F473208

General Info

Members Datasets Scaffolds Average Seq Length
658 344 1272 342

Family's Representative Sequence

Representative Sequence 3300049568|Ga0501031_0035577|Ga0501031_0035577_244_1455
Length 403
Sequence MSEPDFTCRRLQFRVGRGAFSPAMRKLGVHRALSRNRHRTYPALSRGGGAMRGETGKPVDSALQEFSVSKSFKFRLAALALATSFAANAFASDVTGAGASFVYPAMSKWSSDYKAATGKEVNYQSIGSGGGIAQIKAGTVDFGSSDKPLPPDELARSGLAQFPSVIGGVVPAFNLPGVAAGAMKLDPDVLADIFLGKITMWDDARIAATNRGISLPSQKITVVHRSDGSGTSFNFTNYLSKVSPEWKSKVGEGTAVKWPVGIGGKGNEGVSAYIKQIKGSIGYVELAYAIQNKVPYSRLKNAAGNYVNPSDDSFAEAAASADWKSAKDFFLVVTNAPGQNAWPITATNFMLVHKDGKPGTKAAIEFFRWVYANGDDAATSLGYVPLPDSLVQQIQGYWTQNVK

Samples

Sample ID Description Type Environment
1 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
5 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
9 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
10 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
11 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
12 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
13 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
14 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
15 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
16 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
17 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
18 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
55 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
56 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
57 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
63 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
75 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
87 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
88 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
92 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
93 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
94 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
95 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
96 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
97 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
101 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
104 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
106 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
158 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
159 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
160 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
161 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
162 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
163 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
164 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
165 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
166 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
167 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
168 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
169 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
170 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
171 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
172 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
173 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
174 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
175 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
176 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
177 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
178 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
179 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
180 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
181 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
182 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
183 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
184 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
185 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
186 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
187 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
188 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
189 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
190 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
191 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
192 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
193 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
194 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
195 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
196 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
197 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
198 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
199 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
200 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
201 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
202 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
203 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
204 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
205 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
206 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
207 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
208 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
209 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
210 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
211 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
212 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
213 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
214 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
215 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
216 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
217 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
218 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
219 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
220 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
221 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
222 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
223 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
224 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
225 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
226 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
227 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
228 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
229 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
230 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
231 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
232 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
233 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
234 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
235 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
236 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
237 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
238 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
239 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
252 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
253 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
254 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
255 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
256 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
257 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
258 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
259 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
260 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
261 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
262 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
263 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
264 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
265 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
266 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
268 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
269 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
270 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
271 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
272 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
273 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
274 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
275 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
276 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
277 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
278 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
279 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
280 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
281 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
282 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
283 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
284 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
285 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
286 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
287 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
288 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
289 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
290 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
291 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
292 2643221559 Lysobacter sp. Root559 Isolate Unclassified
293 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
294 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
295 2643221586 Lysobacter sp. Root667 Isolate Unclassified
296 2643221593 Lysobacter sp. Root690 Isolate Unclassified
297 2643221612 Lysobacter sp. Root76 Isolate Unclassified
298 2643221695 Lysobacter sp. Root494 Isolate Unclassified
299 2643221720 Lysobacter sp. Root916 Isolate Unclassified
300 2643221727 Lysobacter sp. Root96 Isolate Unclassified
301 2643221728 Lysobacter sp. Root983 Isolate Unclassified
302 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
303 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
304 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
305 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
306 2818991457 Xanthomonas translucens 569 Isolate Unclassified
307 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
308 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
309 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
310 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
311 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
312 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
313 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
314 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
315 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
316 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
317 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
318 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
319 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
320 2919513703 Luteimonas sp. 3794 Isolate Unclassified
321 2919675420 Luteimonas terrae 4099 Isolate Unclassified
322 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
323 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
324 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
325 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
326 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
327 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
328 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
329 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
330 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
331 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
332 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
333 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
334 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
335 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
336 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
337 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
338 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
339 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
340 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
341 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
342 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
343 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
344 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.06
Metatranscriptomes 0.61
Isolates 10.33

Biome Distribution

Category Percentage (%)
Aerial Root 0.3
Bulb 0
Endosphere 16.57
Nodule 0.15
Rhizoplane 2.89
Rhizosphere 69.15
Stem 0
Stem Tuber 0
Unclassified 0.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501031_0035577 3300049568 Bacteria 3249
2 SwRhRL2b_contig_42121 2162886007 Bacteria 2391
3 JGI24741J21665_1002078 3300001915 Bacteria 5357
4 JGI25152J39213_1000252 3300002773 Bacteria 35837
5 JGI25150J39212_1000322 3300002774 Bacteria 23553
6 JGI25151J46595_10000183 3300003187 Bacteria 78518
7 JGI25151J46595_10000522 3300003187 Bacteria 35846
8 JGI25153J46596_10000311 3300003215 Bacteria 35846
9 Ga0055526_1000036 3300003771 Bacteria 135235
10 Ga0055526_1001709 3300003771 Bacteria 15305
11 Ga0055526_1009464 3300003771 Bacteria 4679
12 Ga0055537_1000083 3300003773 Bacteria 68713
13 Ga0055537_1000392 3300003773 Bacteria 29390
14 Ga0055524_1000359 3300003775 Bacteria 41002
15 Ga0055536_1001515 3300003781 Bacteria 13941
16 Ga0055536_1003198 3300003781 Bacteria 8877
17 Ga0055536_1004862 3300003781 Bacteria 6710
18 Ga0055536_1009027 3300003781 Bacteria 4194
19 Ga0055534_1000103 3300003784 Bacteria 65838
20 Ga0055534_1000328 3300003784 Bacteria 31317
21 Ga0055528_1000004 3300003790 Bacteria 285772
22 Ga0055528_1000115 3300003790 Bacteria 64238
23 Ga0055530_10003828 3300003791 Bacteria 8267
24 Ga0055531_10011297 3300003794 Bacteria 4326
25 Ga0055531_10011726 3300003794 Bacteria 4194
26 Ga0055531_10017094 3300003794 Bacteria 3082
27 Ga0058692_1000002 3300003856 Bacteria 508401
28 Ga0058692_1000020 3300003856 Bacteria 250589
29 Ga0065704_10006659 3300005289 Bacteria 2517
30 Ga0065704_10073140 3300005289 Bacteria 7543
31 Ga0065704_10080768 3300005289 Bacteria 3883
32 Ga0065715_10194591 3300005293 Bacteria 1395
33 Ga0070670_100000064 3300005331 Bacteria 110044
34 Ga0070670_100001108 3300005331 Bacteria 21408
35 Ga0070670_100062560 3300005331 Bacteria 3195
36 Ga0070666_10037596 3300005335 Bacteria 3219
37 Ga0070666_10112566 3300005335 Bacteria 1883
38 Ga0070680_100000405 3300005336 Bacteria 29476
39 Ga0070680_100008797 3300005336 Bacteria 7746
40 Ga0070660_100026051 3300005339 Bacteria 4352
41 Ga0070660_100037696 3300005339 Bacteria 3664
42 Ga0070661_100004480 3300005344 Bacteria 9633
43 Ga0070661_100254797 3300005344 Bacteria 1355
44 Ga0070661_100383441 3300005344 Bacteria 1108
45 Ga0070692_10011935 3300005345 Bacteria 4005
46 Ga0070668_100005796 3300005347 Bacteria 9162
47 Ga0070668_100050653 3300005347 Bacteria 3198
48 Ga0070668_100075087 3300005347 Bacteria 2638
49 Ga0070668_100278924 3300005347 Bacteria 1395
50 Ga0070669_100012001 3300005353 Bacteria 6149
51 Ga0070669_100088864 3300005353 Bacteria 2313
52 Ga0070669_100301564 3300005353 Bacteria 1289
53 Ga0070671_100000025 3300005355 Bacteria 121912
54 Ga0070671_100004291 3300005355 Bacteria 11282
55 Ga0070671_100102580 3300005355 Bacteria 2400
56 Ga0070671_100135430 3300005355 Bacteria 2077
57 Ga0070674_100051839 3300005356 Bacteria 2829
58 Ga0070674_100281229 3300005356 Bacteria 1319
59 Ga0070688_100002099 3300005365 Bacteria 10058
60 Ga0070659_100003974 3300005366 Bacteria 10527
61 Ga0070667_100000012 3300005367 Bacteria 258575
62 Ga0070667_100000095 3300005367 Bacteria 109595
63 Ga0070663_100000126 3300005455 Bacteria 36101
64 Ga0070663_100011268 3300005455 Bacteria 5605
65 Ga0070663_100027309 3300005455 Bacteria 3875
66 Ga0070678_100120271 3300005456 Bacteria 2070
67 Ga0070678_100134573 3300005456 Bacteria 1969
68 Ga0070681_10003393 3300005458 Bacteria 14907
69 Ga0070685_10000005 3300005466 Bacteria 190119
70 Ga0070679_100000681 3300005530 Bacteria 29079
71 Ga0070679_100002883 3300005530 Bacteria 15619
72 Ga0068853_100000768 3300005539 Bacteria 22263
73 Ga0068853_100008635 3300005539 Bacteria 8193
74 Ga0068853_100042082 3300005539 Bacteria 3905
75 Ga0070696_100007449 3300005546 Bacteria 7320
76 Ga0070693_100000911 3300005547 Bacteria 13154
77 Ga0070693_100022123 3300005547 Bacteria 3375
78 Ga0070665_100000077 3300005548 Bacteria 188308
79 Ga0070665_100007283 3300005548 Bacteria 11249
80 Ga0070665_100015383 3300005548 Bacteria 7683
81 Ga0070665_100036667 3300005548 Bacteria 4930
82 Ga0070665_100061222 3300005548 Bacteria 3772
83 Ga0070665_100092750 3300005548 Bacteria 3025
84 Ga0070665_100094082 3300005548 Bacteria 3002
85 Ga0070665_100127021 3300005548 Bacteria 2552
86 Ga0070665_100314230 3300005548 Bacteria 1571
87 Ga0068855_100001280 3300005563 Bacteria 31168
88 Ga0068855_100030800 3300005563 Bacteria 6414
89 Ga0068855_100046292 3300005563 Bacteria 5143
90 Ga0068855_100046906 3300005563 Bacteria 5106
91 Ga0070664_100120811 3300005564 Bacteria 2294
92 Ga0070664_100264376 3300005564 Bacteria 1548
93 Ga0068857_100057901 3300005577 Bacteria 3440
94 Ga0068854_100005144 3300005578 Bacteria 8248
95 Ga0068854_100011728 3300005578 Bacteria 5718
96 Ga0068854_100160550 3300005578 Bacteria 1740
97 Ga0068856_100000234 3300005614 Bacteria 60217
98 Ga0068852_100014711 3300005616 Bacteria 6036
99 Ga0068852_100058737 3300005616 Bacteria 3333
100 Ga0068852_100142938 3300005616 Bacteria 2216
101 Ga0068859_100003094 3300005617 Bacteria 16887
102 Ga0068859_100007853 3300005617 Bacteria 10828
103 Ga0068864_100000073 3300005618 Bacteria 109681
104 Ga0068863_100013677 3300005841 Bacteria 7824
105 Ga0068863_100438673 3300005841 Bacteria 1280
106 Ga0068858_100106608 3300005842 Bacteria 2615
107 Ga0068860_100002476 3300005843 Bacteria 19371
108 Ga0068860_100018691 3300005843 Bacteria 6739
109 Ga0068860_100163794 3300005843 Bacteria 2145
110 Ga0068862_100000164 3300005844 Bacteria 73885
111 Ga0068862_100001217 3300005844 Bacteria 24281
112 Ga0068862_100009079 3300005844 Bacteria 8228
113 Ga0081539_10015349 3300005985 Bacteria 5573
114 Ga0075364_10000438 3300006051 Bacteria 20844
115 Ga0075364_10001495 3300006051 Bacteria 12727
116 Ga0075364_10006217 3300006051 Bacteria 7003
117 Ga0075364_10042688 3300006051 Bacteria 2947
118 Ga0075364_10053176 3300006051 Bacteria 2647
119 Ga0075364_10185020 3300006051 Bacteria 1410
120 Ga0075362_10002219 3300006177 Bacteria 6450
121 Ga0075367_10003075 3300006178 Bacteria 7830
122 Ga0075367_10008976 3300006178 Bacteria 5205
123 Ga0075366_10003119 3300006195 Bacteria 8670
124 Ga0097621_100089419 3300006237 Bacteria 2575
125 Ga0075434_100149224 3300006871 Bacteria 2358
126 Ga0068865_100115328 3300006881 Bacteria 1988
127 Ga0068865_100192517 3300006881 Bacteria 1578
128 Ga0097620_100003094 3300006931 Bacteria 16887
129 Ga0097620_100007853 3300006931 Bacteria 10828
130 Ga0105251_10000010 3300009011 Bacteria 186242
131 Ga0105251_10007369 3300009011 Bacteria 6795
132 Ga0105244_10007676 3300009036 Bacteria 6835
133 Ga0105240_10020333 3300009093 Bacteria 8859
134 Ga0111539_10052153 3300009094 Bacteria 4869
135 Ga0105243_10010816 3300009148 Bacteria 6905
136 Ga0105243_10117107 3300009148 Bacteria 2239
137 Ga0105241_10516019 3300009174 Bacteria 1068
138 Ga0105248_10000179 3300009177 Bacteria 73845
139 Ga0105237_10000348 3300009545 Bacteria 65042
140 Ga0105237_10002762 3300009545 Bacteria 21342
141 Ga0105237_10126843 3300009545 Bacteria 2546
142 Ga0105238_10238095 3300009551 Bacteria 1797
143 Ga0105238_10433190 3300009551 Bacteria 1311
144 Ga0105249_10000262 3300009553 Bacteria 56551
145 Ga0105249_10414300 3300009553 Bacteria 1380
146 Ga0105032_102285 3300009979 Bacteria 1721
147 Ga0105239_10000401 3300010375 Bacteria 63434
148 Ga0105239_10095895 3300010375 Bacteria 3277
149 Ga0105239_10162004 3300010375 Bacteria 2499
150 Ga0157318_1000466 3300012482 Bacteria 1725
151 Ga0157327_1001669 3300012512 Bacteria 1432
152 Ga0157373_10019579 3300013100 Bacteria 4923
153 Ga0157373_10063523 3300013100 Bacteria 2614
154 Ga0157373_10086535 3300013100 Bacteria 2208
155 Ga0157371_10037059 3300013102 Bacteria 3492
156 Ga0157371_10066765 3300013102 Bacteria 2547
157 Ga0157370_10011223 3300013104 Bacteria 9394
158 Ga0157370_10017572 3300013104 Bacteria 7216
159 Ga0157370_10017945 3300013104 Bacteria 7126
160 Ga0157370_10083337 3300013104 Bacteria 3006
161 Ga0157370_10156688 3300013104 Bacteria 2119
162 Ga0157369_10001849 3300013105 Bacteria 25579
163 Ga0157369_10042343 3300013105 Bacteria 4968
164 Ga0157369_10162220 3300013105 Bacteria 2359
165 Ga0157369_10294003 3300013105 Bacteria 1691
166 Ga0157374_10014089 3300013296 Bacteria 6990
167 Ga0157372_10000421 3300013307 Bacteria 46585
168 Ga0157372_10214716 3300013307 Bacteria 2229
169 Ga0157372_10263919 3300013307 Bacteria 2000
170 Ga0163163_10001573 3300014325 Bacteria 19239
171 Ga0182008_10002138 3300014497 Bacteria 12596
172 Ga0157377_10038115 3300014745 Unclassified 2652
173 Ga0157379_10110387 3300014968 Bacteria 2470
174 Ga0182005_1004408 3300015265 Bacteria 4557
175 Ga0183360_10001 3300015689 Bacteria 3943671
176 Ga0197907_11154955 3300020069 Bacteria 1653
177 Ga0206352_10574363 3300020078 Bacteria 1465
178 Ga0206354_11590007 3300020081 Bacteria 2432
179 Ga0154015_1567256 3300020610 Bacteria 6123
180 Ga0207425_1000283 3300025245 Bacteria 37349
181 Ga0209646_1003226 3300025246 Bacteria 3271
182 Ga0209026_1000162 3300025250 Bacteria 102867
183 Ga0209759_1000906 3300025256 Bacteria 22092
184 Ga0209129_1000365 3300025258 Bacteria 37356
185 Ga0209565_1000001 3300025263 Bacteria 2950419
186 Ga0209565_1000014 3300025263 Bacteria 530302
187 Ga0209455_1000261 3300025272 Bacteria 60720
188 Ga0209673_1000001 3300025273 Bacteria 3176258
189 Ga0209673_1000623 3300025273 Bacteria 54075
190 Ga0209130_1026971 3300025284 Bacteria 1225
191 Ga0209675_1000001 3300025291 Bacteria 2950293
192 Ga0209675_1000021 3300025291 Bacteria 334833
193 Ga0209676_1000024 3300025292 Bacteria 578839
194 Ga0209676_1000047 3300025292 Bacteria 408645
195 Ga0209676_1000079 3300025292 Bacteria 290447
196 Ga0209676_1001198 3300025292 Bacteria 27768
197 Ga0209676_1005540 3300025292 Bacteria 6545
198 Ga0209676_1019683 3300025292 Bacteria 2315
199 Ga0209025_1000012 3300025294 Bacteria 924362
200 Ga0209025_1000015 3300025294 Bacteria 808120
201 Ga0209025_1007720 3300025294 Bacteria 7936
202 Ga0209025_1022654 3300025294 Bacteria 3320
203 Ga0209025_1027256 3300025294 Bacteria 2838
204 Ga0209564_1000001 3300025295 Bacteria 3176258
205 Ga0209564_1000263 3300025295 Bacteria 112148
206 Ga0209758_1000018 3300025297 Bacteria 753320
207 Ga0209758_1011751 3300025297 Bacteria 5019
208 Ga0209758_1017780 3300025297 Bacteria 3517
209 Ga0209050_1000153 3300025298 Bacteria 160851
210 Ga0209050_1001146 3300025298 Bacteria 31752
211 Ga0209050_1011617 3300025298 Bacteria 4148
212 Ga0209050_1031241 3300025298 Bacteria 1663
213 Ga0209256_1000002 3300025299 Bacteria 1906740
214 Ga0209256_1005467 3300025299 Bacteria 7296
215 Ga0209051_1001823 3300025303 Bacteria 16847
216 Ga0209051_1006438 3300025303 Bacteria 6612
217 Ga0209051_1010564 3300025303 Bacteria 4643
218 Ga0209257_1000081 3300025304 Bacteria 306577
219 Ga0209257_1000148 3300025304 Bacteria 193131
220 Ga0209257_1000988 3300025304 Bacteria 38563
221 Ga0209257_1001062 3300025304 Bacteria 36333
222 Ga0209257_1001483 3300025304 Bacteria 27558
223 Ga0209257_1004325 3300025304 Bacteria 11138
224 Ga0209257_1015480 3300025304 Bacteria 3170
225 Ga0207656_10045037 3300025321 Bacteria 1886
226 Ga0207713_1000292 3300025735 Bacteria 57738
227 Ga0207647_10000467 3300025904 Bacteria 32759
228 Ga0207647_10108731 3300025904 Bacteria 1640
229 Ga0207705_10000532 3300025909 Bacteria 32283
230 Ga0207707_10000229 3300025912 Bacteria 60350
231 Ga0207707_10000241 3300025912 Bacteria 59575
232 Ga0207707_10000607 3300025912 Bacteria 36033
233 Ga0207707_10003687 3300025912 Bacteria 13581
234 Ga0207707_10173209 3300025912 Bacteria 1886
235 Ga0207695_10021839 3300025913 Bacteria 7289
236 Ga0207695_10107679 3300025913 Bacteria 2772
237 Ga0207695_10120705 3300025913 Bacteria 2590
238 Ga0207695_10173677 3300025913 Bacteria 2079
239 Ga0207671_10000167 3300025914 Bacteria 100428
240 Ga0207671_10020004 3300025914 Bacteria 5106
241 Ga0207671_10079929 3300025914 Bacteria 2450
242 Ga0207660_10001209 3300025917 Bacteria 17282
243 Ga0207660_10138384 3300025917 Bacteria 1859
244 Ga0207660_10274081 3300025917 Bacteria 1337
245 Ga0207657_10008767 3300025919 Bacteria 10237
246 Ga0207657_10053425 3300025919 Bacteria 3500
247 Ga0207649_10005986 3300025920 Bacteria 6600
248 Ga0207649_10225719 3300025920 Bacteria 1337
249 Ga0207652_10000531 3300025921 Bacteria 38731
250 Ga0207652_10001033 3300025921 Bacteria 25488
251 Ga0207652_10004906 3300025921 Bacteria 10827
252 Ga0207652_10005786 3300025921 Bacteria 10032
253 Ga0207652_10161664 3300025921 Bacteria 2008
254 Ga0207652_10215981 3300025921 Bacteria 1727
255 Ga0207681_10005843 3300025923 Bacteria 7543
256 Ga0207681_10010548 3300025923 Bacteria 5661
257 Ga0207681_10035698 3300025923 Unclassified 3277
258 Ga0207681_10256283 3300025923 Bacteria 1368
259 Ga0207694_10003240 3300025924 Bacteria 12967
260 Ga0207694_10015555 3300025924 Bacteria 5737
261 Ga0207694_10124076 3300025924 Bacteria 2064
262 Ga0207694_10279842 3300025924 Bacteria 1370
263 Ga0207650_10000106 3300025925 Bacteria 110058
264 Ga0207650_10047545 3300025925 Bacteria 3162
265 Ga0207650_10070639 3300025925 Bacteria 2625
266 Ga0207644_10000049 3300025931 Bacteria 95260
267 Ga0207644_10001185 3300025931 Bacteria 16763
268 Ga0207644_10123618 3300025931 Bacteria 1973
269 Ga0207709_10000805 3300025935 Bacteria 24411
270 Ga0207709_10134122 3300025935 Bacteria 1692
271 Ga0207669_10122239 3300025937 Bacteria 1770
272 Ga0207704_10143233 3300025938 Bacteria 1675
273 Ga0207691_10041622 3300025940 Bacteria 4240
274 Ga0207711_10000393 3300025941 Bacteria 46458
275 Ga0207711_10000406 3300025941 Bacteria 45644
276 Ga0207689_10222188 3300025942 Bacteria 1561
277 Ga0207667_10000481 3300025949 Bacteria 52931
278 Ga0207667_10002512 3300025949 Bacteria 22872
279 Ga0207667_10024035 3300025949 Bacteria 6701
280 Ga0207667_10038881 3300025949 Bacteria 5074
281 Ga0207667_10039795 3300025949 Bacteria 5006
282 Ga0207667_10088441 3300025949 Bacteria 3204
283 Ga0207651_10150809 3300025960 Bacteria 1809
284 Ga0207651_10282001 3300025960 Bacteria 1374
285 Ga0207712_10018395 3300025961 Bacteria 4550
286 Ga0207712_10343718 3300025961 Bacteria 1238
287 Ga0207668_10009979 3300025972 Bacteria 5714
288 Ga0207668_10089222 3300025972 Bacteria 2260
289 Ga0207668_10090062 3300025972 Bacteria 2251
290 Ga0207640_10000423 3300025981 Bacteria 26221
291 Ga0207640_10002472 3300025981 Bacteria 9896
292 Ga0207640_10005569 3300025981 Bacteria 6864
293 Ga0207640_10020099 3300025981 Bacteria 3960
294 Ga0207640_10032912 3300025981 Bacteria 3219
295 Ga0207658_10000027 3300025986 Bacteria 174626
296 Ga0207658_10000073 3300025986 Bacteria 111738
297 Ga0207639_10000800 3300026041 Bacteria 21366
298 Ga0207639_10001128 3300026041 Bacteria 18159
299 Ga0207639_10026103 3300026041 Bacteria 4243
300 Ga0207639_10062770 3300026041 Bacteria 2874
301 Ga0207639_10076983 3300026041 Bacteria 2628
302 Ga0207639_10105299 3300026041 Bacteria 2288
303 Ga0207639_10226367 3300026041 Bacteria 1618
304 Ga0207678_10000258 3300026067 Bacteria 48084
305 Ga0207678_10014004 3300026067 Bacteria 7050
306 Ga0207678_10022995 3300026067 Bacteria 5455
307 Ga0207678_10072065 3300026067 Bacteria 2961
308 Ga0207678_10119925 3300026067 Bacteria 2245
309 Ga0207678_10121690 3300026067 Bacteria 2227
310 Ga0207678_10199245 3300026067 Bacteria 1712
311 Ga0207702_10000113 3300026078 Bacteria 94003
312 Ga0207702_10008183 3300026078 Bacteria 8840
313 Ga0207641_10006988 3300026088 Bacteria 9443
314 Ga0207641_10012294 3300026088 Bacteria 7022
315 Ga0207676_10000010 3300026095 Bacteria 519402
316 Ga0207674_10006108 3300026116 Bacteria 14240
317 Ga0207674_10014543 3300026116 Bacteria 8689
318 Ga0207683_10133266 3300026121 Bacteria 2236
319 Ga0207683_10148720 3300026121 Bacteria 2113
320 Ga0207698_10005479 3300026142 Bacteria 7851
321 Ga0207698_10009887 3300026142 Bacteria 6100
322 Ga0209973_1006852 3300027252 Bacteria 1256
323 Ga0209371_1000004 3300027312 Bacteria 1098197
324 Ga0209371_1000011 3300027312 Bacteria 848456
325 Ga0210000_1007276 3300027462 Bacteria 1619
326 Ga0209999_1016445 3300027543 Bacteria 1346
327 Ga0209982_1009959 3300027552 Bacteria 1407
328 Ga0209970_1013972 3300027614 Bacteria 1333
329 Ga0209983_1003327 3300027665 Bacteria 3442
330 Ga0209971_1013948 3300027682 Bacteria 1905
331 Ga0209974_10016414 3300027876 Bacteria 2459
332 Ga0209974_10026909 3300027876 Bacteria 1902
333 Ga0268266_10000001 3300028379 Bacteria 4040580
334 Ga0268266_10028958 3300028379 Bacteria 4706
335 Ga0268266_10051213 3300028379 Bacteria 3544
336 Ga0268266_10053633 3300028379 Bacteria 3464
337 Ga0268266_10173357 3300028379 Bacteria 1959
338 Ga0268266_10181353 3300028379 Bacteria 1917
339 Ga0268265_10000186 3300028380 Bacteria 73892
340 Ga0268265_10001086 3300028380 Bacteria 24228
341 Ga0268265_10010427 3300028380 Bacteria 6275
342 Ga0268265_10022795 3300028380 Bacteria 4405
343 Ga0268264_10000123 3300028381 Bacteria 189361
344 Ga0268264_10013370 3300028381 Bacteria 6755
345 Ga0268264_10309693 3300028381 Bacteria 1489
346 Ga0307515_10116400 3300028794 Bacteria 3069
347 Ga0268256_1000005 3300030500 Bacteria 1082342
348 Ga0268256_1000011 3300030500 Bacteria 848625
349 Ga0316177_1136997 3300030731 Bacteria 1474
350 Ga0316176_1142398 3300030732 Bacteria 3332
351 Ga0314311_1231852 3300030733 Bacteria 2320
352 Ga0316183_1166111 3300030742 Bacteria 3110
353 Ga0265330_10000317 3300031235 Bacteria 34538
354 Ga0265332_10000327 3300031238 Bacteria 36661
355 Ga0265332_10097128 3300031238 Bacteria 1244
356 Ga0265329_10005943 3300031242 Unclassified 4891
357 Ga0265339_10016163 3300031249 Unclassified 4456
358 Ga0265331_10050053 3300031250 Bacteria 2005
359 Ga0265327_10052702 3300031251 Bacteria 2117
360 Ga0265316_10000399 3300031344 Bacteria 49576
361 Ga0265316_10020002 3300031344 Bacteria 5710
362 Ga0307513_10038394 3300031456 Bacteria 5317
363 Ga0307408_100180265 3300031548 Bacteria 1694
364 Ga0316575_10025114 3300031665 Bacteria 2309
365 Ga0265314_10000532 3300031711 Bacteria 49131
366 Ga0265342_10000369 3300031712 Bacteria 49518
367 Ga0307516_10102543 3300031730 Unclassified 2676
368 Ga0307405_10008187 3300031731 Bacteria 5286
369 Ga0307413_10024028 3300031824 Bacteria 3314
370 Ga0307413_10042644 3300031824 Bacteria 2668
371 Ga0307410_10035339 3300031852 Bacteria 3244
372 Ga0307410_10151279 3300031852 Bacteria 1728
373 Ga0307406_10026385 3300031901 Bacteria 3488
374 Ga0307407_10028001 3300031903 Bacteria 3006
375 Ga0307409_100215943 3300031995 Bacteria 1727
376 Ga0307416_100029159 3300032002 Bacteria 4118
377 Ga0307416_100042911 3300032002 Bacteria 3536
378 Ga0307416_100249072 3300032002 Bacteria 1727
379 Ga0307414_10001756 3300032004 Bacteria 11248
380 Ga0307414_10008346 3300032004 Bacteria 5866
381 Ga0307414_10017527 3300032004 Bacteria 4384
382 Ga0307414_10040583 3300032004 Bacteria 3145
383 Ga0307414_10170712 3300032004 Bacteria 1738
384 Ga0307414_10206376 3300032004 Bacteria 1602
385 Ga0307414_10227258 3300032004 Bacteria 1536
386 Ga0307411_10044316 3300032005 Bacteria 2852
387 Ga0307415_100035163 3300032126 Bacteria 3270
388 Ga0316574_0144620 3300035398 Bacteria 1532
389 Ga0395899_0009887 3300037312 Bacteria 7314
390 Ga0395899_0011332 3300037312 Bacteria 6829
391 Ga0395900_0098299 3300037418 Bacteria 3007
392 Ga0395900_0099121 3300037418 Bacteria 2994
393 Ga0395900_0157562 3300037418 Bacteria 2319
394 Ga0395900_0175637 3300037418 Bacteria 2179
395 Ga0395898_0030081 3300037466 Bacteria 5437
396 Ga0395898_0061392 3300037466 Bacteria 3651
397 Ga0395898_0116809 3300037466 Bacteria 2556
398 Ga0395905_0002660 3300037471 Bacteria 19606
399 Ga0395905_0004830 3300037471 Bacteria 13896
400 Ga0395905_0036766 3300037471 Bacteria 4600
401 Ga0395905_0080660 3300037471 Bacteria 3049
402 Ga0395901_0018705 3300038443 Bacteria 7076
403 Ga0395901_0086061 3300038443 Bacteria 3286
404 Ga0237819_00047 3300038705 Bacteria 41634
405 Ga0237819_04917 3300038705 Bacteria 2144
406 Ga0439436_0025090 3300041404 Bacteria 1754
407 Ga0439465_0002378 3300041413 Bacteria 6166
408 Ga0439465_0008709 3300041413 Bacteria 3199
409 Ga0439465_0068937 3300041413 Bacteria 1183
410 Ga0451797_0878899 3300041453 Bacteria 1895
411 Ga0451797_1574149 3300041453 Bacteria 1748
412 Ga0451800_0984490 3300041459 Bacteria 11360
413 Ga0451802_0202710 3300041460 Bacteria 6206
414 Ga0451806_345240 3300041462 Bacteria 5689
415 Ga0451804_0018860 3300041463 Bacteria 6284
416 Ga0451807_0350558 3300041486 Bacteria 5205
417 Ga0451837_1126891 3300041494 Bacteria 2814
418 Ga0451843_1236032 3300041509 Bacteria 1646
419 Ga0439432_035924 3300042006 Bacteria 1587
420 Ga0439449_0000272 3300042007 Bacteria 18664
421 Ga0439449_0004443 3300042007 Bacteria 5410
422 Ga0439449_0004460 3300042007 Bacteria 5400
423 Ga0439449_0020398 3300042007 Bacteria 2484
424 Ga0439449_0032212 3300042007 Bacteria 1954
425 Ga0451577_0002087 3300042876 Bacteria 24590
426 Ga0466972_0000629 3300044658 Bacteria 17099
427 Ga0466963_0178071 3300044694 Bacteria 1484
428 Ga0466970_0000172 3300044765 Bacteria 30789
429 Ga0466957_0067438 3300044842 Bacteria 2207
430 Ga0466959_0038586 3300045049 Bacteria 3529
431 Ga0495638_0183320 3300046460 Bacteria 1193
432 Ga0495663_0002717 3300046525 Bacteria 5244
433 Ga0495621_0011311 3300046539 Bacteria 2757
434 Ga0495633_0009843 3300046558 Bacteria 5255
435 Ga0495633_0028189 3300046558 Bacteria 2739
436 Ga0495668_0013505 3300046616 Bacteria 4814
437 Ga0495636_0020099 3300047318 Bacteria 2689
438 Ga0495686_0001563 3300047472 Bacteria 24398
439 Ga0496100_0142789 3300048903 Bacteria 1699
440 Ga0496101_0060606 3300048904 Bacteria 2746
441 Ga0496107_0239664 3300048910 Bacteria 1350
442 Ga0496108_0023131 3300048911 Bacteria 5111
443 Ga0496109_0010311 3300048912 Bacteria 7980
444 Ga0496111_0053415 3300048914 Bacteria 2919
445 Ga0496113_0010772 3300048916 Bacteria 6063
446 Ga0496114_0000915 3300048917 Bacteria 22110
447 Ga0496114_0086321 3300048917 Bacteria 2659
448 Ga0496115_0139494 3300048918 Bacteria 2000
449 Ga0496115_0285411 3300048918 Bacteria 1355
450 Ga0496116_0022348 3300048919 Bacteria 4740
451 Ga0496117_0001168 3300048920 Bacteria 39488
452 Ga0496117_0008641 3300048920 Bacteria 9640
453 Ga0496117_0010386 3300048920 Bacteria 8496
454 Ga0496118_0000145 3300048921 Bacteria 123886
455 Ga0496118_0000682 3300048921 Bacteria 55209
456 Ga0496118_0003292 3300048921 Bacteria 20547
457 Ga0496118_0024498 3300048921 Bacteria 5204
458 Ga0496118_0129882 3300048921 Bacteria 1620
459 Ga0496119_0001728 3300048922 Bacteria 25473
460 Ga0496120_0000605 3300048923 Bacteria 54408
461 Ga0496121_0000176 3300048924 Bacteria 142585
462 Ga0496121_0004743 3300048924 Bacteria 17942
463 Ga0496122_0000220 3300048925 Bacteria 127065
464 Ga0496122_0001135 3300048925 Bacteria 45756
465 Ga0496122_0001331 3300048925 Bacteria 40422
466 Ga0496123_0000107 3300048926 Bacteria 166923
467 Ga0496123_0000151 3300048926 Bacteria 141062
468 Ga0496123_0000226 3300048926 Bacteria 113889
469 Ga0496123_0074405 3300048926 Bacteria 2103
470 Ga0496124_0000785 3300048927 Bacteria 51854
471 Ga0496124_0076260 3300048927 Bacteria 2768
472 Ga0496126_0017194 3300048929 Bacteria 7211
473 Ga0496126_0095881 3300048929 Bacteria 2601
474 Ga0501290_000542 3300049513 Bacteria 5779
475 Ga0501300_010952 3300049523 Bacteria 1322
476 Ga0501032_0001950 3300049569 Bacteria 16241
477 Ga0501032_0053533 3300049569 Bacteria 2717
478 Ga0501033_0009648 3300049570 Bacteria 7425
479 Ga0501033_0016560 3300049570 Bacteria 5578
480 Ga0501033_0044899 3300049570 Bacteria 3289
481 Ga0501033_0122922 3300049570 Bacteria 1882
482 Ga0501034_0000822 3300049571 Bacteria 46209
483 Ga0501034_0002484 3300049571 Bacteria 22159
484 Ga0501034_0010768 3300049571 Bacteria 9499
485 Ga0501034_0023790 3300049571 Bacteria 6238
486 Ga0501034_0089351 3300049571 Bacteria 3078
487 Ga0501034_0132782 3300049571 Bacteria 2472
488 Ga0501034_0195122 3300049571 Bacteria 1985
489 Ga0501034_0391287 3300049571 Bacteria 1314
490 Ga0501036_0022651 3300049572 Bacteria 5286
491 Ga0501037_0001245 3300049573 Bacteria 18769
492 Ga0501037_0037684 3300049573 Bacteria 3564
493 Ga0501037_0056576 3300049573 Bacteria 2864
494 Ga0501038_0006070 3300049574 Bacteria 11177
495 Ga0501039_0010599 3300049575 Bacteria 7022
496 Ga0501039_0019791 3300049575 Bacteria 5160
497 Ga0501039_0021732 3300049575 Bacteria 4923
498 Ga0501040_0063313 3300049576 Bacteria 2545
499 Ga0501042_0029270 3300049578 Bacteria 3884
500 Ga0501043_0002712 3300049579 Bacteria 14825
501 Ga0501043_0010830 3300049579 Bacteria 7140
502 Ga0501043_0020494 3300049579 Bacteria 5187
503 Ga0501043_0065770 3300049579 Bacteria 2847
504 Ga0501046_0014070 3300049580 Bacteria 6757
505 Ga0501046_0028250 3300049580 Bacteria 4570
506 Ga0501046_0030906 3300049580 Bacteria 4345
507 Ga0501046_0286939 3300049580 Bacteria 1204
508 Ga0501047_0008649 3300049581 Bacteria 9617
509 Ga0501047_0018572 3300049581 Bacteria 6665
510 Ga0501047_0090986 3300049581 Bacteria 2928
511 Ga0501068_0008363 3300049584 Bacteria 5754
512 Ga0501069_0045573 3300049585 Bacteria 2430
513 Ga0501070_0023731 3300049586 Bacteria 5140
514 Ga0501070_0042467 3300049586 Bacteria 3787
515 Ga0501070_0080698 3300049586 Bacteria 2691
516 Ga0501070_0166995 3300049586 Bacteria 1813
517 Ga0501070_0351963 3300049586 Bacteria 1195
518 Ga0501072_0200304 3300049588 Bacteria 1592
519 Ga0501073_0031310 3300049589 Bacteria 3795
520 Ga0501073_0073939 3300049589 Bacteria 2373
521 Ga0501073_0080063 3300049589 Bacteria 2273
522 Ga0501074_0137626 3300049590 Bacteria 1747
523 Ga0501206_014084 3300049653 Bacteria 1096
524 Ga0501257_010657 3300049686 Bacteria 2090
525 Ga0501258_005025 3300049687 Bacteria 1270
526 Ga0501225_0023020 3300049705 Bacteria 1718
527 Ga0501225_0051860 3300049705 Bacteria 1143
528 Ga0501079_0054416 3300049741 Bacteria 3086
529 Ga0501080_0006579 3300049742 Bacteria 10440
530 Ga0501080_0081368 3300049742 Bacteria 3009
531 Ga0501080_0118455 3300049742 Bacteria 2455
532 Ga0501080_0178029 3300049742 Bacteria 1958
533 Ga0501080_0188210 3300049742 Bacteria 1897
534 Ga0501080_0255198 3300049742 Bacteria 1598
535 Ga0501265_000289 3300049762 Bacteria 5157
536 Ga0501272_008396 3300049769 Bacteria 1133
537 Ga0501275_000710 3300049772 Bacteria 3640
538 Ga0501035_0013181 3300049822 Bacteria 7630
539 Ga0501035_0034410 3300049822 Bacteria 4603
540 Ga0501035_0132748 3300049822 Bacteria 2169
541 Ga0501035_0175390 3300049822 Bacteria 1849
542 Ga0501035_0189279 3300049822 Bacteria 1769
543 Ga0501044_0005580 3300049823 Bacteria 13962
544 Ga0501044_0013448 3300049823 Bacteria 8851
545 Ga0501044_0015688 3300049823 Bacteria 8157
546 Ga0501044_0019454 3300049823 Bacteria 7264
547 Ga0501044_0068934 3300049823 Bacteria 3602
548 nmdc:mga03683_15792_c1 3300050489 Bacteria 2825
549 nmdc:mga00v17_102185_c1 3300050491 Bacteria 1811
550 nmdc:mga00v17_15952_c1 3300050491 Bacteria 4227
551 nmdc:mga00v17_1758_c1 3300050491 Bacteria 11252
552 nmdc:mga00v17_4333_c1 3300050491 Bacteria 7371
553 nmdc:mga00v17_83611_c1 3300050491 Bacteria 1997
554 nmdc:mga0k408_1865_c1 3300050493 Bacteria 11320
555 nmdc:mga06z11_47478_c1 3300050494 Bacteria 2181
556 nmdc:mga06z11_7830_c1 3300050494 Bacteria 4419
557 nmdc:mga07m45_4599_c2 3300050496 Bacteria 6089
558 nmdc:mga08y16_169766_c1 3300050511 Bacteria 2266
559 nmdc:mga0n895_149757_c1 3300050512 Bacteria 2363
560 Ga0500610_0000158 3300053079 Bacteria 20255
561 Ga0500643_001164 3300053087 Bacteria 15686
562 Ga0500651_0001249 3300053093 Bacteria 12654
563 Ga0500650_0000007 3300053098 Bacteria 108097
564 Ga0500568_0003690 3300053139 Bacteria 8405
565 Ga0500577_0137301 3300053142 Bacteria 1029
566 Ga0500616_0107946 3300053153 Bacteria 1349
567 Ga0500634_0094406 3300053161 Bacteria 1510
568 Ga0501082_0021662 3300060353 Bacteria 5540
569 2510284134 2510065053 Bacteria 5005518
570 2510293190 2510065055 Bacteria 5037935
571 2510312684 2510065058 Bacteria 5005894
572 2525555999 2524614729 Bacteria 3091755
573 2547501601 2547132130 Bacteria 4660562
574 2572253449 2571042365 Bacteria 3289345
575 2578458986 2576861471 Bacteria 4648976
576 2630651013 2627854209 Bacteria 3093011
577 2643818984 2643221559 Bacteria 4424915
578 2643905705 2643221579 Bacteria 4443405
579 2643905706 2643221579 Bacteria 4443405
580 2643913164 2643221581 Bacteria 3893603
581 2643913165 2643221581 Bacteria 3893603
582 2643941345 2643221586 Bacteria 4446529
583 2643974384 2643221593 Bacteria 6296053
584 2643974385 2643221593 Bacteria 6296053
585 2644080410 2643221612 Bacteria 4361984
586 2644528795 2643221695 Bacteria 3441323
587 2644662884 2643221720 Bacteria 4694283
588 2644697023 2643221727 Bacteria 4415595
589 2644698161 2643221728 Bacteria 4797149
590 2747948697 2747842428 Bacteria 4689383
591 2765578389 2765235840 Bacteria 4663337
592 2774130520 2773857672 Bacteria 4993178
593 2816516416 2816332141 Bacteria 4436036
594 2819663582 2818991457 Bacteria 5323295
595 2842392873 2842391507 Bacteria 4486072
596 2842758662 2842757796 Bacteria 3981385
597 2852651317 2852649853 Bacteria 4036942
598 2852686285 2852684882 Bacteria 5463342
599 2857446847 2857442823 Bacteria 4562550
600 2874221017 2874220319 Bacteria 4594709
601 2895499210 2895498888 Bacteria 5283788
602 2895512232 2895511927 Bacteria 6802080
603 2895522243 2895522137 Bacteria 3284416
604 2895527314 2895525241 Bacteria 3388457
605 2919091228 2919089067 Bacteria 4560942
606 2919132411 2919130084 Bacteria 5301837
607 2919136738 2919134579 Bacteria 4480386
608 2919516544 2919513703 Bacteria 3844312
609 2919678572 2919675420 Bacteria 3969095
610 2923517807 2923516293 Bacteria 3716336
611 2923517808 2923516293 Bacteria 3716336
612 2928497859 2928496128 Bacteria 4631123
613 2929197122 2929195423 Bacteria 5325372
614 2931381339 2931380184 Bacteria 4455911
615 2937611838 2937610967 Bacteria 4618818
616 2939590524 2939589442 Bacteria 4214238
617 2939622683 2939622612 Bacteria 4698046
618 2939627779 2939626828 Bacteria 4695272
619 2941477741 2941475908 Bacteria 4145589
620 2941489594 2941489479 Bacteria 6313767
621 2941489595 2941489479 Bacteria 6313767
622 2961047782 2961047084 Bacteria 4594415
623 2961067124 2961064222 Bacteria 4749990
624 2974301543 2974298342 Bacteria 4840922
625 2974309432 2974307012 Bacteria 4172388
626 2977250151 2977247770 Bacteria 4160543
627 2984503986 2984499530 Bacteria 5020881
628 2984515357 2984514374 Bacteria 4172479
629 2987605820 2987605356 Bacteria 4187822
630 2995950869 2995948881 Bacteria 6358104
631 2995950870 2995948881 Bacteria 6358104
632 8002871674 8002869464 Bacteria 3588529
633 8002871675 8002869464 Bacteria 3588529
634 8021626518 8021622325 Bacteria 4844743
635 8021628139 8021626552 Bacteria 4665214
636 8021648631 8021648035 Bacteria 4772378
637 Ga0501031_0035577
638 SwRhRL2b_contig_42121
639 JGI24741J21665_1002078
640 JGI25152J39213_1000252
641 JGI25150J39212_1000322
642 JGI25151J46595_10000183
643 JGI25151J46595_10000522
644 JGI25153J46596_10000311
645 Ga0055526_1000036
646 Ga0055526_1001709
647 Ga0055526_1009464
648 Ga0055537_1000083
649 Ga0055537_1000392
650 Ga0055524_1000359
651 Ga0055536_1001515
652 Ga0055536_1003198
653 Ga0055536_1004862
654 Ga0055536_1009027
655 Ga0055534_1000103
656 Ga0055534_1000328
657 Ga0055528_1000004
658 Ga0055528_1000115
659 Ga0055530_10003828
660 Ga0055531_10011297
661 Ga0055531_10011726
662 Ga0055531_10017094
663 Ga0058692_1000002
664 Ga0058692_1000020
665 Ga0065704_10006659
666 Ga0065704_10073140
667 Ga0065704_10080768
668 Ga0065715_10194591
669 Ga0070670_100000064
670 Ga0070670_100001108
671 Ga0070670_100062560
672 Ga0070666_10037596
673 Ga0070666_10112566
674 Ga0070680_100000405
675 Ga0070680_100008797
676 Ga0070660_100026051
677 Ga0070660_100037696
678 Ga0070661_100004480
679 Ga0070661_100254797
680 Ga0070661_100383441
681 Ga0070692_10011935
682 Ga0070668_100005796
683 Ga0070668_100050653
684 Ga0070668_100075087
685 Ga0070668_100278924
686 Ga0070669_100012001
687 Ga0070669_100088864
688 Ga0070669_100301564
689 Ga0070671_100000025
690 Ga0070671_100004291
691 Ga0070671_100102580
692 Ga0070671_100135430
693 Ga0070674_100051839
694 Ga0070674_100281229
695 Ga0070688_100002099
696 Ga0070659_100003974
697 Ga0070667_100000012
698 Ga0070667_100000095
699 Ga0070663_100000126
700 Ga0070663_100011268
701 Ga0070663_100027309
702 Ga0070678_100120271
703 Ga0070678_100134573
704 Ga0070681_10003393
705 Ga0070685_10000005
706 Ga0070679_100000681
707 Ga0070679_100002883
708 Ga0068853_100000768
709 Ga0068853_100008635
710 Ga0068853_100042082
711 Ga0070696_100007449
712 Ga0070693_100000911
713 Ga0070693_100022123
714 Ga0070665_100000077
715 Ga0070665_100007283
716 Ga0070665_100015383
717 Ga0070665_100036667
718 Ga0070665_100061222
719 Ga0070665_100092750
720 Ga0070665_100094082
721 Ga0070665_100127021
722 Ga0070665_100314230
723 Ga0068855_100001280
724 Ga0068855_100030800
725 Ga0068855_100046292
726 Ga0068855_100046906
727 Ga0070664_100120811
728 Ga0070664_100264376
729 Ga0068857_100057901
730 Ga0068854_100005144
731 Ga0068854_100011728
732 Ga0068854_100160550
733 Ga0068856_100000234
734 Ga0068852_100014711
735 Ga0068852_100058737
736 Ga0068852_100142938
737 Ga0068859_100003094
738 Ga0068859_100007853
739 Ga0068864_100000073
740 Ga0068863_100013677
741 Ga0068863_100438673
742 Ga0068858_100106608
743 Ga0068860_100002476
744 Ga0068860_100018691
745 Ga0068860_100163794
746 Ga0068862_100000164
747 Ga0068862_100001217
748 Ga0068862_100009079
749 Ga0081539_10015349
750 Ga0075364_10000438
751 Ga0075364_10001495
752 Ga0075364_10006217
753 Ga0075364_10042688
754 Ga0075364_10053176
755 Ga0075364_10185020
756 Ga0075362_10002219
757 Ga0075367_10003075
758 Ga0075367_10008976
759 Ga0075366_10003119
760 Ga0097621_100089419
761 Ga0075434_100149224
762 Ga0068865_100115328
763 Ga0068865_100192517
764 Ga0097620_100003094
765 Ga0097620_100007853
766 Ga0105251_10000010
767 Ga0105251_10007369
768 Ga0105244_10007676
769 Ga0105240_10020333
770 Ga0111539_10052153
771 Ga0105243_10010816
772 Ga0105243_10117107
773 Ga0105241_10516019
774 Ga0105248_10000179
775 Ga0105237_10000348
776 Ga0105237_10002762
777 Ga0105237_10126843
778 Ga0105238_10238095
779 Ga0105238_10433190
780 Ga0105249_10000262
781 Ga0105249_10414300
782 Ga0105032_102285
783 Ga0105239_10000401
784 Ga0105239_10095895
785 Ga0105239_10162004
786 Ga0157318_1000466
787 Ga0157327_1001669
788 Ga0157373_10019579
789 Ga0157373_10063523
790 Ga0157373_10086535
791 Ga0157371_10037059
792 Ga0157371_10066765
793 Ga0157370_10011223
794 Ga0157370_10017572
795 Ga0157370_10017945
796 Ga0157370_10083337
797 Ga0157370_10156688
798 Ga0157369_10001849
799 Ga0157369_10042343
800 Ga0157369_10162220
801 Ga0157369_10294003
802 Ga0157374_10014089
803 Ga0157372_10000421
804 Ga0157372_10214716
805 Ga0157372_10263919
806 Ga0163163_10001573
807 Ga0182008_10002138
808 Ga0157377_10038115
809 Ga0157379_10110387
810 Ga0182005_1004408
811 Ga0183360_10001
812 Ga0197907_11154955
813 Ga0206352_10574363
814 Ga0206354_11590007
815 Ga0154015_1567256
816 Ga0207425_1000283
817 Ga0209646_1003226
818 Ga0209026_1000162
819 Ga0209759_1000906
820 Ga0209129_1000365
821 Ga0209565_1000001
822 Ga0209565_1000014
823 Ga0209455_1000261
824 Ga0209673_1000001
825 Ga0209673_1000623
826 Ga0209130_1026971
827 Ga0209675_1000001
828 Ga0209675_1000021
829 Ga0209676_1000024
830 Ga0209676_1000047
831 Ga0209676_1000079
832 Ga0209676_1001198
833 Ga0209676_1005540
834 Ga0209676_1019683
835 Ga0209025_1000012
836 Ga0209025_1000015
837 Ga0209025_1007720
838 Ga0209025_1022654
839 Ga0209025_1027256
840 Ga0209564_1000001
841 Ga0209564_1000263
842 Ga0209758_1000018
843 Ga0209758_1011751
844 Ga0209758_1017780
845 Ga0209050_1000153
846 Ga0209050_1001146
847 Ga0209050_1011617
848 Ga0209050_1031241
849 Ga0209256_1000002
850 Ga0209256_1005467
851 Ga0209051_1001823
852 Ga0209051_1006438
853 Ga0209051_1010564
854 Ga0209257_1000081
855 Ga0209257_1000148
856 Ga0209257_1000988
857 Ga0209257_1001062
858 Ga0209257_1001483
859 Ga0209257_1004325
860 Ga0209257_1015480
861 Ga0207656_10045037
862 Ga0207713_1000292
863 Ga0207647_10000467
864 Ga0207647_10108731
865 Ga0207705_10000532
866 Ga0207707_10000229
867 Ga0207707_10000241
868 Ga0207707_10000607
869 Ga0207707_10003687
870 Ga0207707_10173209
871 Ga0207695_10021839
872 Ga0207695_10107679
873 Ga0207695_10120705
874 Ga0207695_10173677
875 Ga0207671_10000167
876 Ga0207671_10020004
877 Ga0207671_10079929
878 Ga0207660_10001209
879 Ga0207660_10138384
880 Ga0207660_10274081
881 Ga0207657_10008767
882 Ga0207657_10053425
883 Ga0207649_10005986
884 Ga0207649_10225719
885 Ga0207652_10000531
886 Ga0207652_10001033
887 Ga0207652_10004906
888 Ga0207652_10005786
889 Ga0207652_10161664
890 Ga0207652_10215981
891 Ga0207681_10005843
892 Ga0207681_10010548
893 Ga0207681_10035698
894 Ga0207681_10256283
895 Ga0207694_10003240
896 Ga0207694_10015555
897 Ga0207694_10124076
898 Ga0207694_10279842
899 Ga0207650_10000106
900 Ga0207650_10047545
901 Ga0207650_10070639
902 Ga0207644_10000049
903 Ga0207644_10001185
904 Ga0207644_10123618
905 Ga0207709_10000805
906 Ga0207709_10134122
907 Ga0207669_10122239
908 Ga0207704_10143233
909 Ga0207691_10041622
910 Ga0207711_10000393
911 Ga0207711_10000406
912 Ga0207689_10222188
913 Ga0207667_10000481
914 Ga0207667_10002512
915 Ga0207667_10024035
916 Ga0207667_10038881
917 Ga0207667_10039795
918 Ga0207667_10088441
919 Ga0207651_10150809
920 Ga0207651_10282001
921 Ga0207712_10018395
922 Ga0207712_10343718
923 Ga0207668_10009979
924 Ga0207668_10089222
925 Ga0207668_10090062
926 Ga0207640_10000423
927 Ga0207640_10002472
928 Ga0207640_10005569
929 Ga0207640_10020099
930 Ga0207640_10032912
931 Ga0207658_10000027
932 Ga0207658_10000073
933 Ga0207639_10000800
934 Ga0207639_10001128
935 Ga0207639_10026103
936 Ga0207639_10062770
937 Ga0207639_10076983
938 Ga0207639_10105299
939 Ga0207639_10226367
940 Ga0207678_10000258
941 Ga0207678_10014004
942 Ga0207678_10022995
943 Ga0207678_10072065
944 Ga0207678_10119925
945 Ga0207678_10121690
946 Ga0207678_10199245
947 Ga0207702_10000113
948 Ga0207702_10008183
949 Ga0207641_10006988
950 Ga0207641_10012294
951 Ga0207676_10000010
952 Ga0207674_10006108
953 Ga0207674_10014543
954 Ga0207683_10133266
955 Ga0207683_10148720
956 Ga0207698_10005479
957 Ga0207698_10009887
958 Ga0209973_1006852
959 Ga0209371_1000004
960 Ga0209371_1000011
961 Ga0210000_1007276
962 Ga0209999_1016445
963 Ga0209982_1009959
964 Ga0209970_1013972
965 Ga0209983_1003327
966 Ga0209971_1013948
967 Ga0209974_10016414
968 Ga0209974_10026909
969 Ga0268266_10000001
970 Ga0268266_10028958
971 Ga0268266_10051213
972 Ga0268266_10053633
973 Ga0268266_10173357
974 Ga0268266_10181353
975 Ga0268265_10000186
976 Ga0268265_10001086
977 Ga0268265_10010427
978 Ga0268265_10022795
979 Ga0268264_10000123
980 Ga0268264_10013370
981 Ga0268264_10309693
982 Ga0307515_10116400
983 Ga0268256_1000005
984 Ga0268256_1000011
985 Ga0316177_1136997
986 Ga0316176_1142398
987 Ga0314311_1231852
988 Ga0316183_1166111
989 Ga0265330_10000317
990 Ga0265332_10000327
991 Ga0265332_10097128
992 Ga0265329_10005943
993 Ga0265339_10016163
994 Ga0265331_10050053
995 Ga0265327_10052702
996 Ga0265316_10000399
997 Ga0265316_10020002
998 Ga0307513_10038394
999 Ga0307408_100180265
1000 Ga0316575_10025114
1001 Ga0265314_10000532
1002 Ga0265342_10000369
1003 Ga0307516_10102543
1004 Ga0307405_10008187
1005 Ga0307413_10024028
1006 Ga0307413_10042644
1007 Ga0307410_10035339
1008 Ga0307410_10151279
1009 Ga0307406_10026385
1010 Ga0307407_10028001
1011 Ga0307409_100215943
1012 Ga0307416_100029159
1013 Ga0307416_100042911
1014 Ga0307416_100249072
1015 Ga0307414_10001756
1016 Ga0307414_10008346
1017 Ga0307414_10017527
1018 Ga0307414_10040583
1019 Ga0307414_10170712
1020 Ga0307414_10206376
1021 Ga0307414_10227258
1022 Ga0307411_10044316
1023 Ga0307415_100035163
1024 Ga0316574_0144620
1025 Ga0395899_0009887
1026 Ga0395899_0011332
1027 Ga0395900_0098299
1028 Ga0395900_0099121
1029 Ga0395900_0157562
1030 Ga0395900_0175637
1031 Ga0395898_0030081
1032 Ga0395898_0061392
1033 Ga0395898_0116809
1034 Ga0395905_0002660
1035 Ga0395905_0004830
1036 Ga0395905_0036766
1037 Ga0395905_0080660
1038 Ga0395901_0018705
1039 Ga0395901_0086061
1040 Ga0237819_00047
1041 Ga0237819_04917
1042 Ga0439436_0025090
1043 Ga0439465_0002378
1044 Ga0439465_0008709
1045 Ga0439465_0068937
1046 Ga0451797_0878899
1047 Ga0451797_1574149
1048 Ga0451800_0984490
1049 Ga0451802_0202710
1050 Ga0451806_345240
1051 Ga0451804_0018860
1052 Ga0451807_0350558
1053 Ga0451837_1126891
1054 Ga0451843_1236032
1055 Ga0439432_035924
1056 Ga0439449_0000272
1057 Ga0439449_0004443
1058 Ga0439449_0004460
1059 Ga0439449_0020398
1060 Ga0439449_0032212
1061 Ga0451577_0002087
1062 Ga0466972_0000629
1063 Ga0466963_0178071
1064 Ga0466970_0000172
1065 Ga0466957_0067438
1066 Ga0466959_0038586
1067 Ga0495638_0183320
1068 Ga0495663_0002717
1069 Ga0495621_0011311
1070 Ga0495633_0009843
1071 Ga0495633_0028189
1072 Ga0495668_0013505
1073 Ga0495636_0020099
1074 Ga0495686_0001563
1075 Ga0496100_0142789
1076 Ga0496101_0060606
1077 Ga0496107_0239664
1078 Ga0496108_0023131
1079 Ga0496109_0010311
1080 Ga0496111_0053415
1081 Ga0496113_0010772
1082 Ga0496114_0000915
1083 Ga0496114_0086321
1084 Ga0496115_0139494
1085 Ga0496115_0285411
1086 Ga0496116_0022348
1087 Ga0496117_0001168
1088 Ga0496117_0008641
1089 Ga0496117_0010386
1090 Ga0496118_0000145
1091 Ga0496118_0000682
1092 Ga0496118_0003292
1093 Ga0496118_0024498
1094 Ga0496118_0129882
1095 Ga0496119_0001728
1096 Ga0496120_0000605
1097 Ga0496121_0000176
1098 Ga0496121_0004743
1099 Ga0496122_0000220
1100 Ga0496122_0001135
1101 Ga0496122_0001331
1102 Ga0496123_0000107
1103 Ga0496123_0000151
1104 Ga0496123_0000226
1105 Ga0496123_0074405
1106 Ga0496124_0000785
1107 Ga0496124_0076260
1108 Ga0496126_0017194
1109 Ga0496126_0095881
1110 Ga0501290_000542
1111 Ga0501300_010952
1112 Ga0501032_0001950
1113 Ga0501032_0053533
1114 Ga0501033_0009648
1115 Ga0501033_0016560
1116 Ga0501033_0044899
1117 Ga0501033_0122922
1118 Ga0501034_0000822
1119 Ga0501034_0002484
1120 Ga0501034_0010768
1121 Ga0501034_0023790
1122 Ga0501034_0089351
1123 Ga0501034_0132782
1124 Ga0501034_0195122
1125 Ga0501034_0391287
1126 Ga0501036_0022651
1127 Ga0501037_0001245
1128 Ga0501037_0037684
1129 Ga0501037_0056576
1130 Ga0501038_0006070
1131 Ga0501039_0010599
1132 Ga0501039_0019791
1133 Ga0501039_0021732
1134 Ga0501040_0063313
1135 Ga0501042_0029270
1136 Ga0501043_0002712
1137 Ga0501043_0010830
1138 Ga0501043_0020494
1139 Ga0501043_0065770
1140 Ga0501046_0014070
1141 Ga0501046_0028250
1142 Ga0501046_0030906
1143 Ga0501046_0286939
1144 Ga0501047_0008649
1145 Ga0501047_0018572
1146 Ga0501047_0090986
1147 Ga0501068_0008363
1148 Ga0501069_0045573
1149 Ga0501070_0023731
1150 Ga0501070_0042467
1151 Ga0501070_0080698
1152 Ga0501070_0166995
1153 Ga0501070_0351963
1154 Ga0501072_0200304
1155 Ga0501073_0031310
1156 Ga0501073_0073939
1157 Ga0501073_0080063
1158 Ga0501074_0137626
1159 Ga0501206_014084
1160 Ga0501257_010657
1161 Ga0501258_005025
1162 Ga0501225_0023020
1163 Ga0501225_0051860
1164 Ga0501079_0054416
1165 Ga0501080_0006579
1166 Ga0501080_0081368
1167 Ga0501080_0118455
1168 Ga0501080_0178029
1169 Ga0501080_0188210
1170 Ga0501080_0255198
1171 Ga0501265_000289
1172 Ga0501272_008396
1173 Ga0501275_000710
1174 Ga0501035_0013181
1175 Ga0501035_0034410
1176 Ga0501035_0132748
1177 Ga0501035_0175390
1178 Ga0501035_0189279
1179 Ga0501044_0005580
1180 Ga0501044_0013448
1181 Ga0501044_0015688
1182 Ga0501044_0019454
1183 Ga0501044_0068934
1184 nmdc:mga03683_15792_c1
1185 nmdc:mga00v17_102185_c1
1186 nmdc:mga00v17_15952_c1
1187 nmdc:mga00v17_1758_c1
1188 nmdc:mga00v17_4333_c1
1189 nmdc:mga00v17_83611_c1
1190 nmdc:mga0k408_1865_c1
1191 nmdc:mga06z11_47478_c1
1192 nmdc:mga06z11_7830_c1
1193 nmdc:mga07m45_4599_c2
1194 nmdc:mga08y16_169766_c1
1195 nmdc:mga0n895_149757_c1
1196 Ga0500610_0000158
1197 Ga0500643_001164
1198 Ga0500651_0001249
1199 Ga0500650_0000007
1200 Ga0500568_0003690
1201 Ga0500577_0137301
1202 Ga0500616_0107946
1203 Ga0500634_0094406
1204 Ga0501082_0021662
1205 2510284134
1206 2510293190
1207 2510312684
1208 2525555999
1209 2547501601
1210 2572253449
1211 2578458986
1212 2630651013
1213 2643818984
1214 2643905705
1215 2643905706
1216 2643913164
1217 2643913165
1218 2643941345
1219 2643974384
1220 2643974385
1221 2644080410
1222 2644528795
1223 2644662884
1224 2644697023
1225 2644698161
1226 2747948697
1227 2765578389
1228 2774130520
1229 2816516416
1230 2819663582
1231 2842392873
1232 2842758662
1233 2852651317
1234 2852686285
1235 2857446847
1236 2874221017
1237 2895499210
1238 2895512232
1239 2895522243
1240 2895527314
1241 2919091228
1242 2919132411
1243 2919136738
1244 2919516544
1245 2919678572
1246 2923517807
1247 2923517808
1248 2928497859
1249 2929197122
1250 2931381339
1251 2937611838
1252 2939590524
1253 2939622683
1254 2939627779
1255 2941477741
1256 2941489594
1257 2941489595
1258 2961047782
1259 2961067124
1260 2974301543
1261 2974309432
1262 2977250151
1263 2984503986
1264 2984515357
1265 2987605820
1266 2995950869
1267 2995950870
1268 8002871674
1269 8002871675
1270 8021626518
1271 8021628139
1272 8021648631

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01547

SBP_bac_1

Bacterial extracellular solute-binding protein

91

377

0.87

PF12849

PBP_like_2

PBP superfamily domain

82

373

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ods-assembly1.cif.gz_A phosphate-binding protein (psts) from xanthomonas citri pv. citri a306 bound to phosphate 0.9916 26 334
5i84-assembly5.cif.gz_E structure of the xanthomonas citri phosphate-binding protein phox 0.9913 26 337
5i84-assembly3.cif.gz_C structure of the xanthomonas citri phosphate-binding protein phox 0.9878 26 335
1pbp-assembly1.cif.gz_A fine tuning of the specificity of the periplasmic phosphate transport receptor: site-directed mutagenesis, ligand binding, and crystallographic studies 0.9839 25 336
1quj-assembly1.cif.gz_A phosphate-binding protein mutant with asp 137 replaced by gly complex with chlorine and phosphate 0.9824 25 336
ID Description Score Start End Superfamily
af_P0AG82_103_278_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9929 101 277 3.40.190.10
af_P0AG82_103_278_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9818 101 277 3.40.190.10
1pc3B02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.946 102 277 3.40.190.10
5i84A01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9441 26 337 3.40.190.10
5i84A01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9379 26 337 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A4S1FX25-F1-model_v4 Phosphate ABC transporter substrate-binding protein PstS 0.9943 114 217
AF-A0A6D0EMP2-F1-model_v4 deleted 0.9938 50 210
AF-A0A2G8T783-F1-model_v4 Phosphate-binding protein PstS 0.9934 78 256 GO:0035435
GO:0042301
GO:0043190
AF-A0A3S4FMK8-F1-model_v4 deleted 0.9934 85 209
AF-A0A1J9PHQ6-F1-model_v4 deleted 0.9925 107 277

Map