F473253

General Info

Members Datasets Scaffolds Average Seq Length
659 330 603 243

Family's Representative Sequence

Representative Sequence 3300028794|Ga0307515_10085380|Ga0307515_100853801
Length 262
Sequence LQWSGRLLSMSGSMRGSSVGTLILLRHGESLWNAENLFTGWVDVALSPKGEKEAHRGGELLRETGLLPDIVHTSVLRRAIATANIALDVADRHWIPVKRDWRLNERHYGALQGKNKKQTLEEFGEEQFMLWRRSYDTPPPPIELGTEFSQDGDPRYAGLDIPRTECLKDVVARMLPYWESEIVPDLRAGKTVLLAAHGNSLRALVKYLDRISDDAISGLNIPTGIPLRYDLNDQLEPENPGGTYLDPEAAEKAAAAVANQGR

Samples

Sample ID Description Type Environment
1 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
2 2643221561 Nocardioides sp. Root151 Isolate Unclassified
3 2643221576 Nocardioides sp. Root614 Isolate Unclassified
4 2643221590 Nocardioides sp. Root682 Isolate Unclassified
5 2643221613 Oerskovia sp. Root22 Isolate Unclassified
6 2643221635 Yonghaparkia sp. Root332 Isolate Unclassified
7 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
8 2643221679 Angustibacter sp. Root456 Isolate Unclassified
9 2643221696 Nocardioides sp. Root140 Isolate Unclassified
10 2643221711 Terrabacter sp. Root85 Isolate Unclassified
11 2643221721 Oerskovia sp. Root918 Isolate Unclassified
12 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
13 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
14 2734482000 Kineosporia rhizophila JCM 9960 Isolate Unclassified
15 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
16 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
17 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
18 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
19 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
20 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
21 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
22 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
23 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
24 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
25 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
26 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
27 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
28 2808606394 Promicromonospora sp. C35 Isolate Unclassified
29 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
30 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
31 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
32 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
33 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
34 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
35 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
36 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
37 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
38 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
39 2904430863 Curtobacterium oceanosedimentum 1519 Isolate Rhizosphere
40 2904501621 Curtobacterium sp. 1909 Isolate Unclassified
41 2908674828 Curtobacterium sp. 1517 Isolate Rhizosphere
42 2909074476 Curtobacterium sp. 1310 Isolate Rhizosphere
43 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
44 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
45 2919039151 Curtobacterium sp. 260 Isolate Rhizosphere
46 2919042368 Curtobacterium sp. 320 Isolate Rhizosphere
47 2928104781 Curtobacterium sp. 1544 Isolate Rhizosphere
48 2928500415 Curtobacterium oceanosedimentum 1257 Isolate Rhizosphere
49 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
50 2946003308 Arthrobacter agilis W3I6 Isolate Rhizosphere
51 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root
52 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
53 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
54 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
56 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
57 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
58 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
59 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
60 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
61 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
62 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
63 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
64 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
65 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
66 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
67 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
68 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
69 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
70 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
71 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
72 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
73 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
74 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
75 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
76 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
77 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
78 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
79 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
80 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
81 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
82 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
83 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
84 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
85 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
86 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
87 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
88 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
89 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
90 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
91 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
92 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
93 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
94 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
95 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
96 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
97 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
98 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
99 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
100 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
101 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
102 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
103 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
104 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
105 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
106 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
107 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
108 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
110 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
111 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
112 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
113 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
114 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
115 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
116 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
117 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
118 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
119 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
120 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
121 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
122 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
123 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
124 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
125 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
126 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
127 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
128 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
129 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
130 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
131 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
132 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
133 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
134 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
171 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
172 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
176 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
177 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
178 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
179 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
180 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
181 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
182 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
183 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
184 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
185 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
186 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
187 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
188 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
189 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
190 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
191 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
192 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
193 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
194 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
195 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
196 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
197 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
198 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
199 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
200 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
201 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
202 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
203 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
204 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
205 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
206 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
207 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
208 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
209 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
210 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
211 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
212 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
213 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
214 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
215 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
216 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
217 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
218 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
219 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
220 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
221 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
222 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
223 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
224 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
225 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
226 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
227 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
228 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
229 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
230 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
231 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
232 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
233 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
234 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
235 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
236 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
237 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
238 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
239 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
240 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
241 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
242 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
243 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
244 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
245 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
246 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
247 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
248 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
249 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
250 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
251 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
252 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
253 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
254 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
255 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
256 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
257 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
258 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
259 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
260 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
261 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
262 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
263 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
264 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
265 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
266 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
267 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
268 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
269 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
270 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
271 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
272 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
273 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
274 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
275 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
276 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
284 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
287 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
290 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
291 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
292 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
293 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
294 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
295 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
296 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
297 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
298 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
299 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
300 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
301 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
302 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
303 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
304 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
305 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
307 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
308 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
309 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
310 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
311 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
312 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
313 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
314 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
315 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
316 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
317 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
318 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
319 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
320 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
321 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
322 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
323 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
324 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
325 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
326 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
327 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
328 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule
329 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule
330 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.05
Metatranscriptomes 0.46
Isolates 8.5

Biome Distribution

Category Percentage (%)
Aerial Root 0.15
Bulb 0
Endosphere 9.71
Nodule 0.3
Rhizoplane 11.08
Rhizosphere 67.07
Stem 0
Stem Tuber 0
Unclassified 11.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10003793 3300001979 Bacteria 6578
2 JGI24740J21852_10012489 3300001979 Bacteria 3199
3 JGI24745J21846_1001844 3300002073 Bacteria 2099
4 JGI25406J46586_10005697 3300003203 Bacteria 5758
5 JGI25406J46586_10013775 3300003203 Bacteria 3458
6 Ga0006562J51391_1199253 3300003578 Bacteria 993
7 Ga0055540_1000069 3300003792 Bacteria 119560
8 Ga0070658_10076640 3300005327 Bacteria 2742
9 Ga0070658_10655437 3300005327 Bacteria 911
10 Ga0070683_100001445 3300005329 Bacteria 18257
11 Ga0070683_100047993 3300005329 Bacteria 3947
12 Ga0070683_100121022 3300005329 Bacteria 2473
13 Ga0070683_100280538 3300005329 Bacteria 1585
14 Ga0070683_100310104 3300005329 Bacteria 1501
15 Ga0070683_100374454 3300005329 Bacteria 1357
16 Ga0068869_100052208 3300005334 Bacteria 2968
17 Ga0070666_10117686 3300005335 Bacteria 1841
18 Ga0070682_100011552 3300005337 Bacteria 5049
19 Ga0070682_100013638 3300005337 Bacteria 4682
20 Ga0070682_100014903 3300005337 Bacteria 4500
21 Ga0068868_100076813 3300005338 Bacteria 2671
22 Ga0068868_100155532 3300005338 Bacteria 1885
23 Ga0068868_100730599 3300005338 Bacteria 888
24 Ga0070660_100091318 3300005339 Bacteria 2402
25 Ga0070660_100197323 3300005339 Bacteria 1632
26 Ga0070691_10065190 3300005341 Bacteria 1758
27 Ga0070692_10004256 3300005345 Bacteria 5944
28 Ga0070692_10007753 3300005345 Bacteria 4755
29 Ga0070668_100000963 3300005347 Bacteria 20130
30 Ga0070668_100150343 3300005347 Bacteria 1882
31 Ga0070675_100184765 3300005354 Bacteria 1804
32 Ga0070671_100124269 3300005355 Bacteria 2172
33 Ga0070674_100135387 3300005356 Bacteria 1842
34 Ga0070674_100282983 3300005356 Bacteria 1315
35 Ga0070673_100344744 3300005364 Bacteria 1321
36 Ga0070688_100190680 3300005365 Bacteria 1428
37 Ga0070688_100330998 3300005365 Bacteria 1109
38 Ga0070659_100122691 3300005366 Bacteria 2106
39 Ga0070659_100237441 3300005366 Bacteria 1507
40 Ga0070667_100006772 3300005367 Bacteria 9515
41 Ga0070667_100645933 3300005367 Bacteria 977
42 Ga0070714_100009318 3300005435 Bacteria 7713
43 Ga0070710_10000504 3300005437 Bacteria 18353
44 Ga0070700_100004562 3300005441 Bacteria 7246
45 Ga0070663_100030289 3300005455 Bacteria 3706
46 Ga0070663_100037219 3300005455 Bacteria 3386
47 Ga0070662_100112899 3300005457 Bacteria 2072
48 Ga0068867_100239097 3300005459 Bacteria 1472
49 Ga0068867_100355214 3300005459 Bacteria 1224
50 Ga0070685_10010211 3300005466 Bacteria 4875
51 Ga0070679_100000778 3300005530 Bacteria 27739
52 Ga0070684_100005967 3300005535 Bacteria 9383
53 Ga0070684_100048161 3300005535 Bacteria 3697
54 Ga0070684_100126792 3300005535 Bacteria 2300
55 Ga0068853_100052096 3300005539 Bacteria 3525
56 Ga0068853_100306199 3300005539 Bacteria 1470
57 Ga0070686_100038187 3300005544 Bacteria 2983
58 Ga0070693_100243612 3300005547 Bacteria 1189
59 Ga0070693_100278269 3300005547 Bacteria 1120
60 Ga0070665_100176415 3300005548 Bacteria 2138
61 Ga0068857_100001052 3300005577 Bacteria 21360
62 Ga0068854_100015711 3300005578 Bacteria 5025
63 Ga0070702_100031694 3300005615 Bacteria 2895
64 Ga0070702_100115877 3300005615 Bacteria 1670
65 Ga0068852_100231103 3300005616 Bacteria 1763
66 Ga0068852_100289128 3300005616 Bacteria 1583
67 Ga0068852_100492973 3300005616 Bacteria 1219
68 Ga0068859_100196471 3300005617 Bacteria 2102
69 Ga0068861_100049509 3300005719 Bacteria 3182
70 Ga0068861_100102208 3300005719 Bacteria 2281
71 Ga0068870_10011937 3300005840 Bacteria 4043
72 Ga0068860_100000539 3300005843 Bacteria 46099
73 Ga0068860_100129700 3300005843 Bacteria 2418
74 Ga0068860_100406271 3300005843 Bacteria 1348
75 Ga0068862_100317680 3300005844 Bacteria 1437
76 Ga0081540_1023161 3300005983 Bacteria 3642
77 Ga0081539_10000401 3300005985 Bacteria 92875
78 Ga0081539_10001059 3300005985 Bacteria 50280
79 Ga0081539_10004844 3300005985 Bacteria 14410
80 Ga0081539_10018104 3300005985 Bacteria 4906
81 Ga0081539_10092009 3300005985 Bacteria 1565
82 Ga0075365_10010141 3300006038 Bacteria 5469
83 Ga0075365_10018799 3300006038 Bacteria 4255
84 Ga0075365_10052811 3300006038 Bacteria 2690
85 Ga0075365_10059042 3300006038 Bacteria 2555
86 Ga0075365_10091368 3300006038 Bacteria 2074
87 Ga0075365_10103238 3300006038 Bacteria 1954
88 Ga0075365_10163980 3300006038 Bacteria 1549
89 Ga0075365_10177082 3300006038 Bacteria 1490
90 Ga0075365_10249280 3300006038 Bacteria 1248
91 Ga0075368_10024343 3300006042 Bacteria 2319
92 Ga0075368_10074607 3300006042 Bacteria 1374
93 Ga0075363_100001876 3300006048 Bacteria 8289
94 Ga0075363_100024374 3300006048 Bacteria 3075
95 Ga0075363_100114471 3300006048 Bacteria 1502
96 Ga0075364_10031207 3300006051 Bacteria 3423
97 Ga0075364_10084636 3300006051 Bacteria 2100
98 Ga0075364_10100711 3300006051 Bacteria 1923
99 Ga0075364_10103027 3300006051 Bacteria 1900
100 Ga0075364_10159985 3300006051 Bacteria 1520
101 Ga0075367_10004865 3300006178 Bacteria 6615
102 Ga0075367_10065731 3300006178 Bacteria 2172
103 Ga0075367_10137558 3300006178 Bacteria 1512
104 Ga0075367_10171244 3300006178 Bacteria 1352
105 Ga0075369_10011473 3300006186 Bacteria 3487
106 Ga0075369_10015997 3300006186 Bacteria 3020
107 Ga0075370_10012058 3300006353 Bacteria 4558
108 Ga0075370_10042517 3300006353 Bacteria 2567
109 Ga0075370_10171899 3300006353 Bacteria 1274
110 Ga0075370_10275835 3300006353 Bacteria 998
111 Ga0068865_100032731 3300006881 Bacteria 3476
112 Ga0068865_100128016 3300006881 Bacteria 1898
113 Ga0068865_100152708 3300006881 Bacteria 1753
114 Ga0097620_100196484 3300006931 Bacteria 2102
115 Ga0105244_10100973 3300009036 Bacteria 1411
116 Ga0111539_10070559 3300009094 Bacteria 4124
117 Ga0111539_10296615 3300009094 Bacteria 1881
118 Ga0111539_11531175 3300009094 Bacteria 773
119 Ga0105245_10003998 3300009098 Bacteria 13101
120 Ga0105245_10519266 3300009098 Bacteria 1209
121 Ga0105247_10063916 3300009101 Bacteria 2286
122 Ga0105247_10448890 3300009101 Bacteria 929
123 Ga0105243_10007184 3300009148 Bacteria 8559
124 Ga0105243_10011541 3300009148 Bacteria 6684
125 Ga0105243_10014166 3300009148 Bacteria 6033
126 Ga0105243_10116392 3300009148 Bacteria 2245
127 Ga0105242_10200620 3300009176 Bacteria 1772
128 Ga0105242_10344532 3300009176 Bacteria 1374
129 Ga0105242_10510515 3300009176 Bacteria 1145
130 Ga0105237_10024837 3300009545 Bacteria 6132
131 Ga0105237_10347805 3300009545 Bacteria 1487
132 Ga0105238_10091772 3300009551 Bacteria 3024
133 Ga0105249_10032672 3300009553 Bacteria 4708
134 Ga0105249_10069615 3300009553 Bacteria 3247
135 Ga0105033_101393 3300009986 Bacteria 1970
136 Ga0105239_10001993 3300010375 Bacteria 26536
137 Ga0105239_10010349 3300010375 Bacteria 10444
138 Ga0105239_10257108 3300010375 Bacteria 1962
139 Ga0105246_10000815 3300011119 Bacteria 17721
140 Ga0105246_10596243 3300011119 Bacteria 954
141 Ga0157371_10517358 3300013102 Bacteria 882
142 Ga0157370_10249476 3300013104 Bacteria 1642
143 Ga0157369_10014254 3300013105 Bacteria 8980
144 Ga0157369_10149211 3300013105 Bacteria 2471
145 Ga0163162_10014982 3300013306 Bacteria 7573
146 Ga0163162_10017495 3300013306 Bacteria 7013
147 Ga0163162_10091249 3300013306 Bacteria 3129
148 Ga0157372_10002613 3300013307 Bacteria 19489
149 Ga0157372_10267634 3300013307 Bacteria 1985
150 Ga0157372_10624792 3300013307 Bacteria 1255
151 Ga0157372_10640141 3300013307 Bacteria 1238
152 Ga0157375_10139821 3300013308 Bacteria 2548
153 Ga0157375_10203333 3300013308 Bacteria 2137
154 Ga0157375_10475597 3300013308 Bacteria 1414
155 Ga0157375_10669569 3300013308 Bacteria 1193
156 Ga0163163_10177716 3300014325 Bacteria 2175
157 Ga0163163_10355422 3300014325 Bacteria 1521
158 Ga0163163_10504682 3300014325 Bacteria 1271
159 Ga0157380_10055521 3300014326 Bacteria 3146
160 Ga0157380_10157151 3300014326 Bacteria 1972
161 Ga0157380_10766622 3300014326 Bacteria 978
162 Ga0157377_10021539 3300014745 Bacteria 3392
163 Ga0157379_10105912 3300014968 Bacteria 2524
164 Ga0157379_10130391 3300014968 Bacteria 2263
165 Ga0157379_10417977 3300014968 Bacteria 1234
166 Ga0157376_10102910 3300014969 Bacteria 2499
167 Ga0163161_10008550 3300017792 Bacteria 7080
168 Ga0206353_11108400 3300020082 Bacteria 5389
169 Ga0206353_11418486 3300020082 Bacteria 2172
170 Ga0213876_10055421 3300021384 Bacteria 2093
171 Ga0213875_10113922 3300021388 Bacteria 1263
172 Ga0209051_1000034 3300025303 Bacteria 371498
173 Ga0207692_10000113 3300025898 Bacteria 24150
174 Ga0207688_10003254 3300025901 Bacteria 8873
175 Ga0207688_10009136 3300025901 Bacteria 5398
176 Ga0207688_10048479 3300025901 Bacteria 2374
177 Ga0207680_10097225 3300025903 Bacteria 1885
178 Ga0207647_10032967 3300025904 Bacteria 3322
179 Ga0207647_10048574 3300025904 Bacteria 2635
180 Ga0207647_10052368 3300025904 Bacteria 2520
181 Ga0207643_10003380 3300025908 Bacteria 8599
182 Ga0207705_10688818 3300025909 Bacteria 795
183 Ga0207671_10015402 3300025914 Bacteria 5987
184 Ga0207671_10233044 3300025914 Bacteria 1445
185 Ga0207657_10027101 3300025919 Bacteria 5254
186 Ga0207657_10079100 3300025919 Bacteria 2767
187 Ga0207649_10126274 3300025920 Bacteria 1732
188 Ga0207649_10438981 3300025920 Bacteria 983
189 Ga0207650_10412542 3300025925 Bacteria 1119
190 Ga0207687_10003039 3300025927 Bacteria 11371
191 Ga0207687_10049776 3300025927 Bacteria 2915
192 Ga0207664_10003778 3300025929 Bacteria 10171
193 Ga0207690_10004172 3300025932 Bacteria 8534
194 Ga0207690_10032084 3300025932 Bacteria 3367
195 Ga0207690_10178437 3300025932 Bacteria 1597
196 Ga0207706_10019667 3300025933 Bacteria 6074
197 Ga0207709_10082347 3300025935 Bacteria 2078
198 Ga0207669_10029278 3300025937 Bacteria 3043
199 Ga0207669_10158540 3300025937 Bacteria 1595
200 Ga0207669_10290901 3300025937 Bacteria 1237
201 Ga0207691_10002292 3300025940 Bacteria 18735
202 Ga0207691_10262037 3300025940 Bacteria 1490
203 Ga0207711_10097215 3300025941 Bacteria 2600
204 Ga0207711_10556845 3300025941 Bacteria 1069
205 Ga0207661_10011065 3300025944 Bacteria 6521
206 Ga0207661_10106938 3300025944 Bacteria 2359
207 Ga0207661_10110715 3300025944 Bacteria 2322
208 Ga0207661_10364274 3300025944 Bacteria 1306
209 Ga0207661_10783673 3300025944 Bacteria 878
210 Ga0207651_10880045 3300025960 Bacteria 797
211 Ga0207712_10054044 3300025961 Bacteria 2820
212 Ga0207712_10160189 3300025961 Bacteria 1748
213 Ga0207668_10002836 3300025972 Bacteria 10150
214 Ga0207668_10050720 3300025972 Bacteria 2862
215 Ga0207668_10247666 3300025972 Bacteria 1445
216 Ga0207640_10034143 3300025981 Bacteria 3171
217 Ga0207640_10322984 3300025981 Bacteria 1230
218 Ga0207658_10012145 3300025986 Bacteria 5874
219 Ga0207658_10215519 3300025986 Bacteria 1612
220 Ga0207658_10583197 3300025986 Bacteria 1003
221 Ga0207677_10066661 3300026023 Bacteria 2518
222 Ga0207639_10537911 3300026041 Bacteria 1071
223 Ga0207678_10042511 3300026067 Bacteria 3936
224 Ga0207678_10059810 3300026067 Bacteria 3278
225 Ga0207708_10000865 3300026075 Bacteria 22817
226 Ga0207708_10017225 3300026075 Bacteria 5438
227 Ga0207641_10233055 3300026088 Bacteria 1712
228 Ga0207648_10015438 3300026089 Bacteria 7024
229 Ga0207676_10026631 3300026095 Bacteria 4300
230 Ga0207676_10759251 3300026095 Bacteria 944
231 Ga0207674_10001835 3300026116 Bacteria 27058
232 Ga0207674_10422523 3300026116 Bacteria 1288
233 Ga0207675_100008603 3300026118 Bacteria 9595
234 Ga0207675_100013494 3300026118 Bacteria 7623
235 Ga0207675_100430180 3300026118 Bacteria 1305
236 Ga0207683_10136068 3300026121 Bacteria 2212
237 Ga0207698_10031472 3300026142 Bacteria 3829
238 Ga0207698_10045971 3300026142 Bacteria 3293
239 Ga0207698_10261283 3300026142 Bacteria 1591
240 Ga0207698_10306461 3300026142 Bacteria 1481
241 Ga0209813_10061839 3300027866 Bacteria 1197
242 Ga0207428_10152644 3300027907 Bacteria 1757
243 Ga0268266_10002050 3300028379 Bacteria 22345
244 Ga0268266_10043357 3300028379 Bacteria 3844
245 Ga0268266_10152404 3300028379 Bacteria 2085
246 Ga0268266_10521761 3300028379 Bacteria 1136
247 Ga0268265_10017253 3300028380 Bacteria 4979
248 Ga0268264_10000195 3300028381 Bacteria 123899
249 Ga0268264_10267850 3300028381 Bacteria 1595
250 Ga0268264_10302450 3300028381 Bacteria 1506
251 Ga0307515_10022429 3300028794 Bacteria 11126
252 Ga0307515_10085380 3300028794 Bacteria 4040
253 Ga0307512_10004546 3300030522 Bacteria 15156
254 Ga0307512_10175866 3300030522 Bacteria 1215
255 Ga0316176_1056925 3300030732 Bacteria 8164
256 Ga0314311_1197282 3300030733 Bacteria 1720
257 Ga0265327_10002433 3300031251 Bacteria 19668
258 Ga0307513_10009960 3300031456 Bacteria 11989
259 Ga0307513_10465042 3300031456 Bacteria 987
260 Ga0316575_10000002 3300031665 Bacteria 148142
261 Ga0316579_10000077 3300031691 Bacteria 24927
262 Ga0316576_10082548 3300031727 Bacteria 2386
263 Ga0316576_10507928 3300031727 Unclassified 886
264 Ga0307405_10382348 3300031731 Bacteria 1096
265 Ga0307405_10434991 3300031731 Bacteria 1036
266 Ga0307405_10485164 3300031731 Bacteria 987
267 Ga0316577_10015368 3300031733 Unclassified 4211
268 Ga0307413_10000463 3300031824 Bacteria 13250
269 Ga0307413_10064546 3300031824 Bacteria 2276
270 Ga0307413_10315576 3300031824 Bacteria 1192
271 Ga0307413_10348456 3300031824 Bacteria 1142
272 Ga0307410_10638689 3300031852 Bacteria 892
273 Ga0307406_10214727 3300031901 Bacteria 1426
274 Ga0307406_10295522 3300031901 Bacteria 1242
275 Ga0307407_10327846 3300031903 Bacteria 1077
276 Ga0307412_10546605 3300031911 Bacteria 972
277 Ga0307409_100010399 3300031995 Bacteria 5784
278 Ga0307409_100341147 3300031995 Bacteria 1410
279 Ga0307409_100396726 3300031995 Bacteria 1316
280 Ga0307409_100453401 3300031995 Bacteria 1238
281 Ga0307416_100177321 3300032002 Bacteria 1993
282 Ga0307416_100187712 3300032002 Bacteria 1945
283 Ga0307416_100671994 3300032002 Bacteria 1122
284 Ga0307416_100766249 3300032002 Bacteria 1059
285 Ga0307414_10296286 3300032004 Bacteria 1366
286 Ga0307411_10001252 3300032005 Bacteria 10130
287 Ga0307411_10377596 3300032005 Bacteria 1165
288 Ga0307415_100018929 3300032126 Bacteria 4170
289 Ga0307415_100338999 3300032126 Bacteria 1261
290 Ga0373955_0158288 3300035172 Bacteria 1335
291 Ga0316574_0009266 3300035398 Bacteria 5507
292 Ga0316574_0086504 3300035398 Bacteria 1995
293 Ga0316574_0198282 3300035398 Bacteria 1290
294 Ga0316582_0450050 3300036647 Unclassified 888
295 Ga0316584_0085693 3300036712 Bacteria 2359
296 Ga0316584_0183904 3300036712 Unclassified 1546
297 Ga0395899_0030932 3300037312 Bacteria 4025
298 Ga0395900_0023149 3300037418 Bacteria 6358
299 Ga0395900_0296634 3300037418 Bacteria 1604
300 Ga0395898_0070047 3300037466 Bacteria 3392
301 Ga0395898_0687058 3300037466 Bacteria 965
302 Ga0436364_0749840 3300037853 Bacteria 1263
303 Ga0436364_0913214 3300037853 Bacteria 27932
304 Ga0395901_0243830 3300038443 Bacteria 1873
305 Ga0395901_0252198 3300038443 Bacteria 1838
306 Ga0400488_22546 3300038741 Bacteria 7428
307 Ga0400486_22540 3300038742 Bacteria 84879
308 Ga0400489_78532 3300039093 Bacteria 1073
309 Ga0400487_39832 3300039110 Bacteria 22275
310 Ga0436365_0419767 3300039437 Bacteria 7055
311 Ga0436363_1137442 3300039450 Bacteria 3838
312 Ga0439436_0055029 3300041404 Bacteria 1118
313 Ga0451789_0746420 3300041443 Bacteria 896
314 Ga0451789_0761823 3300041443 Bacteria 1032
315 Ga0451793_1670076 3300041452 Bacteria 1145
316 Ga0451795_1031073 3300041456 Bacteria 1101
317 Ga0451837_1701886 3300041494 Bacteria 779
318 Ga0451843_0422325 3300041509 Bacteria 1224
319 Ga0439431_0003122 3300041997 Bacteria 3641
320 Ga0439442_053679 3300042002 Bacteria 851
321 Ga0439445_0042078 3300042004 Bacteria 1216
322 Ga0439448_0022163 3300042005 Bacteria 1972
323 Ga0450907_027452 3300042146 Bacteria 965
324 Ga0439446_0033993 3300042156 Bacteria 1482
325 Ga0439434_0014582 3300042435 Bacteria 2338
326 Ga0466969_0127025 3300044656 Bacteria 1184
327 Ga0466972_0006954 3300044658 Bacteria 5671
328 Ga0466972_0033184 3300044658 Bacteria 2532
329 Ga0466972_0215953 3300044658 Bacteria 897
330 Ga0466965_0009079 3300044683 Bacteria 4612
331 Ga0466965_0020112 3300044683 Bacteria 3207
332 Ga0466965_0028079 3300044683 Bacteria 2732
333 Ga0466965_0076205 3300044683 Bacteria 1692
334 Ga0466966_0001077 3300044684 Bacteria 17437
335 Ga0466966_0020914 3300044684 Bacteria 4302
336 Ga0466966_0147585 3300044684 Bacteria 1435
337 Ga0466966_0240529 3300044684 Bacteria 1091
338 Ga0466966_0380467 3300044684 Bacteria 848
339 Ga0466961_0002887 3300044693 Bacteria 10658
340 Ga0466961_0035712 3300044693 Bacteria 3191
341 Ga0466961_0063191 3300044693 Bacteria 2352
342 Ga0466961_0089039 3300044693 Bacteria 1950
343 Ga0466963_0000115 3300044694 Bacteria 29685
344 Ga0466963_0030387 3300044694 Bacteria 3485
345 Ga0466963_0131421 3300044694 Bacteria 1730
346 Ga0466963_0175993 3300044694 Bacteria 1493
347 Ga0466963_0260927 3300044694 Bacteria 1216
348 Ga0466963_0290368 3300044694 Bacteria 1150
349 Ga0466964_0012466 3300044706 Bacteria 3216
350 Ga0466971_0006231 3300044719 Bacteria 5185
351 Ga0466971_0014554 3300044719 Bacteria 3463
352 Ga0466971_0084901 3300044719 Bacteria 1446
353 Ga0466968_0032127 3300044735 Bacteria 2182
354 Ga0466970_0015172 3300044765 Bacteria 3962
355 Ga0466970_0024604 3300044765 Bacteria 3150
356 Ga0466970_0028523 3300044765 Bacteria 2934
357 Ga0466970_0051545 3300044765 Bacteria 2196
358 Ga0466970_0064225 3300044765 Bacteria 1968
359 Ga0466970_0072524 3300044765 Bacteria 1852
360 Ga0466970_0079765 3300044765 Bacteria 1768
361 Ga0466957_0001123 3300044842 Bacteria 13861
362 Ga0466957_0012126 3300044842 Bacteria 4986
363 Ga0466957_0024565 3300044842 Bacteria 3566
364 Ga0466957_0127261 3300044842 Bacteria 1628
365 Ga0466957_0286614 3300044842 Bacteria 1103
366 Ga0466957_0470565 3300044842 Bacteria 868
367 Ga0466960_0000485 3300044901 Bacteria 13567
368 Ga0466960_0002733 3300044901 Bacteria 6670
369 Ga0466960_0004596 3300044901 Bacteria 5415
370 Ga0466960_0009617 3300044901 Bacteria 3991
371 Ga0466960_0034563 3300044901 Bacteria 2357
372 Ga0466960_0075045 3300044901 Bacteria 1691
373 Ga0466959_0045896 3300045049 Bacteria 3216
374 Ga0466959_0049346 3300045049 Bacteria 3092
375 Ga0466959_0075272 3300045049 Bacteria 2439
376 Ga0466959_0080803 3300045049 Bacteria 2343
377 Ga0451576_0054279 3300045051 Bacteria 4197
378 Ga0466958_0000458 3300045836 Bacteria 17006
379 Ga0466958_0176824 3300045836 Bacteria 1353
380 Ga0466967_0026902 3300045976 Bacteria 4775
381 Ga0466967_0044891 3300045976 Bacteria 3837
382 Ga0466967_0092787 3300045976 Bacteria 2746
383 Ga0466967_0141503 3300045976 Bacteria 2241
384 Ga0466967_0151361 3300045976 Bacteria 2169
385 Ga0466967_0151939 3300045976 Bacteria 2165
386 Ga0466967_0233178 3300045976 Bacteria 1753
387 Ga0466967_0266691 3300045976 Bacteria 1639
388 Ga0466967_0298166 3300045976 Bacteria 1550
389 Ga0495603_0172054 3300046455 Bacteria 1254
390 Ga0495654_0047676 3300046530 Bacteria 2105
391 Ga0495667_0480188 3300046559 Bacteria 779
392 Ga0495670_0430571 3300046691 Bacteria 714
393 Ga0495649_0205141 3300046694 Bacteria 1023
394 Ga0495589_0048932 3300046794 Bacteria 2092
395 Ga0495581_0140779 3300047315 Bacteria 1407
396 Ga0495672_0179100 3300047320 Bacteria 1075
397 Ga0495676_0041245 3300047321 Bacteria 3801
398 Ga0495676_0059561 3300047321 Bacteria 2997
399 Ga0495676_0068800 3300047321 Bacteria 2734
400 Ga0496100_0000905 3300048903 Bacteria 14132
401 Ga0496100_0002424 3300048903 Bacteria 9453
402 Ga0496100_0050669 3300048903 Bacteria 2691
403 Ga0496100_0064800 3300048903 Bacteria 2419
404 Ga0496100_0104710 3300048903 Bacteria 1955
405 Ga0496100_0178702 3300048903 Bacteria 1534
406 Ga0496101_0000086 3300048904 Bacteria 102149
407 Ga0496101_0004541 3300048904 Bacteria 8765
408 Ga0496102_0005826 3300048905 Bacteria 10482
409 Ga0496102_0070317 3300048905 Bacteria 3213
410 Ga0496102_0106008 3300048905 Bacteria 2615
411 Ga0496102_0278286 3300048905 Bacteria 1577
412 Ga0496102_0713233 3300048905 Bacteria 926
413 Ga0496103_0000804 3300048906 Bacteria 23093
414 Ga0496103_0015384 3300048906 Bacteria 4551
415 Ga0496103_0353309 3300048906 Bacteria 945
416 Ga0496104_0003740 3300048907 Bacteria 13144
417 Ga0496104_0015747 3300048907 Bacteria 6859
418 Ga0496104_0028007 3300048907 Bacteria 5219
419 Ga0496104_0192394 3300048907 Bacteria 1952
420 Ga0496104_0255195 3300048907 Bacteria 1666
421 Ga0496104_0571071 3300048907 Bacteria 1041
422 Ga0496105_0001083 3300048908 Bacteria 18870
423 Ga0496105_0014851 3300048908 Bacteria 6200
424 Ga0496105_0019239 3300048908 Bacteria 5507
425 Ga0496105_0228556 3300048908 Bacteria 1512
426 Ga0496105_0353543 3300048908 Bacteria 1173
427 Ga0496106_0005886 3300048909 Bacteria 9063
428 Ga0496106_0100823 3300048909 Bacteria 2239
429 Ga0496106_0112894 3300048909 Bacteria 2118
430 Ga0496106_0413005 3300048909 Bacteria 1085
431 Ga0496107_0001622 3300048910 Bacteria 14015
432 Ga0496107_0034962 3300048910 Bacteria 3601
433 Ga0496107_0050536 3300048910 Bacteria 2997
434 Ga0496108_0001685 3300048911 Bacteria 17515
435 Ga0496108_0025618 3300048911 Bacteria 4862
436 Ga0496108_0045007 3300048911 Bacteria 3685
437 Ga0496108_0056359 3300048911 Bacteria 3302
438 Ga0496108_0063429 3300048911 Bacteria 3112
439 Ga0496108_0188936 3300048911 Bacteria 1785
440 Ga0496108_0396344 3300048911 Bacteria 1206
441 Ga0496108_0495965 3300048911 Bacteria 1067
442 Ga0496108_0576964 3300048911 Bacteria 980
443 Ga0496109_0001458 3300048912 Bacteria 19612
444 Ga0496109_0004303 3300048912 Bacteria 11891
445 Ga0496109_0009816 3300048912 Bacteria 8171
446 Ga0496109_0060924 3300048912 Bacteria 3449
447 Ga0496109_0074692 3300048912 Bacteria 3117
448 Ga0496109_0738277 3300048912 Bacteria 922
449 Ga0496110_0000730 3300048913 Bacteria 22682
450 Ga0496110_0009667 3300048913 Bacteria 7809
451 Ga0496110_0053034 3300048913 Bacteria 3564
452 Ga0496110_0160930 3300048913 Bacteria 2035
453 Ga0496111_0045912 3300048914 Bacteria 3144
454 Ga0496111_0085581 3300048914 Bacteria 2305
455 Ga0496111_0197586 3300048914 Bacteria 1495
456 Ga0496112_0007193 3300048915 Bacteria 9860
457 Ga0496112_0226089 3300048915 Bacteria 1827
458 Ga0496112_0361321 3300048915 Bacteria 1394
459 Ga0496113_0028183 3300048916 Bacteria 4037
460 Ga0496113_0050921 3300048916 Bacteria 3089
461 Ga0496114_0002569 3300048917 Bacteria 13873
462 Ga0496114_0023846 3300048917 Bacteria 4993
463 Ga0496114_0026952 3300048917 Bacteria 4707
464 Ga0496114_0052647 3300048917 Bacteria 3392
465 Ga0496114_0135452 3300048917 Bacteria 2130
466 Ga0496114_0211574 3300048917 Bacteria 1701
467 Ga0496114_0212106 3300048917 Bacteria 1698
468 Ga0496115_0058627 3300048918 Bacteria 3098
469 Ga0496116_0027928 3300048919 Bacteria 4098
470 Ga0496117_0008944 3300048920 Bacteria 9429
471 Ga0496117_0018503 3300048920 Bacteria 5764
472 Ga0496118_0000173 3300048921 Bacteria 116057
473 Ga0496118_0013363 3300048921 Bacteria 7771
474 Ga0496118_0036261 3300048921 Bacteria 3989
475 Ga0496119_0002996 3300048922 Bacteria 17913
476 Ga0496119_0014727 3300048922 Bacteria 6091
477 Ga0496119_0050783 3300048922 Bacteria 2553
478 Ga0496120_0032045 3300048923 Bacteria 3174
479 Ga0496120_0084319 3300048923 Bacteria 1713
480 Ga0496121_0000002 3300048924 Bacteria 1494588
481 Ga0496122_0000078 3300048925 Bacteria 214068
482 Ga0496122_0005671 3300048925 Bacteria 14731
483 Ga0496123_0028187 3300048926 Bacteria 4164
484 Ga0496123_0033158 3300048926 Bacteria 3722
485 Ga0496124_0000002 3300048927 Bacteria 1494588
486 Ga0496124_0000135 3300048927 Bacteria 152458
487 Ga0496124_0114339 3300048927 Bacteria 2167
488 Ga0496125_0000002 3300048928 Bacteria 1480920
489 Ga0496125_0000069 3300048928 Bacteria 246981
490 Ga0496126_0000009 3300048929 Bacteria 750350
491 Ga0501031_0013911 3300049568 Bacteria 5242
492 Ga0501031_0065587 3300049568 Bacteria 2365
493 Ga0501031_0070318 3300049568 Bacteria 2280
494 Ga0501032_0006872 3300049569 Bacteria 8340
495 Ga0501032_0062244 3300049569 Bacteria 2501
496 Ga0501033_0147381 3300049570 Bacteria 1699
497 Ga0501034_0017019 3300049571 Bacteria 7454
498 Ga0501034_0018926 3300049571 Bacteria 7054
499 Ga0501034_0473575 3300049571 Bacteria 1168
500 Ga0501034_0577810 3300049571 Bacteria 1031
501 Ga0501036_0008682 3300049572 Bacteria 8337
502 Ga0501036_0270690 3300049572 Bacteria 1422
503 Ga0501037_0012832 3300049573 Bacteria 6175
504 Ga0501037_0235033 3300049573 Bacteria 1286
505 Ga0501037_0261346 3300049573 Bacteria 1209
506 Ga0501038_0006592 3300049574 Bacteria 10736
507 Ga0501038_0134602 3300049574 Bacteria 2026
508 Ga0501038_0266899 3300049574 Bacteria 1351
509 Ga0501038_0513251 3300049574 Bacteria 915
510 Ga0501039_0028267 3300049575 Bacteria 4316
511 Ga0501039_0183533 3300049575 Bacteria 1645
512 Ga0501039_0189753 3300049575 Bacteria 1616
513 Ga0501039_0468153 3300049575 Bacteria 990
514 Ga0501039_0701342 3300049575 Bacteria 791
515 Ga0501040_0316580 3300049576 Bacteria 1116
516 Ga0501040_0558595 3300049576 Bacteria 826
517 Ga0501041_0057828 3300049577 Bacteria 2372
518 Ga0501042_0199654 3300049578 Bacteria 1442
519 Ga0501042_0367103 3300049578 Bacteria 1041
520 Ga0501042_0457845 3300049578 Bacteria 925
521 Ga0501046_0014566 3300049580 Bacteria 6628
522 Ga0501047_0008648 3300049581 Bacteria 9617
523 Ga0501047_0297808 3300049581 Bacteria 1456
524 Ga0501048_0003591 3300049582 Bacteria 11809
525 Ga0501048_0036870 3300049582 Bacteria 3513
526 Ga0501067_0000281 3300049583 Bacteria 27873
527 Ga0501067_0002797 3300049583 Bacteria 9600
528 Ga0501067_0034549 3300049583 Bacteria 2806
529 Ga0501068_0004750 3300049584 Bacteria 7389
530 Ga0501068_0045809 3300049584 Bacteria 2635
531 Ga0501069_0042743 3300049585 Bacteria 2508
532 Ga0501070_0001910 3300049586 Bacteria 18394
533 Ga0501070_0018477 3300049586 Bacteria 5849
534 Ga0501070_0065416 3300049586 Bacteria 3010
535 Ga0501070_0132964 3300049586 Bacteria 2054
536 Ga0501071_0001378 3300049587 Bacteria 13940
537 Ga0501071_0071865 3300049587 Bacteria 2523
538 Ga0501071_0191863 3300049587 Bacteria 1532
539 Ga0501072_0011705 3300049588 Bacteria 6703
540 Ga0501072_0014932 3300049588 Bacteria 5952
541 Ga0501072_0088659 3300049588 Bacteria 2455
542 Ga0501072_0219616 3300049588 Bacteria 1515
543 Ga0501072_0299898 3300049588 Bacteria 1277
544 Ga0501073_0002579 3300049589 Bacteria 13545
545 Ga0501073_0005522 3300049589 Bacteria 9471
546 Ga0501073_0074002 3300049589 Bacteria 2372
547 Ga0501074_0000114 3300049590 Bacteria 40265
548 Ga0501074_0000753 3300049590 Bacteria 20344
549 Ga0501075_0051704 3300049591 Bacteria 3090
550 Ga0501076_0686325 3300049592 Bacteria 845
551 Ga0501077_0013720 3300049593 Bacteria 5079
552 Ga0501209_058633 3300049656 Bacteria 1069
553 Ga0501079_0216234 3300049741 Bacteria 1497
554 Ga0501080_0004668 3300049742 Bacteria 12222
555 Ga0501080_0006655 3300049742 Bacteria 10398
556 Ga0501080_0340256 3300049742 Bacteria 1356
557 Ga0501080_0810744 3300049742 Bacteria 820
558 Ga0501083_0309084 3300049744 Bacteria 1028
559 Ga0501035_0043012 3300049822 Bacteria 4072
560 Ga0501035_0400964 3300049822 Bacteria 1141
561 Ga0501044_0015730 3300049823 Bacteria 8148
562 Ga0501045_0007675 3300049824 Bacteria 7503
563 Ga0501045_0149201 3300049824 Bacteria 1739
564 nmdc:mga03n38_201681_c1 3300050490 Bacteria 1030
565 nmdc:mga03n38_224828_c1 3300050490 Bacteria 981
566 nmdc:mga03n38_24974_c1 3300050490 Bacteria 2449
567 nmdc:mga03n38_47739_c1 3300050490 Bacteria 1897
568 nmdc:mga00v17_10109_c1 3300050491 Bacteria 5141
569 nmdc:mga00v17_151300_c1 3300050491 Bacteria 1491
570 nmdc:mga00v17_212805_c1 3300050491 Bacteria 1251
571 nmdc:mga00v17_24407_c1 3300050491 Bacteria 3507
572 nmdc:mga00v17_50109_c1 3300050491 Bacteria 2535
573 nmdc:mga0yw44_185107_c1 3300050492 Bacteria 1372
574 nmdc:mga0yw44_222707_c1 3300050492 Bacteria 1251
575 nmdc:mga0yw44_323611_c1 3300050492 Bacteria 1036
576 nmdc:mga0yw44_4214_c2 3300050492 Bacteria 2219
577 nmdc:mga0yw44_459896_c1 3300050492 Bacteria 862
578 nmdc:mga0yw44_5313_c1 3300050492 Bacteria 6057
579 nmdc:mga06z11_16124_c1 3300050494 Bacteria 3357
580 nmdc:mga06z11_269667_c1 3300050494 Bacteria 1006
581 nmdc:mga06z11_58334_c1 3300050494 Bacteria 2002
582 nmdc:mga06z11_8002_c1 3300050494 Bacteria 4382
583 nmdc:mga04h51_187422_c1 3300050495 Bacteria 808
584 nmdc:mga07m45_160542_c1 3300050496 Bacteria 1305
585 nmdc:mga07m45_177362_c1 3300050496 Bacteria 1239
586 nmdc:mga07m45_190266_c1 3300050496 Bacteria 1193
587 nmdc:mga07m45_5040_c1 3300050496 Bacteria 6527
588 nmdc:mga07m45_53873_c1 3300050496 Bacteria 2274
589 nmdc:mga0qj67_6418_c1 3300050509 Bacteria 8643
590 nmdc:mga08y16_288876_c1 3300050511 Bacteria 1691
591 nmdc:mga0sz30_12745_c1 3300050516 Bacteria 3275
592 nmdc:mga0sz30_15418_c1 3300050516 Bacteria 3020
593 Ga0495619_0187132 3300053085 Bacteria 1433
594 Ga0500644_0000179 3300053088 Bacteria 40770
595 Ga0500650_0155295 3300053098 Bacteria 1057
596 Ga0500568_0179268 3300053139 Bacteria 779
597 Ga0500573_0000757 3300053140 Bacteria 14484
598 Ga0500622_0236573 3300053156 Bacteria 810
599 Ga0501084_0079016 3300054114 Bacteria 2757
600 Ga0501082_0127106 3300060353 Bacteria 2211
601 Ga0501082_0294969 3300060353 Bacteria 1412
602 Ga0466962_0006557 3300061719 Bacteria 5587
603 Ga0466962_0020473 3300061719 Bacteria 3178

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046691 Ga0495670_0430571 Ga0495670_0430571_128_697 186
2 3300053156 Ga0500622_0236573 Ga0500622_0236573_12_650 205
3 3300050490 nmdc:mga03n38_224828_c1 nmdc:mga03n38_224828_c1_294_965 213
4 3300025937 Ga0207669_10158540 Ga0207669_101585403 219
5 iso_pu_bacteria 2738543034 2739363954 221
6 3300028379 Ga0268266_10002050 Ga0268266_1000205011 223
7 3300041494 Ga0451837_1701886 Ga0451837_1701886_71_751 223
8 3300048906 Ga0496103_0353309 Ga0496103_0353309_14_718 223
9 3300031727 Ga0316576_10507928 Ga0316576_105079281 224
10 3300031733 Ga0316577_10015368 Ga0316577_100153681 224
11 3300035398 Ga0316574_0009266 Ga0316574_0009266_4708_5394 224
12 3300036647 Ga0316582_0450050 Ga0316582_0450050_168_854 224
13 3300036712 Ga0316584_0183904 Ga0316584_0183904_802_1488 224
14 3300049586 Ga0501070_0132964 Ga0501070_0132964_343_1086 224
15 3300049741 Ga0501079_0216234 Ga0501079_0216234_431_1174 224
16 3300049742 Ga0501080_0810744 Ga0501080_0810744_19_762 224
17 3300031731 Ga0307405_10382348 Ga0307405_103823481 225
18 3300038741 Ga0400488_22546 Ga0400488_22546_1470_2213 225
19 3300006051 Ga0075364_10103027 Ga0075364_101030273 226
20 3300006186 Ga0075369_10015997 Ga0075369_100159973 226
21 3300013307 Ga0157372_10624792 Ga0157372_106247922 226
22 3300026118 Ga0207675_100430180 Ga0207675_1004301802 226
23 3300031731 Ga0307405_10434991 Ga0307405_104349911 226
24 3300041443 Ga0451789_0746420 Ga0451789_0746420_95_835 226
25 3300046455 Ga0495603_0172054 Ga0495603_0172054_263_970 226
26 3300046794 Ga0495589_0048932 Ga0495589_0048932_624_1331 226
27 3300047321 Ga0495676_0059561 Ga0495676_0059561_742_1449 226
28 3300048917 Ga0496114_0026952 Ga0496114_0026952_31_774 226
29 3300049568 Ga0501031_0013911 Ga0501031_0013911_698_1441 226
30 3300049576 Ga0501040_0316580 Ga0501040_0316580_87_830 226
31 3300050491 nmdc:mga00v17_50109_c1 nmdc:mga00v17_50109_c1_130_876 226
32 3300050516 nmdc:mga0sz30_15418_c1 nmdc:mga0sz30_15418_c1_1231_1974 226
33 3300060353 Ga0501082_0294969 Ga0501082_0294969_424_1167 226
34 3300005327 Ga0070658_10655437 Ga0070658_106554371 227
35 3300005367 Ga0070667_100645933 Ga0070667_1006459331 227
36 3300009148 Ga0105243_10014166 Ga0105243_100141667 227
37 3300013308 Ga0157375_10139821 Ga0157375_101398213 227
38 3300013308 Ga0157375_10475597 Ga0157375_104755972 227
39 3300025972 Ga0207668_10050720 Ga0207668_100507203 227
40 3300031691 Ga0316579_10000077 Ga0316579_1000007716 227
41 3300031824 Ga0307413_10348456 Ga0307413_103484562 227
42 3300031995 Ga0307409_100453401 Ga0307409_1004534012 227
43 3300044901 Ga0466960_0004596 Ga0466960_0004596_347_1090 227
44 3300048911 Ga0496108_0396344 Ga0496108_0396344_159_914 227
45 3300049568 Ga0501031_0070318 Ga0501031_0070318_189_932 228
46 3300049572 Ga0501036_0270690 Ga0501036_0270690_45_788 228
47 3300049575 Ga0501039_0701342 Ga0501039_0701342_28_771 228
48 3300049576 Ga0501040_0558595 Ga0501040_0558595_26_769 228
49 3300049578 Ga0501042_0457845 Ga0501042_0457845_166_909 228
50 3300049582 Ga0501048_0036870 Ga0501048_0036870_269_1012 228
51 3300049587 Ga0501071_0071865 Ga0501071_0071865_825_1568 228
52 3300049588 Ga0501072_0014932 Ga0501072_0014932_375_1118 228
53 3300049591 Ga0501075_0051704 Ga0501075_0051704_1013_1756 228
54 3300049822 Ga0501035_0400964 Ga0501035_0400964_325_1068 228
55 3300049824 Ga0501045_0149201 Ga0501045_0149201_455_1198 228
56 3300050492 nmdc:mga0yw44_4214_c2 nmdc:mga0yw44_4214_c2_228_971 228
57 3300060353 Ga0501082_0127106 Ga0501082_0127106_1385_2128 228
58 3300009545 Ga0105237_10347805 Ga0105237_103478051 229
59 3300013104 Ga0157370_10249476 Ga0157370_102494763 230
60 3300014326 Ga0157380_10157151 Ga0157380_101571513 231
61 3300044658 Ga0466972_0033184 Ga0466972_0033184_1499_2239 232
62 3300044693 Ga0466961_0063191 Ga0466961_0063191_788_1528 232
63 3300044706 Ga0466964_0012466 Ga0466964_0012466_1626_2366 232
64 3300044719 Ga0466971_0084901 Ga0466971_0084901_413_1153 232
65 3300044842 Ga0466957_0024565 Ga0466957_0024565_91_831 232
66 3300045836 Ga0466958_0176824 Ga0466958_0176824_595_1335 232
67 3300045976 Ga0466967_0026902 Ga0466967_0026902_3038_3778 232
68 3300061719 Ga0466962_0020473 Ga0466962_0020473_102_842 232
69 3300005719 Ga0068861_100102208 Ga0068861_1001022082 233
70 3300009148 Ga0105243_10116392 Ga0105243_101163923 233
71 3300014326 Ga0157380_10766622 Ga0157380_107666221 233
72 3300020082 Ga0206353_11108400 Ga0206353_111084003 233
73 3300026075 Ga0207708_10017225 Ga0207708_100172253 233
74 3300026118 Ga0207675_100013494 Ga0207675_1000134944 233
75 3300031727 Ga0316576_10082548 Ga0316576_100825482 233
76 3300031731 Ga0307405_10485164 Ga0307405_104851642 233
77 3300031901 Ga0307406_10295522 Ga0307406_102955222 233
78 3300031995 Ga0307409_100010399 Ga0307409_1000103994 233
79 3300031995 Ga0307409_100341147 Ga0307409_1003411472 233
80 3300032002 Ga0307416_100187712 Ga0307416_1001877121 233
81 3300032126 Ga0307415_100018929 Ga0307415_1000189295 233
82 3300044684 Ga0466966_0147585 Ga0466966_0147585_198_932 233
83 3300045049 Ga0466959_0080803 Ga0466959_0080803_296_1030 233
84 3300005329 Ga0070683_100001445 Ga0070683_10000144510 234
85 3300005337 Ga0070682_100013638 Ga0070682_1000136386 234
86 3300005345 Ga0070692_10007753 Ga0070692_100077533 234
87 3300005535 Ga0070684_100005967 Ga0070684_1000059674 234
88 3300005535 Ga0070684_100126792 Ga0070684_1001267923 234
89 3300005539 Ga0068853_100052096 Ga0068853_1000520965 234
90 3300005544 Ga0070686_100038187 Ga0070686_1000381874 234
91 3300005548 Ga0070665_100176415 Ga0070665_1001764153 234
92 3300005577 Ga0068857_100001052 Ga0068857_10000105221 234
93 3300005616 Ga0068852_100289128 Ga0068852_1002891282 234
94 3300005843 Ga0068860_100406271 Ga0068860_1004062712 234
95 3300006881 Ga0068865_100032731 Ga0068865_1000327313 234
96 3300009098 Ga0105245_10003998 Ga0105245_1000399810 234
97 3300009148 Ga0105243_10007184 Ga0105243_100071849 234
98 3300009176 Ga0105242_10344532 Ga0105242_103445322 234
99 3300009553 Ga0105249_10069615 Ga0105249_100696152 234
100 3300010375 Ga0105239_10001993 Ga0105239_100019938 234
101 3300011119 Ga0105246_10000815 Ga0105246_1000081515 234
102 3300013105 Ga0157369_10014254 Ga0157369_100142548 234
103 3300013306 Ga0163162_10014982 Ga0163162_100149821 234
104 3300013307 Ga0157372_10002613 Ga0157372_100026136 234
105 3300014325 Ga0163163_10355422 Ga0163163_103554222 234
106 3300014968 Ga0157379_10105912 Ga0157379_101059122 234
107 3300025901 Ga0207688_10003254 Ga0207688_1000325411 234
108 3300025927 Ga0207687_10003039 Ga0207687_1000303910 234
109 3300025932 Ga0207690_10004172 Ga0207690_100041726 234
110 3300025941 Ga0207711_10556845 Ga0207711_105568451 234
111 3300025944 Ga0207661_10011065 Ga0207661_100110653 234
112 3300025960 Ga0207651_10880045 Ga0207651_108800451 234
113 3300025961 Ga0207712_10054044 Ga0207712_100540442 234
114 3300026067 Ga0207678_10059810 Ga0207678_100598104 234
115 3300026095 Ga0207676_10026631 Ga0207676_100266312 234
116 3300026116 Ga0207674_10001835 Ga0207674_100018355 234
117 3300026142 Ga0207698_10045971 Ga0207698_100459713 234
118 3300028379 Ga0268266_10152404 Ga0268266_101524042 234
119 3300028381 Ga0268264_10302450 Ga0268264_103024502 234
120 3300035398 Ga0316574_0198282 Ga0316574_0198282_294_1079 234
121 3300041997 Ga0439431_0003122 Ga0439431_0003122_631_1374 234
122 3300042004 Ga0439445_0042078 Ga0439445_0042078_200_943 234
123 3300042156 Ga0439446_0033993 Ga0439446_0033993_694_1437 234
124 3300042435 Ga0439434_0014582 Ga0439434_0014582_719_1462 234
125 3300045051 Ga0451576_0054279 Ga0451576_0054279_372_1115 234
126 3300048903 Ga0496100_0104710 Ga0496100_0104710_184_927 234
127 3300048905 Ga0496102_0070317 Ga0496102_0070317_1029_1772 234
128 3300048909 Ga0496106_0100823 Ga0496106_0100823_870_1613 234
129 3300048910 Ga0496107_0034962 Ga0496107_0034962_1449_2192 234
130 3300048911 Ga0496108_0056359 Ga0496108_0056359_37_780 234
131 3300048912 Ga0496109_0004303 Ga0496109_0004303_75_818 234
132 3300048913 Ga0496110_0009667 Ga0496110_0009667_3643_4386 234
133 3300048914 Ga0496111_0045912 Ga0496111_0045912_53_796 234
134 3300048917 Ga0496114_0135452 Ga0496114_0135452_1284_2027 234
135 3300048917 Ga0496114_0212106 Ga0496114_0212106_428_1171 234
136 3300049575 Ga0501039_0468153 Ga0501039_0468153_19_762 234
137 3300049585 Ga0501069_0042743 Ga0501069_0042743_1399_2142 234
138 3300049656 Ga0501209_058633 Ga0501209_058633_239_982 234
139 3300005329 Ga0070683_100374454 Ga0070683_1003744541 235
140 3300005339 Ga0070660_100091318 Ga0070660_1000913181 235
141 3300005364 Ga0070673_100344744 Ga0070673_1003447442 235
142 3300005366 Ga0070659_100122691 Ga0070659_1001226913 235
143 3300005616 Ga0068852_100231103 Ga0068852_1002311033 235
144 3300005985 Ga0081539_10004844 Ga0081539_1000484412 235
145 3300005985 Ga0081539_10018104 Ga0081539_100181043 235
146 3300006038 Ga0075365_10163980 Ga0075365_101639801 235
147 3300014325 Ga0163163_10177716 Ga0163163_101777163 235
148 3300014968 Ga0157379_10417977 Ga0157379_104179772 235
149 3300017792 Ga0163161_10008550 Ga0163161_100085504 235
150 3300025904 Ga0207647_10052368 Ga0207647_100523684 235
151 3300025919 Ga0207657_10027101 Ga0207657_100271015 235
152 3300025932 Ga0207690_10178437 Ga0207690_101784371 235
153 3300025944 Ga0207661_10364274 Ga0207661_103642741 235
154 3300025944 Ga0207661_10783673 Ga0207661_107836731 235
155 3300025981 Ga0207640_10322984 Ga0207640_103229842 235
156 3300026142 Ga0207698_10261283 Ga0207698_102612831 235
157 3300031901 Ga0307406_10214727 Ga0307406_102147271 235
158 3300035398 Ga0316574_0086504 Ga0316574_0086504_677_1435 235
159 3300041404 Ga0439436_0055029 Ga0439436_0055029_22_765 235
160 3300041509 Ga0451843_0422325 Ga0451843_0422325_457_1200 235
161 3300044684 Ga0466966_0020914 Ga0466966_0020914_2193_2936 235
162 3300044693 Ga0466961_0035712 Ga0466961_0035712_1541_2284 235
163 3300044694 Ga0466963_0030387 Ga0466963_0030387_2387_3130 235
164 3300044694 Ga0466963_0131421 Ga0466963_0131421_716_1459 235
165 3300044694 Ga0466963_0260927 Ga0466963_0260927_110_853 235
166 3300044765 Ga0466970_0024604 Ga0466970_0024604_2150_2893 235
167 3300044765 Ga0466970_0064225 Ga0466970_0064225_424_1167 235
168 3300044842 Ga0466957_0012126 Ga0466957_0012126_910_1653 235
169 3300044842 Ga0466957_0127261 Ga0466957_0127261_595_1338 235
170 3300045976 Ga0466967_0092787 Ga0466967_0092787_514_1257 235
171 3300047315 Ga0495581_0140779 Ga0495581_0140779_45_788 235
172 3300047321 Ga0495676_0041245 Ga0495676_0041245_1589_2329 235
173 3300047321 Ga0495676_0068800 Ga0495676_0068800_1292_2035 235
174 3300048911 Ga0496108_0063429 Ga0496108_0063429_323_1072 235
175 3300048917 Ga0496114_0023846 Ga0496114_0023846_3683_4432 235
176 3300049571 Ga0501034_0017019 Ga0501034_0017019_1806_2549 235
177 3300049573 Ga0501037_0261346 Ga0501037_0261346_58_801 235
178 3300049583 Ga0501067_0000281 Ga0501067_0000281_5297_6040 235
179 3300049586 Ga0501070_0001910 Ga0501070_0001910_10992_11735 235
180 3300049587 Ga0501071_0001378 Ga0501071_0001378_4446_5189 235
181 3300049588 Ga0501072_0011705 Ga0501072_0011705_4356_5099 235
182 3300049589 Ga0501073_0002579 Ga0501073_0002579_3768_4511 235
183 3300049590 Ga0501074_0000114 Ga0501074_0000114_12795_13538 235
184 3300049742 Ga0501080_0004668 Ga0501080_0004668_5335_6078 235
185 3300054114 Ga0501084_0079016 Ga0501084_0079016_1958_2701 235
186 3300001979 JGI24740J21852_10012489 JGI24740J21852_100124891 236
187 3300005335 Ga0070666_10117686 Ga0070666_101176862 236
188 3300005367 Ga0070667_100006772 Ga0070667_1000067722 236
189 3300005530 Ga0070679_100000778 Ga0070679_10000077813 236
190 3300006038 Ga0075365_10052811 Ga0075365_100528113 236
191 3300006038 Ga0075365_10103238 Ga0075365_101032382 236
192 3300006038 Ga0075365_10177082 Ga0075365_101770822 236
193 3300006353 Ga0075370_10171899 Ga0075370_101718992 236
194 3300011119 Ga0105246_10596243 Ga0105246_105962431 236
195 3300020082 Ga0206353_11418486 Ga0206353_114184863 236
196 3300025903 Ga0207680_10097225 Ga0207680_100972252 236
197 3300025904 Ga0207647_10048574 Ga0207647_100485743 236
198 3300025919 Ga0207657_10079100 Ga0207657_100791003 236
199 3300025986 Ga0207658_10012145 Ga0207658_100121452 236
200 3300026116 Ga0207674_10422523 Ga0207674_104225232 236
201 3300031824 Ga0307413_10000463 Ga0307413_100004634 236
202 3300031995 Ga0307409_100396726 Ga0307409_1003967262 236
203 3300032002 Ga0307416_100177321 Ga0307416_1001773213 236
204 3300041443 Ga0451789_0761823 Ga0451789_0761823_157_909 236
205 3300042146 Ga0450907_027452 Ga0450907_027452_61_804 236
206 3300044658 Ga0466972_0215953 Ga0466972_0215953_49_795 236
207 3300044765 Ga0466970_0051545 Ga0466970_0051545_1102_1851 236
208 3300045976 Ga0466967_0141503 Ga0466967_0141503_1462_2211 236
209 3300048903 Ga0496100_0000905 Ga0496100_0000905_2143_2886 236
210 3300048904 Ga0496101_0000086 Ga0496101_0000086_11232_11975 236
211 3300048905 Ga0496102_0005826 Ga0496102_0005826_3409_4152 236
212 3300048906 Ga0496103_0000804 Ga0496103_0000804_16520_17263 236
213 3300048909 Ga0496106_0005886 Ga0496106_0005886_1123_1866 236
214 3300048910 Ga0496107_0001622 Ga0496107_0001622_2068_2811 236
215 3300048911 Ga0496108_0001685 Ga0496108_0001685_11257_12000 236
216 3300048912 Ga0496109_0001458 Ga0496109_0001458_7645_8388 236
217 3300048912 Ga0496109_0060924 Ga0496109_0060924_1449_2192 236
218 3300048913 Ga0496110_0000730 Ga0496110_0000730_18561_19304 236
219 3300048915 Ga0496112_0361321 Ga0496112_0361321_199_942 236
220 3300048916 Ga0496113_0028183 Ga0496113_0028183_1763_2506 236
221 3300048917 Ga0496114_0002569 Ga0496114_0002569_1909_2652 236
222 3300048919 Ga0496116_0027928 Ga0496116_0027928_2053_2796 236
223 3300048920 Ga0496117_0018503 Ga0496117_0018503_2053_2796 236
224 3300048921 Ga0496118_0013363 Ga0496118_0013363_3932_4675 236
225 3300048922 Ga0496119_0014727 Ga0496119_0014727_3127_3870 236
226 3300048923 Ga0496120_0032045 Ga0496120_0032045_619_1362 236
227 3300048924 Ga0496121_0000002 Ga0496121_0000002_615555_616298 236
228 3300048925 Ga0496122_0000078 Ga0496122_0000078_202087_202830 236
229 3300048926 Ga0496123_0028187 Ga0496123_0028187_1318_2061 236
230 3300048927 Ga0496124_0000002 Ga0496124_0000002_878291_879034 236
231 3300048928 Ga0496125_0000002 Ga0496125_0000002_615555_616298 236
232 3300048929 Ga0496126_0000009 Ga0496126_0000009_134053_134796 236
233 3300049583 Ga0501067_0002797 Ga0501067_0002797_6624_7367 236
234 3300049583 Ga0501067_0034549 Ga0501067_0034549_1393_2136 236
235 3300049584 Ga0501068_0004750 Ga0501068_0004750_4438_5181 236
236 3300049586 Ga0501070_0018477 Ga0501070_0018477_311_1054 236
237 3300049587 Ga0501071_0191863 Ga0501071_0191863_494_1237 236
238 3300049589 Ga0501073_0005522 Ga0501073_0005522_7579_8322 236
239 3300049590 Ga0501074_0000753 Ga0501074_0000753_12850_13593 236
240 3300049593 Ga0501077_0013720 Ga0501077_0013720_2553_3296 236
241 3300049742 Ga0501080_0006655 Ga0501080_0006655_51_794 236
242 3300050492 nmdc:mga0yw44_323611_c1 nmdc:mga0yw44_323611_c1_234_977 236
243 3300050492 nmdc:mga0yw44_5313_c1 nmdc:mga0yw44_5313_c1_4507_5250 236
244 3300050496 nmdc:mga07m45_177362_c1 nmdc:mga07m45_177362_c1_170_913 236
245 3300053085 Ga0495619_0187132 Ga0495619_0187132_90_833 236
246 3300006048 Ga0075363_100024374 Ga0075363_1000243742 237
247 3300006178 Ga0075367_10137558 Ga0075367_101375582 237
248 3300028381 Ga0268264_10267850 Ga0268264_102678502 237
249 3300031251 Ga0265327_10002433 Ga0265327_1000243318 237
250 3300044842 Ga0466957_0470565 Ga0466957_0470565_97_846 237
251 3300045976 Ga0466967_0233178 Ga0466967_0233178_247_996 237
252 3300050490 nmdc:mga03n38_201681_c1 nmdc:mga03n38_201681_c1_153_896 237
253 3300050492 nmdc:mga0yw44_459896_c1 nmdc:mga0yw44_459896_c1_27_776 237
254 3300050494 nmdc:mga06z11_269667_c1 nmdc:mga06z11_269667_c1_247_990 237
255 3300050495 nmdc:mga04h51_187422_c1 nmdc:mga04h51_187422_c1_53_796 237
256 3300050509 nmdc:mga0qj67_6418_c1 nmdc:mga0qj67_6418_c1_2347_3099 238
257 iso_pu_bacteria 2816332139 2816505769 239
258 3300044656 Ga0466969_0127025 Ga0466969_0127025_252_998 240
259 3300044765 Ga0466970_0072524 Ga0466970_0072524_395_1141 240
260 3300046530 Ga0495654_0047676 Ga0495654_0047676_834_1580 240
261 3300048903 Ga0496100_0178702 Ga0496100_0178702_366_1112 240
262 3300048905 Ga0496102_0278286 Ga0496102_0278286_553_1299 240
263 3300048920 Ga0496117_0008944 Ga0496117_0008944_4731_5477 240
264 3300048921 Ga0496118_0000173 Ga0496118_0000173_111767_112513 240
265 3300048922 Ga0496119_0050783 Ga0496119_0050783_885_1631 240
266 3300048923 Ga0496120_0084319 Ga0496120_0084319_212_958 240
267 3300048926 Ga0496123_0033158 Ga0496123_0033158_1871_2617 240
268 3300048927 Ga0496124_0000135 Ga0496124_0000135_148156_148902 240
269 3300048927 Ga0496124_0114339 Ga0496124_0114339_1133_1879 240
270 3300053140 Ga0500573_0000757 Ga0500573_0000757_3266_4012 240
271 iso_pu_bacteria 2643221613 2644080866 240
272 iso_pu_bacteria 2643221721 2644663817 240
273 iso_pu_bacteria 2738541264 2738665857 240
274 iso_pu_bacteria 2738541272 2738694857 240
275 iso_pu_bacteria 2738541356 2739144991 240
276 iso_pu_bacteria 2738543027 2739325799 240
277 iso_pu_bacteria 2739367654 2739608493 240
278 iso_pu_bacteria 2758568522 2760305846 240
279 iso_pu_bacteria 2758568621 2760625640 240
280 iso_pu_bacteria 2808606394 2809030680 240
281 iso_pu_bacteria 2887443736 2887446823 240
282 iso_pu_bacteria 2935890801 2935892362 240
283 iso_pu_bacteria 8056579771 8056584750 240
284 3300003203 JGI25406J46586_10013775 JGI25406J46586_100137754 241
285 3300005329 Ga0070683_100280538 Ga0070683_1002805382 241
286 3300005985 Ga0081539_10000401 Ga0081539_1000040156 241
287 3300013105 Ga0157369_10149211 Ga0157369_101492112 241
288 3300025920 Ga0207649_10438981 Ga0207649_104389812 241
289 3300028794 Ga0307515_10085380 Ga0307515_100853801 241
290 3300030522 Ga0307512_10004546 Ga0307512_1000454616 241
291 3300031456 Ga0307513_10465042 Ga0307513_104650421 241
292 3300031824 Ga0307413_10064546 Ga0307413_100645462 241
293 3300031852 Ga0307410_10638689 Ga0307410_106386891 241
294 3300031911 Ga0307412_10546605 Ga0307412_105466051 241
295 3300032002 Ga0307416_100671994 Ga0307416_1006719942 241
296 3300037853 Ga0436364_0913214 Ga0436364_0913214_5224_6009 241
297 3300044684 Ga0466966_0001077 Ga0466966_0001077_11970_12710 241
298 3300044694 Ga0466963_0000115 Ga0466963_0000115_11373_12113 241
299 3300044719 Ga0466971_0014554 Ga0466971_0014554_183_923 241
300 3300044735 Ga0466968_0032127 Ga0466968_0032127_881_1627 241
301 3300044765 Ga0466970_0028523 Ga0466970_0028523_958_1698 241
302 3300044842 Ga0466957_0001123 Ga0466957_0001123_12008_12748 241
303 3300045049 Ga0466959_0075272 Ga0466959_0075272_573_1313 241
304 3300045836 Ga0466958_0000458 Ga0466958_0000458_5589_6329 241
305 3300045976 Ga0466967_0151939 Ga0466967_0151939_421_1161 241
306 3300045976 Ga0466967_0298166 Ga0466967_0298166_577_1317 241
307 3300048921 Ga0496118_0036261 Ga0496118_0036261_1573_2322 241
308 3300048925 Ga0496122_0005671 Ga0496122_0005671_13880_14629 241
309 3300048928 Ga0496125_0000069 Ga0496125_0000069_38625_39374 241
310 3300053098 Ga0500650_0155295 Ga0500650_0155295_153_914 241
311 3300061719 Ga0466962_0006557 Ga0466962_0006557_1884_2624 241
312 iso_pu_bacteria 2643221961 2645722306 241
313 iso_pu_bacteria 2643221962 2645725184 241
314 iso_pu_bacteria 2795385470 2795781274 241
315 iso_pu_bacteria 2866612099 2866617295 241
316 3300044683 Ga0466965_0009079 Ga0466965_0009079_3288_4019 242
317 3300044684 Ga0466966_0380467 Ga0466966_0380467_62_805 242
318 3300044693 Ga0466961_0089039 Ga0466961_0089039_1056_1799 242
319 3300045049 Ga0466959_0049346 Ga0466959_0049346_660_1403 242
320 3300053139 Ga0500568_0179268 Ga0500568_0179268_32_763 242
321 iso_pu_bacteria 2643221561 2643824371 242
322 iso_pu_bacteria 2643221576 2643890328 242
323 iso_pu_bacteria 2643221590 2643959384 242
324 iso_pu_bacteria 2643221657 2644320730 242
325 iso_pu_bacteria 2643221696 2644534737 242
326 iso_pu_bacteria 2643221711 2644607752 242
327 iso_pu_bacteria 2818991458 2819665104 242
328 iso_pu_bacteria 2857481737 2857485043 242
329 iso_pu_bacteria 2866552031 2866555741 242
330 iso_pu_bacteria 8054609563 8054613630 242
331 3300002073 JGI24745J21846_1001844 JGI24745J21846_10018443 243
332 3300003203 JGI25406J46586_10005697 JGI25406J46586_100056972 243
333 3300003792 Ga0055540_1000069 Ga0055540_100006943 243
334 3300005327 Ga0070658_10076640 Ga0070658_100766402 243
335 3300005329 Ga0070683_100310104 Ga0070683_1003101042 243
336 3300005334 Ga0068869_100052208 Ga0068869_1000522083 243
337 3300005338 Ga0068868_100155532 Ga0068868_1001555322 243
338 3300005341 Ga0070691_10065190 Ga0070691_100651901 243
339 3300005347 Ga0070668_100000963 Ga0070668_10000096323 243
340 3300005347 Ga0070668_100150343 Ga0070668_1001503432 243
341 3300005354 Ga0070675_100184765 Ga0070675_1001847652 243
342 3300005355 Ga0070671_100124269 Ga0070671_1001242692 243
343 3300005356 Ga0070674_100135387 Ga0070674_1001353872 243
344 3300005365 Ga0070688_100330998 Ga0070688_1003309981 243
345 3300005435 Ga0070714_100009318 Ga0070714_1000093186 243
346 3300005437 Ga0070710_10000504 Ga0070710_100005042 243
347 3300005455 Ga0070663_100030289 Ga0070663_1000302893 243
348 3300005457 Ga0070662_100112899 Ga0070662_1001128993 243
349 3300005459 Ga0068867_100239097 Ga0068867_1002390972 243
350 3300005539 Ga0068853_100306199 Ga0068853_1003061992 243
351 3300005547 Ga0070693_100278269 Ga0070693_1002782692 243
352 3300005578 Ga0068854_100015711 Ga0068854_1000157118 243
353 3300005615 Ga0070702_100115877 Ga0070702_1001158772 243
354 3300005617 Ga0068859_100196471 Ga0068859_1001964712 243
355 3300005719 Ga0068861_100049509 Ga0068861_1000495092 243
356 3300005843 Ga0068860_100129700 Ga0068860_1001297002 243
357 3300005844 Ga0068862_100317680 Ga0068862_1003176802 243
358 3300005985 Ga0081539_10001059 Ga0081539_1000105922 243
359 3300006881 Ga0068865_100128016 Ga0068865_1001280162 243
360 3300006931 Ga0097620_100196484 Ga0097620_1001964842 243
361 3300009094 Ga0111539_10296615 Ga0111539_102966152 243
362 3300009101 Ga0105247_10063916 Ga0105247_100639164 243
363 3300009176 Ga0105242_10200620 Ga0105242_102006202 243
364 3300009545 Ga0105237_10024837 Ga0105237_100248373 243
365 3300009553 Ga0105249_10032672 Ga0105249_100326724 243
366 3300009986 Ga0105033_101393 Ga0105033_1013932 243
367 3300010375 Ga0105239_10010349 Ga0105239_100103493 243
368 3300013102 Ga0157371_10517358 Ga0157371_105173582 243
369 3300013306 Ga0163162_10091249 Ga0163162_100912493 243
370 3300014968 Ga0157379_10130391 Ga0157379_101303912 243
371 3300021384 Ga0213876_10055421 Ga0213876_100554212 243
372 3300025303 Ga0209051_1000034 Ga0209051_1000034286 243
373 3300025898 Ga0207692_10000113 Ga0207692_100001133 243
374 3300025901 Ga0207688_10048479 Ga0207688_100484793 243
375 3300025904 Ga0207647_10032967 Ga0207647_100329672 243
376 3300025914 Ga0207671_10015402 Ga0207671_100154023 243
377 3300025914 Ga0207671_10233044 Ga0207671_102330442 243
378 3300025920 Ga0207649_10126274 Ga0207649_101262742 243
379 3300025927 Ga0207687_10049776 Ga0207687_100497762 243
380 3300025929 Ga0207664_10003778 Ga0207664_100037789 243
381 3300025932 Ga0207690_10032084 Ga0207690_100320842 243
382 3300025933 Ga0207706_10019667 Ga0207706_100196678 243
383 3300025937 Ga0207669_10029278 Ga0207669_100292781 243
384 3300025941 Ga0207711_10097215 Ga0207711_100972154 243
385 3300025961 Ga0207712_10160189 Ga0207712_101601892 243
386 3300025972 Ga0207668_10002836 Ga0207668_100028364 243
387 3300025972 Ga0207668_10247666 Ga0207668_102476662 243
388 3300025981 Ga0207640_10034143 Ga0207640_100341434 243
389 3300025986 Ga0207658_10215519 Ga0207658_102155192 243
390 3300025986 Ga0207658_10583197 Ga0207658_105831971 243
391 3300026023 Ga0207677_10066661 Ga0207677_100666613 243
392 3300027907 Ga0207428_10152644 Ga0207428_101526443 243
393 3300028379 Ga0268266_10043357 Ga0268266_100433572 243
394 3300028380 Ga0268265_10017253 Ga0268265_100172535 243
395 3300028794 Ga0307515_10022429 Ga0307515_100224299 243
396 3300030522 Ga0307512_10175866 Ga0307512_101758661 243
397 3300030732 Ga0316176_1056925 Ga0316176_10569256 243
398 3300030733 Ga0314311_1197282 Ga0314311_11972822 243
399 3300031456 Ga0307513_10009960 Ga0307513_100099608 243
400 3300031665 Ga0316575_10000002 Ga0316575_1000000247 243
401 3300031824 Ga0307413_10315576 Ga0307413_103155762 243
402 3300031903 Ga0307407_10327846 Ga0307407_103278461 243
403 3300032005 Ga0307411_10001252 Ga0307411_100012527 243
404 3300035172 Ga0373955_0158288 Ga0373955_0158288_95_853 243
405 3300037418 Ga0395900_0023149 Ga0395900_0023149_3200_3940 243
406 3300039110 Ga0400487_39832 Ga0400487_39832_2061_2807 243
407 3300039437 Ga0436365_0419767 Ga0436365_0419767_449_1189 243
408 3300042005 Ga0439448_0022163 Ga0439448_0022163_402_1154 243
409 3300044658 Ga0466972_0006954 Ga0466972_0006954_890_1636 243
410 3300044683 Ga0466965_0020112 Ga0466965_0020112_1544_2290 243
411 3300044683 Ga0466965_0028079 Ga0466965_0028079_891_1637 243
412 3300044694 Ga0466963_0175993 Ga0466963_0175993_84_854 243
413 3300044765 Ga0466970_0015172 Ga0466970_0015172_2482_3231 243
414 3300044765 Ga0466970_0079765 Ga0466970_0079765_669_1421 243
415 3300044901 Ga0466960_0000485 Ga0466960_0000485_4509_5255 243
416 3300044901 Ga0466960_0034563 Ga0466960_0034563_1176_1946 243
417 3300044901 Ga0466960_0075045 Ga0466960_0075045_492_1238 243
418 3300045976 Ga0466967_0044891 Ga0466967_0044891_1862_2605 243
419 3300045976 Ga0466967_0266691 Ga0466967_0266691_298_1068 243
420 3300048914 Ga0496111_0085581 Ga0496111_0085581_1092_1832 243
421 3300048917 Ga0496114_0211574 Ga0496114_0211574_257_997 243
422 3300049574 Ga0501038_0513251 Ga0501038_0513251_76_816 243
423 3300050511 nmdc:mga08y16_288876_c1 nmdc:mga08y16_288876_c1_77_817 243
424 iso_pu_bacteria 2585427649 2586064745 243
425 iso_pu_bacteria 2643221635 2644197208 243
426 iso_pu_bacteria 2751185734 2753069767 243
427 iso_pu_bacteria 2751185788 2753303533 243
428 iso_pu_bacteria 2795385472 2795791816 243
429 iso_pu_bacteria 2808606522 2809586021 243
430 iso_pu_bacteria 2891326441 2891331664 243
431 iso_pu_bacteria 2904430863 2904432553 243
432 iso_pu_bacteria 2904501621 2904501663 243
433 iso_pu_bacteria 2908674828 2908676283 243
434 iso_pu_bacteria 2909074476 2909077167 243
435 iso_pu_bacteria 2915768154 2915773076 243
436 iso_pu_bacteria 2917736166 2917741334 243
437 iso_pu_bacteria 2919039151 2919041861 243
438 iso_pu_bacteria 2919042368 2919043359 243
439 iso_pu_bacteria 2928104781 2928105628 243
440 iso_pu_bacteria 2928500415 2928500783 243
441 iso_pu_bacteria 2946003308 2946006961 243
442 iso_pu_bacteria 2984551494 2984551824 243
443 iso_pu_bacteria 8003314358 8003322985 243
444 iso_pu_bacteria 8047710418 8047718467 243
445 iso_pu_bacteria 8055412473 8055418344 243
446 3300003578 Ga0006562J51391_1199253 Ga0006562J51391_11992531 244
447 3300005329 Ga0070683_100047993 Ga0070683_1000479934 244
448 3300005337 Ga0070682_100014903 Ga0070682_1000149034 244
449 3300005338 Ga0068868_100076813 Ga0068868_1000768132 244
450 3300005339 Ga0070660_100197323 Ga0070660_1001973232 244
451 3300005345 Ga0070692_10004256 Ga0070692_100042565 244
452 3300005356 Ga0070674_100282983 Ga0070674_1002829832 244
453 3300005365 Ga0070688_100190680 Ga0070688_1001906802 244
454 3300005366 Ga0070659_100237441 Ga0070659_1002374412 244
455 3300005441 Ga0070700_100004562 Ga0070700_1000045626 244
456 3300005466 Ga0070685_10010211 Ga0070685_100102114 244
457 3300005547 Ga0070693_100243612 Ga0070693_1002436121 244
458 3300005615 Ga0070702_100031694 Ga0070702_1000316942 244
459 3300005840 Ga0068870_10011937 Ga0068870_100119374 244
460 3300005843 Ga0068860_100000539 Ga0068860_10000053933 244
461 3300005983 Ga0081540_1023161 Ga0081540_10231613 244
462 3300005985 Ga0081539_10092009 Ga0081539_100920091 244
463 3300006038 Ga0075365_10018799 Ga0075365_100187993 244
464 3300006038 Ga0075365_10059042 Ga0075365_100590423 244
465 3300006038 Ga0075365_10091368 Ga0075365_100913682 244
466 3300006038 Ga0075365_10249280 Ga0075365_102492801 244
467 3300006042 Ga0075368_10024343 Ga0075368_100243432 244
468 3300006048 Ga0075363_100001876 Ga0075363_1000018763 244
469 3300006048 Ga0075363_100114471 Ga0075363_1001144712 244
470 3300006051 Ga0075364_10031207 Ga0075364_100312075 244
471 3300006051 Ga0075364_10100711 Ga0075364_101007111 244
472 3300006051 Ga0075364_10159985 Ga0075364_101599852 244
473 3300006178 Ga0075367_10065731 Ga0075367_100657313 244
474 3300006178 Ga0075367_10171244 Ga0075367_101712442 244
475 3300006353 Ga0075370_10012058 Ga0075370_100120586 244
476 3300006353 Ga0075370_10042517 Ga0075370_100425173 244
477 3300006353 Ga0075370_10275835 Ga0075370_102758351 244
478 3300006881 Ga0068865_100152708 Ga0068865_1001527082 244
479 3300009036 Ga0105244_10100973 Ga0105244_101009732 244
480 3300009094 Ga0111539_10070559 Ga0111539_100705592 244
481 3300009094 Ga0111539_11531175 Ga0111539_115311751 244
482 3300009098 Ga0105245_10519266 Ga0105245_105192662 244
483 3300009101 Ga0105247_10448890 Ga0105247_104488902 244
484 3300009148 Ga0105243_10011541 Ga0105243_100115415 244
485 3300009176 Ga0105242_10510515 Ga0105242_105105151 244
486 3300009551 Ga0105238_10091772 Ga0105238_100917724 244
487 3300013306 Ga0163162_10017495 Ga0163162_100174957 244
488 3300013307 Ga0157372_10267634 Ga0157372_102676341 244
489 3300013307 Ga0157372_10640141 Ga0157372_106401412 244
490 3300013308 Ga0157375_10203333 Ga0157375_102033332 244
491 3300014325 Ga0163163_10504682 Ga0163163_105046822 244
492 3300014326 Ga0157380_10055521 Ga0157380_100555215 244
493 3300014745 Ga0157377_10021539 Ga0157377_100215393 244
494 3300014969 Ga0157376_10102910 Ga0157376_101029103 244
495 3300021388 Ga0213875_10113922 Ga0213875_101139222 244
496 3300025901 Ga0207688_10009136 Ga0207688_100091364 244
497 3300025908 Ga0207643_10003380 Ga0207643_100033804 244
498 3300025909 Ga0207705_10688818 Ga0207705_106888181 244
499 3300025925 Ga0207650_10412542 Ga0207650_104125421 244
500 3300025935 Ga0207709_10082347 Ga0207709_100823472 244
501 3300025937 Ga0207669_10290901 Ga0207669_102909011 244
502 3300025940 Ga0207691_10002292 Ga0207691_100022929 244
503 3300025944 Ga0207661_10106938 Ga0207661_101069382 244
504 3300026041 Ga0207639_10537911 Ga0207639_105379112 244
505 3300026075 Ga0207708_10000865 Ga0207708_100008656 244
506 3300026088 Ga0207641_10233055 Ga0207641_102330551 244
507 3300026089 Ga0207648_10015438 Ga0207648_100154384 244
508 3300026118 Ga0207675_100008603 Ga0207675_1000086031 244
509 3300026121 Ga0207683_10136068 Ga0207683_101360681 244
510 3300026142 Ga0207698_10031472 Ga0207698_100314722 244
511 3300027866 Ga0209813_10061839 Ga0209813_100618391 244
512 3300028379 Ga0268266_10521761 Ga0268266_105217611 244
513 3300028381 Ga0268264_10000195 Ga0268264_1000019579 244
514 3300032002 Ga0307416_100766249 Ga0307416_1007662491 244
515 3300032005 Ga0307411_10377596 Ga0307411_103775962 244
516 3300032126 Ga0307415_100338999 Ga0307415_1003389992 244
517 3300036712 Ga0316584_0085693 Ga0316584_0085693_1466_2242 244
518 3300037312 Ga0395899_0030932 Ga0395899_0030932_300_1043 244
519 3300037418 Ga0395900_0296634 Ga0395900_0296634_682_1425 244
520 3300037466 Ga0395898_0070047 Ga0395898_0070047_371_1114 244
521 3300037466 Ga0395898_0687058 Ga0395898_0687058_27_770 244
522 3300037853 Ga0436364_0749840 Ga0436364_0749840_391_1152 244
523 3300038443 Ga0395901_0243830 Ga0395901_0243830_630_1373 244
524 3300038443 Ga0395901_0252198 Ga0395901_0252198_11_754 244
525 3300038742 Ga0400486_22540 Ga0400486_22540_59355_60098 244
526 3300039093 Ga0400489_78532 Ga0400489_78532_77_820 244
527 3300041452 Ga0451793_1670076 Ga0451793_1670076_214_969 244
528 3300042002 Ga0439442_053679 Ga0439442_053679_97_840 244
529 3300044684 Ga0466966_0240529 Ga0466966_0240529_321_1064 244
530 3300044693 Ga0466961_0002887 Ga0466961_0002887_9332_10075 244
531 3300044694 Ga0466963_0290368 Ga0466963_0290368_224_967 244
532 3300044719 Ga0466971_0006231 Ga0466971_0006231_1006_1749 244
533 3300044842 Ga0466957_0286614 Ga0466957_0286614_126_869 244
534 3300044901 Ga0466960_0002733 Ga0466960_0002733_2590_3342 244
535 3300045049 Ga0466959_0045896 Ga0466959_0045896_1581_2324 244
536 3300046559 Ga0495667_0480188 Ga0495667_0480188_21_764 244
537 3300048903 Ga0496100_0002424 Ga0496100_0002424_1088_1831 244
538 3300048903 Ga0496100_0050669 Ga0496100_0050669_54_797 244
539 3300048903 Ga0496100_0064800 Ga0496100_0064800_44_787 244
540 3300048904 Ga0496101_0004541 Ga0496101_0004541_2989_3732 244
541 3300048905 Ga0496102_0106008 Ga0496102_0106008_783_1526 244
542 3300048905 Ga0496102_0713233 Ga0496102_0713233_101_844 244
543 3300048906 Ga0496103_0015384 Ga0496103_0015384_2711_3454 244
544 3300048907 Ga0496104_0003740 Ga0496104_0003740_5882_6625 244
545 3300048907 Ga0496104_0015747 Ga0496104_0015747_5020_5763 244
546 3300048907 Ga0496104_0028007 Ga0496104_0028007_4433_5176 244
547 3300048907 Ga0496104_0192394 Ga0496104_0192394_634_1386 244
548 3300048907 Ga0496104_0255195 Ga0496104_0255195_787_1530 244
549 3300048907 Ga0496104_0571071 Ga0496104_0571071_129_872 244
550 3300048908 Ga0496105_0001083 Ga0496105_0001083_8943_9686 244
551 3300048908 Ga0496105_0014851 Ga0496105_0014851_1080_1823 244
552 3300048908 Ga0496105_0019239 Ga0496105_0019239_1100_1843 244
553 3300048909 Ga0496106_0112894 Ga0496106_0112894_220_963 244
554 3300048909 Ga0496106_0413005 Ga0496106_0413005_308_1051 244
555 3300048910 Ga0496107_0050536 Ga0496107_0050536_2066_2809 244
556 3300048911 Ga0496108_0188936 Ga0496108_0188936_186_929 244
557 3300048911 Ga0496108_0495965 Ga0496108_0495965_15_758 244
558 3300048911 Ga0496108_0576964 Ga0496108_0576964_35_778 244
559 3300048912 Ga0496109_0009816 Ga0496109_0009816_4164_4907 244
560 3300048912 Ga0496109_0738277 Ga0496109_0738277_69_821 244
561 3300048913 Ga0496110_0160930 Ga0496110_0160930_909_1652 244
562 3300048914 Ga0496111_0197586 Ga0496111_0197586_146_889 244
563 3300048916 Ga0496113_0050921 Ga0496113_0050921_402_1145 244
564 3300048917 Ga0496114_0052647 Ga0496114_0052647_48_791 244
565 3300048918 Ga0496115_0058627 Ga0496115_0058627_304_1047 244
566 3300049569 Ga0501032_0062244 Ga0501032_0062244_340_1083 244
567 3300049571 Ga0501034_0577810 Ga0501034_0577810_179_922 244
568 3300049573 Ga0501037_0235033 Ga0501037_0235033_413_1156 244
569 3300049574 Ga0501038_0134602 Ga0501038_0134602_745_1488 244
570 3300049575 Ga0501039_0028267 Ga0501039_0028267_1399_2142 244
571 3300049575 Ga0501039_0183533 Ga0501039_0183533_68_811 244
572 3300049575 Ga0501039_0189753 Ga0501039_0189753_286_1029 244
573 3300049577 Ga0501041_0057828 Ga0501041_0057828_683_1426 244
574 3300049578 Ga0501042_0199654 Ga0501042_0199654_642_1385 244
575 3300049588 Ga0501072_0088659 Ga0501072_0088659_280_1023 244
576 3300049588 Ga0501072_0219616 Ga0501072_0219616_530_1273 244
577 3300049588 Ga0501072_0299898 Ga0501072_0299898_285_1028 244
578 3300049592 Ga0501076_0686325 Ga0501076_0686325_52_795 244
579 3300049742 Ga0501080_0340256 Ga0501080_0340256_160_906 244
580 3300049744 Ga0501083_0309084 Ga0501083_0309084_259_1002 244
581 3300050490 nmdc:mga03n38_24974_c1 nmdc:mga03n38_24974_c1_133_879 244
582 3300050490 nmdc:mga03n38_47739_c1 nmdc:mga03n38_47739_c1_140_883 244
583 3300050491 nmdc:mga00v17_10109_c1 nmdc:mga00v17_10109_c1_2873_3619 244
584 3300050491 nmdc:mga00v17_212805_c1 nmdc:mga00v17_212805_c1_114_860 244
585 3300050492 nmdc:mga0yw44_185107_c1 nmdc:mga0yw44_185107_c1_349_1092 244
586 3300050494 nmdc:mga06z11_16124_c1 nmdc:mga06z11_16124_c1_251_994 244
587 3300050494 nmdc:mga06z11_58334_c1 nmdc:mga06z11_58334_c1_12_758 244
588 3300050496 nmdc:mga07m45_160542_c1 nmdc:mga07m45_160542_c1_147_887 244
589 3300050496 nmdc:mga07m45_190266_c1 nmdc:mga07m45_190266_c1_392_1135 244
590 3300050496 nmdc:mga07m45_5040_c1 nmdc:mga07m45_5040_c1_5354_6100 244
591 3300050496 nmdc:mga07m45_53873_c1 nmdc:mga07m45_53873_c1_330_1073 244
592 3300053088 Ga0500644_0000179 Ga0500644_0000179_15243_15986 244
593 iso_pu_bacteria 2643221679 2644446905 244
594 iso_pu_bacteria 2734482000 2734974299 244
595 iso_pu_bacteria 2791354901 2791913894 244
596 iso_pu_bacteria 2818991318 2819426046 244
597 3300005329 Ga0070683_100121022 Ga0070683_1001210221 245
598 3300005337 Ga0070682_100011552 Ga0070682_1000115525 245
599 3300005338 Ga0068868_100730599 Ga0068868_1007305991 245
600 3300005455 Ga0070663_100037219 Ga0070663_1000372193 245
601 3300005459 Ga0068867_100355214 Ga0068867_1003552142 245
602 3300005535 Ga0070684_100048161 Ga0070684_1000481611 245
603 3300005616 Ga0068852_100492973 Ga0068852_1004929732 245
604 3300010375 Ga0105239_10257108 Ga0105239_102571082 245
605 3300013308 Ga0157375_10669569 Ga0157375_106695691 245
606 3300025944 Ga0207661_10110715 Ga0207661_101107152 245
607 3300026067 Ga0207678_10042511 Ga0207678_100425112 245
608 3300026095 Ga0207676_10759251 Ga0207676_107592511 245
609 3300026142 Ga0207698_10306461 Ga0207698_103064612 245
610 3300039450 Ga0436363_1137442 Ga0436363_1137442_1442_2191 245
611 3300045976 Ga0466967_0151361 Ga0466967_0151361_1351_2103 245
612 3300047320 Ga0495672_0179100 Ga0495672_0179100_10_759 245
613 3300048911 Ga0496108_0045007 Ga0496108_0045007_2114_2866 245
614 3300048915 Ga0496112_0007193 Ga0496112_0007193_4277_5026 245
615 3300049571 Ga0501034_0473575 Ga0501034_0473575_40_789 245
616 3300049581 Ga0501047_0297808 Ga0501047_0297808_607_1356 245
617 iso_pu_bacteria 2833709550 2833711776 245
618 3300006051 Ga0075364_10084636 Ga0075364_100846362 246
619 3300025940 Ga0207691_10262037 Ga0207691_102620371 246
620 3300041456 Ga0451795_1031073 Ga0451795_1031073_50_799 246
621 3300050491 nmdc:mga00v17_151300_c1 nmdc:mga00v17_151300_c1_265_1005 246
622 3300001979 JGI24740J21852_10003793 JGI24740J21852_100037933 247
623 3300006038 Ga0075365_10010141 Ga0075365_100101412 247
624 3300006042 Ga0075368_10074607 Ga0075368_100746071 247
625 3300006178 Ga0075367_10004865 Ga0075367_100048657 247
626 3300006186 Ga0075369_10011473 Ga0075369_100114734 247
627 3300032004 Ga0307414_10296286 Ga0307414_102962861 247
628 3300044683 Ga0466965_0076205 Ga0466965_0076205_477_1235 247
629 3300044901 Ga0466960_0009617 Ga0466960_0009617_2732_3490 247
630 3300046694 Ga0495649_0205141 Ga0495649_0205141_222_971 247
631 3300048908 Ga0496105_0228556 Ga0496105_0228556_347_1105 247
632 3300048908 Ga0496105_0353543 Ga0496105_0353543_347_1117 247
633 3300048911 Ga0496108_0025618 Ga0496108_0025618_3541_4299 247
634 3300048912 Ga0496109_0074692 Ga0496109_0074692_351_1109 247
635 3300048913 Ga0496110_0053034 Ga0496110_0053034_46_804 247
636 3300048915 Ga0496112_0226089 Ga0496112_0226089_716_1474 247
637 3300048922 Ga0496119_0002996 Ga0496119_0002996_5867_6616 247
638 3300049568 Ga0501031_0065587 Ga0501031_0065587_630_1379 247
639 3300049569 Ga0501032_0006872 Ga0501032_0006872_4333_5082 247
640 3300049570 Ga0501033_0147381 Ga0501033_0147381_595_1347 247
641 3300049571 Ga0501034_0018926 Ga0501034_0018926_4456_5205 247
642 3300049572 Ga0501036_0008682 Ga0501036_0008682_4282_5031 247
643 3300049573 Ga0501037_0012832 Ga0501037_0012832_2284_3033 247
644 3300049574 Ga0501038_0006592 Ga0501038_0006592_3892_4641 247
645 3300049574 Ga0501038_0266899 Ga0501038_0266899_518_1267 247
646 3300049578 Ga0501042_0367103 Ga0501042_0367103_219_968 247
647 3300049580 Ga0501046_0014566 Ga0501046_0014566_1253_2002 247
648 3300049581 Ga0501047_0008648 Ga0501047_0008648_1061_1810 247
649 3300049582 Ga0501048_0003591 Ga0501048_0003591_9032_9781 247
650 3300049584 Ga0501068_0045809 Ga0501068_0045809_1448_2197 247
651 3300049586 Ga0501070_0065416 Ga0501070_0065416_1647_2396 247
652 3300049589 Ga0501073_0074002 Ga0501073_0074002_819_1568 247
653 3300049822 Ga0501035_0043012 Ga0501035_0043012_1872_2621 247
654 3300049823 Ga0501044_0015730 Ga0501044_0015730_4406_5155 247
655 3300049824 Ga0501045_0007675 Ga0501045_0007675_4834_5583 247
656 3300050491 nmdc:mga00v17_24407_c1 nmdc:mga00v17_24407_c1_278_1027 247
657 3300050492 nmdc:mga0yw44_222707_c1 nmdc:mga0yw44_222707_c1_47_796 247
658 3300050494 nmdc:mga06z11_8002_c1 nmdc:mga06z11_8002_c1_2609_3358 247
659 3300050516 nmdc:mga0sz30_12745_c1 nmdc:mga0sz30_12745_c1_261_1010 247

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00300

His_Phos_1

Histidine phosphatase superfamily (branch 1)

22

154

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1bq4-assembly1.cif.gz_A saccharomyces cerevisiae phosphoglycerate mutase in complex with benzene hexacarboxylate 0.9912 4 234
3fdz-assembly1.cif.gz_B crystal structure of phosphoglyceromutase from burkholderia pseudomallei 1710b with bound 2,3-diphosphoglyceric acid and 3-phosphoglyceric acid 0.9783 3 228
5um0-assembly1.cif.gz_D crystal structure of 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase from neisseria gonorrhoeae 0.9756 3 228
1bq4-assembly1.cif.gz_A saccharomyces cerevisiae phosphoglycerate mutase in complex with benzene hexacarboxylate 0.9744 4 234
3ezn-assembly1.cif.gz_A crystal structure of phosphoglyceromutase from burkholderia pseudomallei 1710b 0.9728 3 236
ID Description Score Start End Superfamily
1riiA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.9818 2 240 3.40.50.1240
af_P36623_9_210_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.9793 5 230 3.40.50.1240
af_P36623_9_210_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.9698 5 230 3.40.50.1240
1riiA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.9618 2 240 3.40.50.1240
af_Q59VM6_2_260_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.9586 1 247 3.40.50.1240
ID Description Score Start End GO Terms
AF-A0A3B9VW50-F1-model_v4 phosphoglycerate mutase (2,3-diphosphoglycerate-dependent) (EC 5.4.2.11) 1.005 8 98 GO:0006096
GO:0016868
AF-A0A3D3KRY2-F1-model_v4 phosphoglycerate mutase (2,3-diphosphoglycerate-dependent) (EC 5.4.2.11) 1.003 8 126 GO:0006096
GO:0016868
AF-A0A399NUZ0-F1-model_v4 phosphoglycerate mutase (2,3-diphosphoglycerate-dependent) (EC 5.4.2.11) 1.001 8 93 GO:0006096
GO:0046538
AF-A0A3D4WUJ8-F1-model_v4 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase (EC 5.4.2.11) 0.9994 8 132 GO:0006096
GO:0046538
AF-A0A496KN39-F1-model_v4 deleted 0.9982 8 92

Feature Viewer

pLDDT pTM Quality
94.48 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map