105238_10053247 | Ga0105238_100532472 | 231 |
| 615 | 3300009551 | Ga0105238_10238330 | Ga0105238_102383301 | 231 |
| 616 | 3300010375 | Ga0105239_10015868 | Ga0105239_100158684 | 231 |
| 617 | 3300013105 | Ga0157369_10016813 | Ga0157369_100168134 | 231 |
| 618 | 3300025231 | Ga0207427_100282 | Ga0207427_10028231 | 231 |
| 619 | 3300025242 | Ga0209258_100608 | Ga0209258_10060820 | 231 |
| 620 | 3300025242 | Ga0209258_101271 | Ga0209258_1012719 | 231 |
| 621 | 3300025246 | Ga0209646_1000056 | Ga0209646_100005664 | 231 |
| 622 | 3300025250 | Ga0209026_1000009 | Ga0209026_1000009264 | 231 |
| 623 | 3300025253 | Ga0209677_100112 | Ga0209677_10011261 | 231 |
| 624 | 3300025256 | Ga0209759_1000035 | Ga0209759_1000035199 | 231 |
| 625 | 3300025256 | Ga0209759_1001596 | Ga0209759_100159611 | 231 |
| 626 | 3300025272 | Ga0209455_1000108 | Ga0209455_1000108150 | 231 |
| 627 | 3300025303 | Ga0209051_1013374 | Ga0209051_10133743 | 231 |
| 628 | 3300025909 | Ga0207705_10029672 | Ga0207705_100296722 | 231 |
| 629 | 3300025913 | Ga0207695_10019920 | Ga0207695_100199205 | 231 |
| 630 | 3300025913 | Ga0207695_10071935 | Ga0207695_100719353 | 231 |
| 631 | 3300025935 | Ga0207709_10004398 | Ga0207709_100043982 | 231 |
| 632 | 3300025942 | Ga0207689_10061084 | Ga0207689_100610843 | 231 |
| 633 | 3300025949 | Ga0207667_10025343 | Ga0207667_100253435 | 231 |
| 634 | 3300025960 | Ga0207651_10020387 | Ga0207651_100203873 | 231 |
| 635 | 3300025981 | Ga0207640_10007857 | Ga0207640_100078574 | 231 |
| 636 | 3300025981 | Ga0207640_10232588 | Ga0207640_102325881 | 231 |
| 637 | 3300026078 | Ga0207702_10001270 | Ga0207702_1000127014 | 231 |
| 638 | 3300026116 | Ga0207674_10004701 | Ga0207674_100047018 | 231 |
| 639 | 3300026118 | Ga0207675_100087291 | Ga0207675_1000872913 | 231 |
| 640 | 3300026142 | Ga0207698_10291352 | Ga0207698_102913522 | 231 |
| 641 | 3300026142 | Ga0207698_10654889 | Ga0207698_106548892 | 231 |
| 642 | 3300028666 | Ga0265336_10000039 | Ga0265336_1000003945 | 231 |
| 643 | 3300029957 | Ga0265324_10000223 | Ga0265324_100002236 | 231 |
| 644 | 3300031507 | Ga0307509_10196248 | Ga0307509_101962482 | 231 |
| 645 | 3300031730 | Ga0307516_10001841 | Ga0307516_1000184114 | 231 |
| 646 | 3300037466 | Ga0395898_0039736 | Ga0395898_0039736_2798_3493 | 231 |
| 647 | 3300038443 | Ga0395901_0082437 | Ga0395901_0082437_2308_3003 | 231 |
| 648 | 3300044656 | Ga0466969_0031508 | Ga0466969_0031508_34_753 | 231 |
| 649 | 3300044684 | Ga0466966_0001971 | Ga0466966_0001971_5976_6695 | 231 |
| 650 | 3300044693 | Ga0466961_0019461 | Ga0466961_0019461_2211_2930 | 231 |
| 651 | 3300044842 | Ga0466957_0041014 | Ga0466957_0041014_650_1369 | 231 |
| 652 | 3300045836 | Ga0466958_0014412 | Ga0466958_0014412_2311_3030 | 231 |
| 653 | 3300045976 | Ga0466967_0841704 | Ga0466967_0841704_171_875 | 231 |
| 654 | 3300046471 | Ga0495650_0007772 | Ga0495650_0007772_703_1419 | 231 |
| 655 | 3300046475 | Ga0495639_0007408 | Ga0495639_0007408_341_1069 | 231 |
| 656 | 3300046529 | Ga0495652_0259229 | Ga0495652_0259229_238_966 | 231 |
| 657 | 3300050496 | nmdc:mga07m45_483_c3 | nmdc:mga07m45_483_c3_5241_5957 | 231 |
| 658 | 3300053080 | Ga0500635_0001451 | Ga0500635_0001451_3843_4559 | 231 |
| 659 | 3300053136 | Ga0500559_0006137 | Ga0500559_0006137_2618_3334 | 231 |
| 660 | 3300061719 | Ga0466962_0010285 | Ga0466962_0010285_2220_2939 | 231 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5xu1-assembly1.cif.gz_A | structure of a non-canonical abc transporter from streptococcus pneumoniae r6 | 0.9739 | 3 | 225 |
| 1f3o-assembly1.cif.gz_A-2 | crystal structure of mj0796 atp-binding cassette | 0.972 | 6 | 223 |
| 2pcj-assembly1.cif.gz_B | crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 | 0.971 | 3 | 224 |
| 5xu1-assembly1.cif.gz_B | structure of a non-canonical abc transporter from streptococcus pneumoniae r6 | 0.9646 | 3 | 228 |
| 5ws4-assembly1.cif.gz_B | crystal structure of tripartite-type abc transporter macb from acinetobacter baumannii | 0.9637 | 3 | 225 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P75957_1_229_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9762 | 1 | 228 | 3.40.50.300 |
| 5xu1A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9739 | 3 | 225 | 3.40.50.300 |
| af_A4I4M8_123_401_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.972 | 32 | 224 | 3.40.50.300 |
| af_P14175_33_289_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9716 | 25 | 225 | 3.40.50.300 |
| af_Q4DP20_46_317_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9693 | 3 | 225 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A089I4Y8-F1-model_v4 | ABC transporter ATP-binding protein | 0.9863 | 6 | 225 |
GO:0005524
GO:0005886 GO:0016887 GO:0022857 |
| AF-A0A3M1CG20-F1-model_v4 | ABC transporter ATP-binding protein | 0.9795 | 6 | 231 |
GO:0005524
GO:0005886 GO:0016887 GO:0022857 |
| AF-A0A5C6DXG8-F1-model_v4 | Macrolide export ATP-binding/permease protein MacB (EC 3.6.3.-) | 0.9785 | 2 | 224 |
GO:0005524
GO:0016887 |
| AF-A0A6I5GX10-F1-model_v4 | Betaine/proline/choline family ABC transporter ATP-binding protein | 0.9761 | 39 | 225 |
GO:0005524
GO:0016020 GO:0016887 GO:0031460 |
| AF-A0A2N6MPE8-F1-model_v4 | deleted | 0.976 | 6 | 224 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar