F473205

General Info

Members Datasets Scaffolds Average Seq Length
658 281 1316 141

Family's Representative Sequence

Representative Sequence 3300048915|Ga0496112_0169415|Ga0496112_0169415_1609_2103
Length 164
Sequence VSSTCVEIEAVMAADASPILAPLVKMLKIVAGPFTFRAQLEEERAPKTVAAIRSMLPFKSKLVHCKWSGESTWVPMGDTKIGDAGGLAFENHTSHPAPGQVLIYPGGISETEILFPYGSTLFSSKVGQLAGNHFATVIEGNDKLAEIGRLALWEGAQDFTIELA

Samples

Sample ID Description Type Environment
1 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
70 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
71 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
101 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
112 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
174 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
177 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
178 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
179 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
180 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
181 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
182 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
183 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
184 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
185 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
186 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
187 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
188 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
189 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
190 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
191 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
192 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
193 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
194 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
195 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
196 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
197 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
198 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
199 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
200 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
201 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
202 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
203 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
204 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
205 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
206 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
207 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
208 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
209 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
210 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
211 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
212 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
213 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
214 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
215 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
216 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
217 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
218 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
219 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
220 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
221 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
222 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
223 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
224 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
225 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
226 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
227 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
228 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
229 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
230 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
231 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
232 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
233 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
234 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
235 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
236 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
237 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
238 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
239 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
251 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
252 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
253 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
254 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
255 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
256 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
257 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
258 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
259 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
260 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
261 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
262 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
263 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
264 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
265 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
266 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
269 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
270 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
271 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
272 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
273 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
274 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
275 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
276 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
277 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
278 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
279 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
280 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
281 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.09
Metatranscriptomes 0.76
Isolates 0.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0.15
Rhizoplane 3.5
Rhizosphere 96.05
Stem 0
Stem Tuber 0
Unclassified 7.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496112_0169415 3300048915 Bacteria 2149
2 rootL2_10046681 3300003322 Bacteria 3337
3 Ga0065712_10160555 3300005290 Unclassified 1305
4 Ga0065707_10574066 3300005295 Bacteria 706
5 Ga0070658_10154964 3300005327 Bacteria 1920
6 Ga0070658_11998788 3300005327 Bacteria 500
7 Ga0070676_10000556 3300005328 Bacteria 18022
8 Ga0070683_100002327 3300005329 Bacteria 15074
9 Ga0070690_100115282 3300005330 Bacteria 1797
10 Ga0070690_100123765 3300005330 Bacteria 1739
11 Ga0070670_100000596 3300005331 Bacteria 28525
12 Ga0070677_10455320 3300005333 Bacteria 685
13 Ga0068869_100000184 3300005334 Bacteria 32054
14 Ga0070680_100001624 3300005336 Bacteria 16434
15 Ga0070680_100801680 3300005336 Bacteria 811
16 Ga0070682_100000464 3300005337 Bacteria 25534
17 Ga0070660_100001374 3300005339 Bacteria 16522
18 Ga0070689_100034790 3300005340 Bacteria 3845
19 Ga0070689_100922031 3300005340 Bacteria 774
20 Ga0070691_10002084 3300005341 Bacteria 8841
21 Ga0070691_10004600 3300005341 Bacteria 6268
22 Ga0070687_100018422 3300005343 Bacteria 3230
23 Ga0070661_100001302 3300005344 Bacteria 17520
24 Ga0070692_10000199 3300005345 Bacteria 16153
25 Ga0070692_10904004 3300005345 Bacteria 611
26 Ga0070669_100039045 3300005353 Bacteria 3448
27 Ga0070669_100436615 3300005353 Bacteria 1077
28 Ga0070671_100060257 3300005355 Bacteria 3160
29 Ga0070674_101872252 3300005356 Bacteria 545
30 Ga0070673_100027314 3300005364 Bacteria 4229
31 Ga0070673_100631331 3300005364 Bacteria 979
32 Ga0070659_100001042 3300005366 Bacteria 20273
33 Ga0070659_100592164 3300005366 Bacteria 952
34 Ga0070667_100030788 3300005367 Bacteria 4475
35 Ga0070703_10000802 3300005406 Bacteria 10283
36 Ga0070703_10001944 3300005406 Bacteria 6060
37 Ga0070714_100003311 3300005435 Bacteria 12016
38 Ga0070714_100016484 3300005435 Bacteria 5969
39 Ga0070714_100286028 3300005435 Bacteria 1533
40 Ga0070713_100004314 3300005436 Bacteria 9531
41 Ga0070710_10006186 3300005437 Bacteria 5730
42 Ga0070711_100042880 3300005439 Bacteria 3061
43 Ga0070705_100000716 3300005440 Bacteria 18891
44 Ga0070705_100010996 3300005440 Bacteria 4550
45 Ga0070705_100120293 3300005440 Bacteria 1694
46 Ga0070705_100620152 3300005440 Bacteria 839
47 Ga0070700_100027826 3300005441 Bacteria 3357
48 Ga0070694_100001937 3300005444 Bacteria 12265
49 Ga0070694_100024552 3300005444 Bacteria 3891
50 Ga0070694_100120095 3300005444 Bacteria 1885
51 Ga0070694_100281082 3300005444 Bacteria 1269
52 Ga0070694_100980321 3300005444 Unclassified 701
53 Ga0070708_100000368 3300005445 Bacteria 34096
54 Ga0070708_100002804 3300005445 Bacteria 13531
55 Ga0070708_100013053 3300005445 Bacteria 6790
56 Ga0070708_100042533 3300005445 Bacteria 3988
57 Ga0070708_100043963 3300005445 Unclassified 3926
58 Ga0070708_100051653 3300005445 Bacteria 3642
59 Ga0070708_100097046 3300005445 Unclassified 2693
60 Ga0070708_100221248 3300005445 Bacteria 1775
61 Ga0070708_100340495 3300005445 Bacteria 1413
62 Ga0070708_100667674 3300005445 Bacteria 979
63 Ga0070708_100710370 3300005445 Bacteria 946
64 Ga0070708_100733277 3300005445 Bacteria 929
65 Ga0070708_101282398 3300005445 Bacteria 684
66 Ga0070663_100010115 3300005455 Bacteria 5869
67 Ga0070663_100475233 3300005455 Unclassified 1034
68 Ga0070663_101056515 3300005455 Bacteria 708
69 Ga0070662_100002733 3300005457 Bacteria 10899
70 Ga0070662_101722853 3300005457 Bacteria 541
71 Ga0070681_10047084 3300005458 Bacteria 4310
72 Ga0070681_10060061 3300005458 Bacteria 3781
73 Ga0070681_10077633 3300005458 Bacteria 3278
74 Ga0070681_10166333 3300005458 Bacteria 2128
75 Ga0070681_10627132 3300005458 Bacteria 990
76 Ga0068867_100002240 3300005459 Bacteria 13591
77 Ga0068867_100862199 3300005459 Bacteria 812
78 Ga0070706_100003203 3300005467 Bacteria 16151
79 Ga0070706_100005074 3300005467 Bacteria 12579
80 Ga0070706_100005221 3300005467 Bacteria 12391
81 Ga0070706_100016058 3300005467 Bacteria 6915
82 Ga0070706_100055418 3300005467 Bacteria 3660
83 Ga0070706_100089033 3300005467 Bacteria 2862
84 Ga0070706_100143831 3300005467 Bacteria 2226
85 Ga0070706_100216767 3300005467 Bacteria 1787
86 Ga0070706_100364658 3300005467 Bacteria 1346
87 Ga0070706_101099382 3300005467 Bacteria 732
88 Ga0070706_101633440 3300005467 Bacteria 588
89 Ga0070707_100000912 3300005468 Bacteria 29321
90 Ga0070707_100015809 3300005468 Bacteria 7085
91 Ga0070707_100040704 3300005468 Bacteria 4446
92 Ga0070707_100052845 3300005468 Unclassified 3895
93 Ga0070707_100078161 3300005468 Bacteria 3192
94 Ga0070707_100156572 3300005468 Bacteria 2219
95 Ga0070707_100193001 3300005468 Bacteria 1986
96 Ga0070707_100219835 3300005468 Unclassified 1850
97 Ga0070707_100404957 3300005468 Bacteria 1324
98 Ga0070707_100430473 3300005468 Bacteria 1280
99 Ga0070707_100518972 3300005468 Bacteria 1153
100 Ga0070707_100696153 3300005468 Bacteria 979
101 Ga0070707_100843340 3300005468 Bacteria 880
102 Ga0070707_101672486 3300005468 Bacteria 604
103 Ga0070698_100000003 3300005471 Bacteria 137957
104 Ga0070698_100001505 3300005471 Bacteria 25863
105 Ga0070698_100001689 3300005471 Bacteria 24629
106 Ga0070698_100033653 3300005471 Bacteria 5309
107 Ga0070698_100047579 3300005471 Bacteria 4384
108 Ga0070698_100066915 3300005471 Bacteria 3614
109 Ga0070698_100081139 3300005471 Bacteria 3238
110 Ga0070698_100099359 3300005471 Bacteria 2883
111 Ga0070698_100156766 3300005471 Bacteria 2222
112 Ga0070698_100217984 3300005471 Bacteria 1842
113 Ga0070698_100428821 3300005471 Bacteria 1257
114 Ga0070698_100743938 3300005471 Unclassified 923
115 Ga0070698_100744529 3300005471 Bacteria 923
116 Ga0070698_100934312 3300005471 Bacteria 813
117 Ga0070698_101629343 3300005471 Bacteria 597
118 Ga0070699_100001430 3300005518 Bacteria 21926
119 Ga0070699_100003711 3300005518 Bacteria 13498
120 Ga0070699_100009254 3300005518 Bacteria 8534
121 Ga0070699_100017005 3300005518 Bacteria 6245
122 Ga0070699_100017391 3300005518 Bacteria 6172
123 Ga0070699_100042912 3300005518 Bacteria 3915
124 Ga0070699_100045524 3300005518 Bacteria 3797
125 Ga0070699_100049616 3300005518 Bacteria 3633
126 Ga0070699_100138833 3300005518 Bacteria 2145
127 Ga0070699_100178956 3300005518 Bacteria 1881
128 Ga0070699_100302615 3300005518 Bacteria 1435
129 Ga0070699_100335899 3300005518 Bacteria 1359
130 Ga0070699_100496192 3300005518 Bacteria 1109
131 Ga0070699_100694096 3300005518 Bacteria 930
132 Ga0070679_100000337 3300005530 Bacteria 39944
133 Ga0070679_100026242 3300005530 Bacteria 5720
134 Ga0070679_100057425 3300005530 Bacteria 3879
135 Ga0070679_100354391 3300005530 Bacteria 1415
136 Ga0070684_100001270 3300005535 Bacteria 18074
137 Ga0070684_100027129 3300005535 Bacteria 4831
138 Ga0070684_100100994 3300005535 Bacteria 2577
139 Ga0070684_100119059 3300005535 Bacteria 2374
140 Ga0070697_100000004 3300005536 Bacteria 284078
141 Ga0070697_100000579 3300005536 Bacteria 27659
142 Ga0070697_100006957 3300005536 Bacteria 8796
143 Ga0070697_100012474 3300005536 Bacteria 6658
144 Ga0070697_100014356 3300005536 Bacteria 6222
145 Ga0070697_100018374 3300005536 Bacteria 5511
146 Ga0070697_100090386 3300005536 Bacteria 2530
147 Ga0070697_100237069 3300005536 Bacteria 1557
148 Ga0070697_100598689 3300005536 Bacteria 969
149 Ga0068853_100000111 3300005539 Bacteria 55607
150 Ga0068853_100264821 3300005539 Bacteria 1581
151 Ga0070686_100505165 3300005544 Bacteria 939
152 Ga0070695_100000192 3300005545 Bacteria 29723
153 Ga0070695_100000344 3300005545 Bacteria 23796
154 Ga0070695_100023894 3300005545 Bacteria 3763
155 Ga0070695_100314009 3300005545 Bacteria 1163
156 Ga0070695_101453332 3300005545 Archaea 569
157 Ga0070696_100004178 3300005546 Bacteria 9620
158 Ga0070696_100099763 3300005546 Bacteria 2079
159 Ga0070696_100206696 3300005546 Unclassified 1468
160 Ga0070696_100225059 3300005546 Unclassified 1409
161 Ga0070696_100525269 3300005546 Unclassified 945
162 Ga0070693_100000173 3300005547 Bacteria 29921
163 Ga0070665_102075915 3300005548 Unclassified 573
164 Ga0070704_100001677 3300005549 Bacteria 12029
165 Ga0070704_100138287 3300005549 Bacteria 1898
166 Ga0068855_100000219 3300005563 Bacteria 72993
167 Ga0068855_100029103 3300005563 Bacteria 6606
168 Ga0070664_100001899 3300005564 Bacteria 16778
169 Ga0070664_100260426 3300005564 Bacteria 1561
170 Ga0068857_100001268 3300005577 Bacteria 19798
171 Ga0068857_100015971 3300005577 Bacteria 6576
172 Ga0068857_100254421 3300005577 Bacteria 1611
173 Ga0068857_100295862 3300005577 Bacteria 1492
174 Ga0068854_100000800 3300005578 Bacteria 18745
175 Ga0068854_100198117 3300005578 Bacteria 1577
176 Ga0068854_101075876 3300005578 Bacteria 715
177 Ga0068856_100003539 3300005614 Bacteria 15735
178 Ga0068856_100006383 3300005614 Bacteria 11565
179 Ga0068856_100046447 3300005614 Bacteria 4277
180 Ga0068856_100683891 3300005614 Bacteria 1046
181 Ga0070702_100038006 3300005615 Bacteria 2677
182 Ga0068852_100009459 3300005616 Bacteria 7240
183 Ga0068859_100004490 3300005617 Bacteria 14232
184 Ga0068859_100129394 3300005617 Bacteria 2595
185 Ga0068859_100379301 3300005617 Bacteria 1509
186 Ga0068859_100937593 3300005617 Bacteria 949
187 Ga0068864_100142633 3300005618 Bacteria 2162
188 Ga0068864_100247577 3300005618 Bacteria 1653
189 Ga0068864_100305042 3300005618 Bacteria 1491
190 Ga0068861_100001718 3300005719 Bacteria 14042
191 Ga0068851_10404805 3300005834 Bacteria 803
192 Ga0068870_10000173 3300005840 Bacteria 23147
193 Ga0068858_100018563 3300005842 Bacteria 6513
194 Ga0068860_100010782 3300005843 Bacteria 9021
195 Ga0068860_100137747 3300005843 Bacteria 2345
196 Ga0068862_100000611 3300005844 Bacteria 37118
197 Ga0070717_10000681 3300006028 Bacteria 21901
198 Ga0070717_10001530 3300006028 Bacteria 16022
199 Ga0070717_10011531 3300006028 Bacteria 6715
200 Ga0070717_10505074 3300006028 Bacteria 1093
201 Ga0070717_10574274 3300006028 Bacteria 1022
202 Ga0070717_10669980 3300006028 Bacteria 942
203 Ga0070717_12142509 3300006028 Bacteria 503
204 Ga0075432_10277928 3300006058 Unclassified 688
205 Ga0070715_10055704 3300006163 Bacteria 1717
206 Ga0070715_10082698 3300006163 Bacteria 1461
207 Ga0070715_10125353 3300006163 Bacteria 1229
208 Ga0070715_10155727 3300006163 Unclassified 1124
209 Ga0070716_100010546 3300006173 Bacteria 4636
210 Ga0070716_100018989 3300006173 Bacteria 3589
211 Ga0070716_100281302 3300006173 Bacteria 1148
212 Ga0070712_100057677 3300006175 Bacteria 2729
213 Ga0070712_100367042 3300006175 Bacteria 1182
214 Ga0070712_100681585 3300006175 Bacteria 875
215 Ga0097621_100152185 3300006237 Bacteria 1984
216 Ga0068871_100034860 3300006358 Bacteria 3996
217 Ga0075428_100414122 3300006844 Bacteria 1444
218 Ga0075430_101099253 3300006846 Unclassified 655
219 Ga0075431_100024903 3300006847 Bacteria 6136
220 Ga0075431_100747105 3300006847 Unclassified 954
221 Ga0075431_101198146 3300006847 Bacteria 722
222 Ga0075431_101659824 3300006847 Unclassified 596
223 Ga0075433_10013373 3300006852 Bacteria 6669
224 Ga0075433_10020684 3300006852 Bacteria 5507
225 Ga0075433_10026432 3300006852 Bacteria 4914
226 Ga0075433_10037423 3300006852 Bacteria 4187
227 Ga0075433_10044720 3300006852 Bacteria 3848
228 Ga0075433_10165317 3300006852 Bacteria 1969
229 Ga0075434_100056859 3300006871 Bacteria 3888
230 Ga0075434_100114131 3300006871 Bacteria 2714
231 Ga0075434_100126322 3300006871 Bacteria 2574
232 Ga0075434_100136087 3300006871 Bacteria 2476
233 Ga0075434_100328435 3300006871 Bacteria 1550
234 Ga0075434_101051893 3300006871 Unclassified 828
235 Ga0075429_100001122 3300006880 Bacteria 21576
236 Ga0075436_100010351 3300006914 Bacteria 6390
237 Ga0075436_100020611 3300006914 Bacteria 4524
238 Ga0075436_100039187 3300006914 Bacteria 3270
239 Ga0075436_100051093 3300006914 Bacteria 2853
240 Ga0075436_100079795 3300006914 Bacteria 2267
241 Ga0075436_100146213 3300006914 Bacteria 1662
242 Ga0075436_100224672 3300006914 Bacteria 1333
243 Ga0075436_100377282 3300006914 Bacteria 1025
244 Ga0097620_100004490 3300006931 Bacteria 14232
245 Ga0097620_100129395 3300006931 Bacteria 2595
246 Ga0097620_100379307 3300006931 Bacteria 1509
247 Ga0097620_100937562 3300006931 Bacteria 949
248 Ga0075435_100011096 3300007076 Bacteria 6608
249 Ga0075435_100027776 3300007076 Bacteria 4430
250 Ga0075435_100053369 3300007076 Bacteria 3260
251 Ga0075435_100063261 3300007076 Bacteria 3005
252 Ga0075435_100148552 3300007076 Bacteria 1969
253 Ga0075435_100259785 3300007076 Bacteria 1479
254 Ga0075435_100613831 3300007076 Bacteria 943
255 Ga0075435_100836270 3300007076 Bacteria 802
256 Ga0099794_10027607 3300007265 Bacteria 2633
257 Ga0099794_10062699 3300007265 Bacteria 1808
258 Ga0111539_10915035 3300009094 Unclassified 1020
259 Ga0105245_10449198 3300009098 Bacteria 1297
260 Ga0105247_10365609 3300009101 Bacteria 1019
261 Ga0114129_10009751 3300009147 Bacteria 13697
262 Ga0114129_10161721 3300009147 Unclassified 3058
263 Ga0114129_10166399 3300009147 Bacteria 3009
264 Ga0114129_10332883 3300009147 Bacteria 2015
265 Ga0114129_10474690 3300009147 Bacteria 1637
266 Ga0114129_10566308 3300009147 Bacteria 1476
267 Ga0114129_10703641 3300009147 Bacteria 1298
268 Ga0114129_11079641 3300009147 Bacteria 1006
269 Ga0105243_10371785 3300009148 Bacteria 1319
270 Ga0105243_11014962 3300009148 Bacteria 833
271 Ga0105241_10000394 3300009174 Bacteria 33141
272 Ga0105241_10621389 3300009174 Bacteria 978
273 Ga0105241_10986923 3300009174 Bacteria 787
274 Ga0105242_10189718 3300009176 Bacteria 1819
275 Ga0105248_10177030 3300009177 Bacteria 2404
276 Ga0105237_10004386 3300009545 Bacteria 16356
277 Ga0105237_10101218 3300009545 Bacteria 2873
278 Ga0105237_10160278 3300009545 Bacteria 2248
279 Ga0105238_10042520 3300009551 Bacteria 4601
280 Ga0105238_10230934 3300009551 Bacteria 1827
281 Ga0105238_11376319 3300009551 Bacteria 732
282 Ga0105249_10396233 3300009553 Bacteria 1410
283 Ga0099796_10051647 3300010159 Unclassified 1429
284 Ga0105239_10816112 3300010375 Bacteria 1069
285 Ga0105246_10110617 3300011119 Unclassified 2018
286 Ga0157373_10000051 3300013100 Bacteria 105264
287 Ga0157373_10185371 3300013100 Bacteria 1466
288 Ga0157371_10307315 3300013102 Bacteria 1149
289 Ga0157370_10371724 3300013104 Bacteria 1317
290 Ga0157369_10010586 3300013105 Bacteria 10499
291 Ga0157369_10025725 3300013105 Bacteria 6530
292 Ga0163162_10389334 3300013306 Bacteria 1527
293 Ga0163162_11098915 3300013306 Bacteria 901
294 Ga0157372_10001083 3300013307 Bacteria 29625
295 Ga0157372_10032114 3300013307 Bacteria 5754
296 Ga0157372_10497580 3300013307 Bacteria 1421
297 Ga0157372_10797068 3300013307 Bacteria 1098
298 Ga0157372_12343289 3300013307 Bacteria 613
299 Ga0157372_12466530 3300013307 Unclassified 597
300 Ga0163163_10062290 3300014325 Bacteria 3696
301 Ga0157377_10041102 3300014745 Bacteria 2564
302 Ga0157379_10244762 3300014968 Unclassified 1627
303 Ga0182007_10029010 3300015262 Bacteria 1896
304 Ga0163161_10439200 3300017792 Unclassified 1053
305 Ga0206350_10295288 3300020080 Bacteria 700
306 Ga0206350_10646724 3300020080 Bacteria 771
307 Ga0154015_1169539 3300020610 Bacteria 1161
308 Ga0154015_1662471 3300020610 Bacteria 544
309 Ga0224712_10010958 3300022467 Unclassified 2793
310 Ga0207653_10000824 3300025885 Bacteria 10350
311 Ga0207653_10001098 3300025885 Bacteria 8874
312 Ga0207653_10002427 3300025885 Bacteria 5922
313 Ga0207710_10075550 3300025900 Unclassified 1553
314 Ga0207680_10149862 3300025903 Bacteria 1554
315 Ga0207647_10136191 3300025904 Bacteria 1441
316 Ga0207685_10137365 3300025905 Bacteria 1092
317 Ga0207699_10176956 3300025906 Bacteria 1431
318 Ga0207645_10000062 3300025907 Bacteria 76875
319 Ga0207645_10229836 3300025907 Bacteria 1224
320 Ga0207643_10000219 3300025908 Bacteria 40245
321 Ga0207705_10792929 3300025909 Bacteria 735
322 Ga0207684_10000035 3300025910 Bacteria 289353
323 Ga0207684_10005095 3300025910 Bacteria 12248
324 Ga0207684_10005357 3300025910 Bacteria 11852
325 Ga0207684_10006721 3300025910 Bacteria 10445
326 Ga0207684_10010175 3300025910 Bacteria 8283
327 Ga0207684_10013567 3300025910 Bacteria 7043
328 Ga0207684_10051786 3300025910 Bacteria 3484
329 Ga0207684_10080139 3300025910 Bacteria 2777
330 Ga0207684_10114708 3300025910 Bacteria 2307
331 Ga0207684_10242639 3300025910 Bacteria 1554
332 Ga0207684_10291647 3300025910 Bacteria 1407
333 Ga0207654_10016553 3300025911 Bacteria 3842
334 Ga0207654_10987586 3300025911 Bacteria 612
335 Ga0207707_10000047 3300025912 Bacteria 118016
336 Ga0207707_10080058 3300025912 Bacteria 2853
337 Ga0207707_10154217 3300025912 Bacteria 2008
338 Ga0207707_10200898 3300025912 Bacteria 1738
339 Ga0207671_10016883 3300025914 Bacteria 5652
340 Ga0207671_10365736 3300025914 Bacteria 1145
341 Ga0207693_10013161 3300025915 Bacteria 6674
342 Ga0207693_10115810 3300025915 Bacteria 2104
343 Ga0207693_11147283 3300025915 Bacteria 588
344 Ga0207663_10037521 3300025916 Bacteria 2922
345 Ga0207663_10074795 3300025916 Bacteria 2196
346 Ga0207660_10001817 3300025917 Bacteria 14216
347 Ga0207660_11411135 3300025917 Bacteria 564
348 Ga0207662_11067552 3300025918 Unclassified 574
349 Ga0207657_10000021 3300025919 Bacteria 155900
350 Ga0207649_10008334 3300025920 Bacteria 5650
351 Ga0207649_10373260 3300025920 Unclassified 1061
352 Ga0207652_10000922 3300025921 Bacteria 27650
353 Ga0207652_10016152 3300025921 Bacteria 6089
354 Ga0207652_10170693 3300025921 Bacteria 1952
355 Ga0207646_10000127 3300025922 Bacteria 103693
356 Ga0207646_10001275 3300025922 Bacteria 31514
357 Ga0207646_10006816 3300025922 Bacteria 11749
358 Ga0207646_10009589 3300025922 Bacteria 9551
359 Ga0207646_10011893 3300025922 Bacteria 8396
360 Ga0207646_10013824 3300025922 Bacteria 7697
361 Ga0207646_10026904 3300025922 Bacteria 5244
362 Ga0207646_10027191 3300025922 Bacteria 5217
363 Ga0207646_10054273 3300025922 Bacteria 3585
364 Ga0207646_10061957 3300025922 Bacteria 3339
365 Ga0207646_10064236 3300025922 Bacteria 3276
366 Ga0207646_10078842 3300025922 Bacteria 2944
367 Ga0207646_10106352 3300025922 Bacteria 2517
368 Ga0207646_10123585 3300025922 Bacteria 2327
369 Ga0207646_10123778 3300025922 Bacteria 2324
370 Ga0207646_10167098 3300025922 Bacteria 1986
371 Ga0207646_10260137 3300025922 Unclassified 1568
372 Ga0207646_10334694 3300025922 Bacteria 1368
373 Ga0207646_10442863 3300025922 Bacteria 1172
374 Ga0207681_10031576 3300025923 Bacteria 3460
375 Ga0207694_10069964 3300025924 Bacteria 2742
376 Ga0207694_10884110 3300025924 Bacteria 755
377 Ga0207650_10015740 3300025925 Bacteria 5273
378 Ga0207687_10299589 3300025927 Bacteria 1295
379 Ga0207700_10003827 3300025928 Bacteria 8789
380 Ga0207700_10065566 3300025928 Bacteria 2771
381 Ga0207700_10114039 3300025928 Bacteria 2180
382 Ga0207664_10007423 3300025929 Bacteria 7599
383 Ga0207664_10066742 3300025929 Bacteria 2885
384 Ga0207664_10158478 3300025929 Bacteria 1929
385 Ga0207664_10253130 3300025929 Bacteria 1538
386 Ga0207690_10004322 3300025932 Bacteria 8390
387 Ga0207690_10763568 3300025932 Bacteria 798
388 Ga0207706_10005155 3300025933 Bacteria 12197
389 Ga0207686_10615159 3300025934 Bacteria 856
390 Ga0207709_10193929 3300025935 Bacteria 1445
391 Ga0207709_11608687 3300025935 Bacteria 540
392 Ga0207670_10024124 3300025936 Bacteria 3798
393 Ga0207669_10873078 3300025937 Bacteria 750
394 Ga0207665_10000261 3300025939 Bacteria 36619
395 Ga0207665_10016024 3300025939 Bacteria 4922
396 Ga0207665_10134477 3300025939 Bacteria 1758
397 Ga0207665_10763233 3300025939 Bacteria 763
398 Ga0207711_10131410 3300025941 Bacteria 2245
399 Ga0207711_10281233 3300025941 Bacteria 1532
400 Ga0207689_10000516 3300025942 Bacteria 36653
401 Ga0207689_10130414 3300025942 Bacteria 2069
402 Ga0207661_10000910 3300025944 Bacteria 19412
403 Ga0207661_10001421 3300025944 Bacteria 16130
404 Ga0207661_10193629 3300025944 Bacteria 1784
405 Ga0207679_10000705 3300025945 Bacteria 22298
406 Ga0207679_10804514 3300025945 Bacteria 857
407 Ga0207679_10928523 3300025945 Bacteria 796
408 Ga0207667_10005241 3300025949 Bacteria 15816
409 Ga0207667_10874410 3300025949 Bacteria 892
410 Ga0207712_10436679 3300025961 Bacteria 1108
411 Ga0207640_10005506 3300025981 Bacteria 6903
412 Ga0207640_10795682 3300025981 Bacteria 819
413 Ga0207640_11092251 3300025981 Bacteria 705
414 Ga0207658_10068623 3300025986 Bacteria 2676
415 Ga0207703_10247677 3300026035 Bacteria 1604
416 Ga0207703_10889950 3300026035 Bacteria 852
417 Ga0207639_10010246 3300026041 Bacteria 6486
418 Ga0207639_10076362 3300026041 Bacteria 2638
419 Ga0207639_10932104 3300026041 Bacteria 812
420 Ga0207678_10001391 3300026067 Bacteria 22252
421 Ga0207678_10839978 3300026067 Bacteria 811
422 Ga0207708_10040893 3300026075 Bacteria 3535
423 Ga0207702_10001148 3300026078 Bacteria 27096
424 Ga0207702_10016684 3300026078 Bacteria 6078
425 Ga0207702_10018134 3300026078 Bacteria 5823
426 Ga0207702_10874148 3300026078 Bacteria 890
427 Ga0207641_10035878 3300026088 Bacteria 4135
428 Ga0207648_10009287 3300026089 Bacteria 9433
429 Ga0207648_10466842 3300026089 Bacteria 1151
430 Ga0207648_10887512 3300026089 Bacteria 832
431 Ga0207676_10148550 3300026095 Bacteria 2015
432 Ga0207676_10208545 3300026095 Bacteria 1732
433 Ga0207674_10000137 3300026116 Bacteria 84955
434 Ga0207674_10002627 3300026116 Bacteria 22496
435 Ga0207674_10080429 3300026116 Bacteria 3262
436 Ga0207674_10874622 3300026116 Bacteria 866
437 Ga0207675_100005591 3300026118 Bacteria 12031
438 Ga0207675_100108774 3300026118 Bacteria 2615
439 Ga0207698_10013879 3300026142 Bacteria 5334
440 Ga0209996_1004023 3300027395 Bacteria 1863
441 Ga0209968_1001059 3300027526 Bacteria 4195
442 Ga0209970_1005879 3300027614 Bacteria 2016
443 Ga0209971_1000030 3300027682 Bacteria 50605
444 Ga0209966_1000518 3300027695 Bacteria 9982
445 Ga0209998_10000007 3300027717 Bacteria 99753
446 Ga0209974_10005666 3300027876 Bacteria 4384
447 Ga0207428_10463056 3300027907 Unclassified 923
448 Ga0268265_10008195 3300028380 Bacteria 7059
449 Ga0268265_10124103 3300028380 Bacteria 2133
450 Ga0268264_10255667 3300028381 Bacteria 1629
451 Ga0268264_11679737 3300028381 Bacteria 646
452 Ga0268264_12226500 3300028381 Bacteria 556
453 Ga0265338_10021958 3300028800 Bacteria 6632
454 Ga0307406_11111089 3300031901 Bacteria 683
455 Ga0307406_12080911 3300031901 Bacteria 508
456 Ga0307407_10179460 3300031903 Bacteria 1402
457 Ga0307407_10991351 3300031903 Bacteria 649
458 Ga0307412_10594322 3300031911 Unclassified 936
459 Ga0307409_100388941 3300031995 Bacteria 1328
460 Ga0307409_100390543 3300031995 Bacteria 1326
461 Ga0307416_100036888 3300032002 Bacteria 3755
462 Ga0307416_101002724 3300032002 Bacteria 938
463 Ga0307416_101335460 3300032002 Bacteria 823
464 Ga0307414_10053595 3300032004 Unclassified 2814
465 Ga0307415_100145941 3300032126 Bacteria 1814
466 Ga0373948_0007310 3300034817 Bacteria 1854
467 Ga0373950_0005212 3300034818 Bacteria 1933
468 Ga0373929_0030774 3300035085 Bacteria 1146
469 Ga0373940_0168555 3300035088 Bacteria 706
470 Ga0373940_0181411 3300035088 Bacteria 684
471 Ga0373944_0148940 3300035089 Unclassified 824
472 Ga0373949_0102571 3300035090 Bacteria 785
473 Ga0373951_0005575 3300035091 Bacteria 2919
474 Ga0373939_0101818 3300035114 Bacteria 987
475 Ga0373941_0069242 3300035115 Bacteria 1167
476 Ga0373941_0257795 3300035115 Unclassified 683
477 Ga0373953_0030319 3300035117 Bacteria 2097
478 Ga0373960_0021009 3300035121 Bacteria 1731
479 Ga0373943_0011516 3300035170 Bacteria 3981
480 Ga0373955_0064542 3300035172 Bacteria 2030
481 Ga0373961_0196905 3300035241 Unclassified 709
482 Ga0373962_0086344 3300035242 Bacteria 960
483 Ga0373931_0030828 3300035691 Bacteria 2763
484 Ga0373931_0071700 3300035691 Bacteria 1893
485 Ga0373935_0769913 3300035692 Unclassified 710
486 Ga0373927_0177637 3300035695 Bacteria 1396
487 Ga0373947_0018173 3300035725 Bacteria 4046
488 Ga0373947_0290725 3300035725 Bacteria 1088
489 Ga0373937_0464517 3300036401 Unclassified 1202
490 Ga0373937_0658199 3300036401 Bacteria 993
491 Ga0373937_1616910 3300036401 Bacteria 595
492 Ga0373925_1683592 3300037068 Bacteria 518
493 Ga0242420_128848 3300038996 Bacteria 557
494 Ga0451839_1328708 3300041496 Unclassified 585
495 Ga0439448_0012354 3300042005 Bacteria 2556
496 Ga0439450_005787 3300042008 Bacteria 2193
497 Ga0439455_0029996 3300042012 Bacteria 1347
498 Ga0439459_0007577 3300042438 Bacteria 1837
499 Ga0439460_0000543 3300042461 Bacteria 8259
500 Ga0451577_0007768 3300042876 Bacteria 10512
501 Ga0451577_0099946 3300042876 Bacteria 2591
502 Ga0451577_0284121 3300042876 Bacteria 1499
503 Ga0466969_0385503 3300044656 Bacteria 636
504 Ga0466966_0213154 3300044684 Bacteria 1167
505 Ga0453684_0097361 3300044712 Bacteria 3611
506 Ga0453684_0654914 3300044712 Bacteria 1146
507 Ga0451576_0006733 3300045051 Bacteria 13998
508 Ga0451576_0181980 3300045051 Bacteria 2194
509 Ga0451576_0421452 3300045051 Bacteria 1400
510 Ga0451576_0435155 3300045051 Bacteria 1376
511 Ga0466967_1498033 3300045976 Bacteria 672
512 Ga0495618_0020262 3300046514 Bacteria 4095
513 Ga0495628_0037485 3300046516 Bacteria 3887
514 Ga0495630_0057279 3300046517 Bacteria 2920
515 Ga0495640_0086872 3300046533 Bacteria 2070
516 Ga0495586_0155989 3300046535 Bacteria 1286
517 Ga0495634_0116211 3300046642 Bacteria 1716
518 Ga0495658_0253652 3300046683 Bacteria 1107
519 Ga0495674_0225847 3300047319 Bacteria 1547
520 Ga0495674_0434742 3300047319 Bacteria 1056
521 Ga0495686_0463077 3300047472 Bacteria 672
522 Ga0496101_1295154 3300048904 Bacteria 570
523 Ga0496102_0571845 3300048905 Bacteria 1053
524 Ga0496104_0003857 3300048907 Bacteria 12971
525 Ga0496105_0001646 3300048908 Bacteria 15908
526 Ga0496106_0047042 3300048909 Bacteria 3245
527 Ga0496106_0569942 3300048909 Bacteria 908
528 Ga0496107_0094047 3300048910 Bacteria 2193
529 Ga0496109_0342696 3300048912 Bacteria 1411
530 Ga0496109_0376060 3300048912 Bacteria 1342
531 Ga0496109_0410860 3300048912 Bacteria 1279
532 Ga0496110_0080123 3300048913 Bacteria 2909
533 Ga0496111_0851054 3300048914 Bacteria 658
534 Ga0496112_0011876 3300048915 Bacteria 7976
535 Ga0496112_0472587 3300048915 Bacteria 1191
536 Ga0496112_0750895 3300048915 Bacteria 902
537 Ga0496112_1507336 3300048915 Bacteria 586
538 Ga0496113_0921183 3300048916 Bacteria 691
539 Ga0496114_0004681 3300048917 Bacteria 10641
540 Ga0496115_0005310 3300048918 Bacteria 9368
541 Ga0496115_0007377 3300048918 Bacteria 8092
542 Ga0496115_0072359 3300048918 Bacteria 2797
543 Ga0496115_0209302 3300048918 Bacteria 1611
544 Ga0501032_0817353 3300049569 Bacteria 588
545 Ga0501036_0050972 3300049572 Bacteria 3505
546 Ga0501037_0104159 3300049573 Bacteria 2046
547 Ga0501039_0045196 3300049575 Bacteria 3402
548 Ga0501040_0037643 3300049576 Bacteria 3287
549 Ga0501040_0079557 3300049576 Bacteria 2269
550 Ga0501040_0116812 3300049576 Bacteria 1869
551 Ga0501041_0003130 3300049577 Bacteria 9521
552 Ga0501042_0162834 3300049578 Bacteria 1609
553 Ga0501043_0024003 3300049579 Bacteria 4785
554 Ga0501046_0001249 3300049580 Bacteria 24589
555 Ga0501046_0115465 3300049580 Bacteria 2047
556 Ga0501047_0161380 3300049581 Bacteria 2113
557 Ga0501048_0001345 3300049582 Bacteria 18641
558 Ga0501067_0001495 3300049583 Bacteria 12726
559 Ga0501067_0013578 3300049583 Bacteria 4511
560 Ga0501067_0046842 3300049583 Bacteria 2400
561 Ga0501067_0252487 3300049583 Bacteria 982
562 Ga0501068_0151979 3300049584 Bacteria 1455
563 Ga0501068_0289680 3300049584 Bacteria 1047
564 Ga0501069_0014678 3300049585 Bacteria 4190
565 Ga0501069_0168077 3300049585 Bacteria 1265
566 Ga0501070_0072501 3300049586 Bacteria 2851
567 Ga0501070_0110047 3300049586 Bacteria 2277
568 Ga0501070_1183212 3300049586 Bacteria 587
569 Ga0501071_0028506 3300049587 Bacteria 3937
570 Ga0501071_0369603 3300049587 Bacteria 1093
571 Ga0501072_0073900 3300049588 Bacteria 2695
572 Ga0501072_0679305 3300049588 Bacteria 810
573 Ga0501075_0059316 3300049591 Bacteria 2882
574 Ga0501075_0149397 3300049591 Bacteria 1781
575 Ga0501075_0691354 3300049591 Unclassified 777
576 Ga0501076_0008426 3300049592 Bacteria 7556
577 Ga0501076_0135700 3300049592 Bacteria 1997
578 Ga0501076_0430081 3300049592 Bacteria 1086
579 Ga0501076_1031146 3300049592 Bacteria 678
580 Ga0501077_0195330 3300049593 Bacteria 1285
581 Ga0501199_031090 3300049650 Bacteria 659
582 Ga0501202_166165 3300049652 Bacteria 587
583 Ga0501235_161569 3300049669 Bacteria 586
584 Ga0501257_117665 3300049686 Bacteria 709
585 Ga0501079_0000310 3300049741 Bacteria 30465
586 Ga0501079_0173858 3300049741 Bacteria 1679
587 Ga0501079_0410973 3300049741 Bacteria 1062
588 Ga0501080_0882551 3300049742 Bacteria 780
589 Ga0501080_1053134 3300049742 Bacteria 704
590 Ga0501083_0053862 3300049744 Bacteria 2700
591 Ga0501035_0142670 3300049822 Bacteria 2082
592 Ga0501044_0063758 3300049823 Bacteria 3763
593 Ga0501044_0501574 3300049823 Unclassified 1115
594 Ga0501045_0014624 3300049824 Bacteria 5564
595 Ga0501045_0164502 3300049824 Bacteria 1652
596 Ga0501045_0254066 3300049824 Bacteria 1308
597 Ga0501045_0400265 3300049824 Bacteria 1022
598 nmdc:mga05p37_1070541_c1 3300050507 Bacteria 848
599 nmdc:mga05p37_123539_c1 3300050507 Bacteria 3180
600 nmdc:mga05p37_2019013_c1 3300050507 Bacteria 545
601 nmdc:mga05p37_223404_c1 3300050507 Unclassified 2272
602 nmdc:mga05p37_310687_c1 3300050507 Bacteria 1868
603 nmdc:mga05p37_452536_c1 3300050507 Bacteria 1485
604 nmdc:mga05p37_515006_c1 3300050507 Bacteria 1370
605 nmdc:mga05p37_578129_c1 3300050507 Bacteria 1273
606 nmdc:mga05p37_74471_c1 3300050507 Bacteria 4179
607 nmdc:mga05p37_830811_c1 3300050507 Bacteria 1006
608 nmdc:mga05p37_85663_c1 3300050507 Bacteria 3883
609 nmdc:mga09592_16057_c1 3300050508 Bacteria 6121
610 nmdc:mga09592_224516_c1 3300050508 Bacteria 1627
611 nmdc:mga06r32_1080124_c1 3300050510 Bacteria 752
612 nmdc:mga06r32_429174_c1 3300050510 Bacteria 1302
613 nmdc:mga06r32_602979_c1 3300050510 Bacteria 1069
614 nmdc:mga06r32_69950_c1 3300050510 Unclassified 3393
615 nmdc:mga08y16_828933_c1 3300050511 Unclassified 916
616 nmdc:mga0n895_117732_c1 3300050512 Unclassified 2676
617 nmdc:mga0n895_1247225_c1 3300050512 Bacteria 716
618 nmdc:mga0n895_1664_c1 3300050512 Bacteria 12894
619 nmdc:mga0n895_236865_c1 3300050512 Bacteria 1852
620 nmdc:mga0n895_252472_c1 3300050512 Bacteria 1790
621 nmdc:mga0n895_262738_c1 3300050512 Bacteria 1752
622 nmdc:mga0rr50_122419_c1 3300050513 Bacteria 2073
623 nmdc:mga0rr50_1259854_c1 3300050513 Unclassified 628
624 nmdc:mga0rr50_1406211_c1 3300050513 Bacteria 591
625 nmdc:mga0rr50_1435232_c1 3300050513 Bacteria 584
626 nmdc:mga0rr50_15743_c1 3300050513 Bacteria 5001
627 nmdc:mga0rr50_23893_c1 3300050513 Bacteria 4226
628 nmdc:mga0rr50_429964_c1 3300050513 Unclassified 1118
629 nmdc:mga0rr50_448015_c1 3300050513 Bacteria 1094
630 nmdc:mga0rr50_51456_c1 3300050513 Bacteria 3056
631 nmdc:mga0rr50_62886_c1 3300050513 Bacteria 2802
632 nmdc:mga0rr50_67274_c1 3300050513 Bacteria 2721
633 nmdc:mga08x19_1079941_c1 3300050514 Bacteria 570
634 nmdc:mga08x19_130868_c1 3300050514 Bacteria 1688
635 nmdc:mga08x19_199904_c1 3300050514 Bacteria 1370
636 nmdc:mga08x19_233064_c1 3300050514 Bacteria 1268
637 nmdc:mga08x19_24742_c1 3300050514 Bacteria 3736
638 nmdc:mga08x19_24964_c1 3300050514 Bacteria 3720
639 nmdc:mga08x19_38580_c1 3300050514 Bacteria 3034
640 nmdc:mga08x19_50929_c1 3300050514 Bacteria 2658
641 nmdc:mga08x19_571175_c1 3300050514 Bacteria 801
642 nmdc:mga08x19_85527_c1 3300050514 Bacteria 2075
643 nmdc:mga0a205_10622_c1 3300050515 Bacteria 8465
644 nmdc:mga0a205_127397_c1 3300050515 Bacteria 2446
645 nmdc:mga0a205_133168_c1 3300050515 Unclassified 2386
646 nmdc:mga0a205_16621_c1 3300050515 Bacteria 6891
647 nmdc:mga0a205_2400_c1 3300050515 Bacteria 16532
648 nmdc:mga0a205_73463_c1 3300050515 Bacteria 3304
649 Ga0495601_1053237 3300053077 Bacteria 510
650 Ga0501084_0001384 3300054114 Bacteria 19196
651 Ga0501084_0512701 3300054114 Bacteria 1014
652 Ga0501084_1041254 3300054114 Unclassified 687
653 Ga0501082_0001189 3300060353 Bacteria 22875
654 Ga0501082_0351601 3300060353 Bacteria 1285
655 Ga0501082_0740056 3300060353 Bacteria 861
656 Ga0501082_0865154 3300060353 Bacteria 791
657 Ga0530510_0054996 3300061734 Bacteria 2876
658 2894026545 2894023352 Bacteria 5167372
659 Ga0496112_0169415
660 rootL2_10046681
661 Ga0065712_10160555
662 Ga0065707_10574066
663 Ga0070658_10154964
664 Ga0070658_11998788
665 Ga0070676_10000556
666 Ga0070683_100002327
667 Ga0070690_100115282
668 Ga0070690_100123765
669 Ga0070670_100000596
670 Ga0070677_10455320
671 Ga0068869_100000184
672 Ga0070680_100001624
673 Ga0070680_100801680
674 Ga0070682_100000464
675 Ga0070660_100001374
676 Ga0070689_100034790
677 Ga0070689_100922031
678 Ga0070691_10002084
679 Ga0070691_10004600
680 Ga0070687_100018422
681 Ga0070661_100001302
682 Ga0070692_10000199
683 Ga0070692_10904004
684 Ga0070669_100039045
685 Ga0070669_100436615
686 Ga0070671_100060257
687 Ga0070674_101872252
688 Ga0070673_100027314
689 Ga0070673_100631331
690 Ga0070659_100001042
691 Ga0070659_100592164
692 Ga0070667_100030788
693 Ga0070703_10000802
694 Ga0070703_10001944
695 Ga0070714_100003311
696 Ga0070714_100016484
697 Ga0070714_100286028
698 Ga0070713_100004314
699 Ga0070710_10006186
700 Ga0070711_100042880
701 Ga0070705_100000716
702 Ga0070705_100010996
703 Ga0070705_100120293
704 Ga0070705_100620152
705 Ga0070700_100027826
706 Ga0070694_100001937
707 Ga0070694_100024552
708 Ga0070694_100120095
709 Ga0070694_100281082
710 Ga0070694_100980321
711 Ga0070708_100000368
712 Ga0070708_100002804
713 Ga0070708_100013053
714 Ga0070708_100042533
715 Ga0070708_100043963
716 Ga0070708_100051653
717 Ga0070708_100097046
718 Ga0070708_100221248
719 Ga0070708_100340495
720 Ga0070708_100667674
721 Ga0070708_100710370
722 Ga0070708_100733277
723 Ga0070708_101282398
724 Ga0070663_100010115
725 Ga0070663_100475233
726 Ga0070663_101056515
727 Ga0070662_100002733
728 Ga0070662_101722853
729 Ga0070681_10047084
730 Ga0070681_10060061
731 Ga0070681_10077633
732 Ga0070681_10166333
733 Ga0070681_10627132
734 Ga0068867_100002240
735 Ga0068867_100862199
736 Ga0070706_100003203
737 Ga0070706_100005074
738 Ga0070706_100005221
739 Ga0070706_100016058
740 Ga0070706_100055418
741 Ga0070706_100089033
742 Ga0070706_100143831
743 Ga0070706_100216767
744 Ga0070706_100364658
745 Ga0070706_101099382
746 Ga0070706_101633440
747 Ga0070707_100000912
748 Ga0070707_100015809
749 Ga0070707_100040704
750 Ga0070707_100052845
751 Ga0070707_100078161
752 Ga0070707_100156572
753 Ga0070707_100193001
754 Ga0070707_100219835
755 Ga0070707_100404957
756 Ga0070707_100430473
757 Ga0070707_100518972
758 Ga0070707_100696153
759 Ga0070707_100843340
760 Ga0070707_101672486
761 Ga0070698_100000003
762 Ga0070698_100001505
763 Ga0070698_100001689
764 Ga0070698_100033653
765 Ga0070698_100047579
766 Ga0070698_100066915
767 Ga0070698_100081139
768 Ga0070698_100099359
769 Ga0070698_100156766
770 Ga0070698_100217984
771 Ga0070698_100428821
772 Ga0070698_100743938
773 Ga0070698_100744529
774 Ga0070698_100934312
775 Ga0070698_101629343
776 Ga0070699_100001430
777 Ga0070699_100003711
778 Ga0070699_100009254
779 Ga0070699_100017005
780 Ga0070699_100017391
781 Ga0070699_100042912
782 Ga0070699_100045524
783 Ga0070699_100049616
784 Ga0070699_100138833
785 Ga0070699_100178956
786 Ga0070699_100302615
787 Ga0070699_100335899
788 Ga0070699_100496192
789 Ga0070699_100694096
790 Ga0070679_100000337
791 Ga0070679_100026242
792 Ga0070679_100057425
793 Ga0070679_100354391
794 Ga0070684_100001270
795 Ga0070684_100027129
796 Ga0070684_100100994
797 Ga0070684_100119059
798 Ga0070697_100000004
799 Ga0070697_100000579
800 Ga0070697_100006957
801 Ga0070697_100012474
802 Ga0070697_100014356
803 Ga0070697_100018374
804 Ga0070697_100090386
805 Ga0070697_100237069
806 Ga0070697_100598689
807 Ga0068853_100000111
808 Ga0068853_100264821
809 Ga0070686_100505165
810 Ga0070695_100000192
811 Ga0070695_100000344
812 Ga0070695_100023894
813 Ga0070695_100314009
814 Ga0070695_101453332
815 Ga0070696_100004178
816 Ga0070696_100099763
817 Ga0070696_100206696
818 Ga0070696_100225059
819 Ga0070696_100525269
820 Ga0070693_100000173
821 Ga0070665_102075915
822 Ga0070704_100001677
823 Ga0070704_100138287
824 Ga0068855_100000219
825 Ga0068855_100029103
826 Ga0070664_100001899
827 Ga0070664_100260426
828 Ga0068857_100001268
829 Ga0068857_100015971
830 Ga0068857_100254421
831 Ga0068857_100295862
832 Ga0068854_100000800
833 Ga0068854_100198117
834 Ga0068854_101075876
835 Ga0068856_100003539
836 Ga0068856_100006383
837 Ga0068856_100046447
838 Ga0068856_100683891
839 Ga0070702_100038006
840 Ga0068852_100009459
841 Ga0068859_100004490
842 Ga0068859_100129394
843 Ga0068859_100379301
844 Ga0068859_100937593
845 Ga0068864_100142633
846 Ga0068864_100247577
847 Ga0068864_100305042
848 Ga0068861_100001718
849 Ga0068851_10404805
850 Ga0068870_10000173
851 Ga0068858_100018563
852 Ga0068860_100010782
853 Ga0068860_100137747
854 Ga0068862_100000611
855 Ga0070717_10000681
856 Ga0070717_10001530
857 Ga0070717_10011531
858 Ga0070717_10505074
859 Ga0070717_10574274
860 Ga0070717_10669980
861 Ga0070717_12142509
862 Ga0075432_10277928
863 Ga0070715_10055704
864 Ga0070715_10082698
865 Ga0070715_10125353
866 Ga0070715_10155727
867 Ga0070716_100010546
868 Ga0070716_100018989
869 Ga0070716_100281302
870 Ga0070712_100057677
871 Ga0070712_100367042
872 Ga0070712_100681585
873 Ga0097621_100152185
874 Ga0068871_100034860
875 Ga0075428_100414122
876 Ga0075430_101099253
877 Ga0075431_100024903
878 Ga0075431_100747105
879 Ga0075431_101198146
880 Ga0075431_101659824
881 Ga0075433_10013373
882 Ga0075433_10020684
883 Ga0075433_10026432
884 Ga0075433_10037423
885 Ga0075433_10044720
886 Ga0075433_10165317
887 Ga0075434_100056859
888 Ga0075434_100114131
889 Ga0075434_100126322
890 Ga0075434_100136087
891 Ga0075434_100328435
892 Ga0075434_101051893
893 Ga0075429_100001122
894 Ga0075436_100010351
895 Ga0075436_100020611
896 Ga0075436_100039187
897 Ga0075436_100051093
898 Ga0075436_100079795
899 Ga0075436_100146213
900 Ga0075436_100224672
901 Ga0075436_100377282
902 Ga0097620_100004490
903 Ga0097620_100129395
904 Ga0097620_100379307
905 Ga0097620_100937562
906 Ga0075435_100011096
907 Ga0075435_100027776
908 Ga0075435_100053369
909 Ga0075435_100063261
910 Ga0075435_100148552
911 Ga0075435_100259785
912 Ga0075435_100613831
913 Ga0075435_100836270
914 Ga0099794_10027607
915 Ga0099794_10062699
916 Ga0111539_10915035
917 Ga0105245_10449198
918 Ga0105247_10365609
919 Ga0114129_10009751
920 Ga0114129_10161721
921 Ga0114129_10166399
922 Ga0114129_10332883
923 Ga0114129_10474690
924 Ga0114129_10566308
925 Ga0114129_10703641
926 Ga0114129_11079641
927 Ga0105243_10371785
928 Ga0105243_11014962
929 Ga0105241_10000394
930 Ga0105241_10621389
931 Ga0105241_10986923
932 Ga0105242_10189718
933 Ga0105248_10177030
934 Ga0105237_10004386
935 Ga0105237_10101218
936 Ga0105237_10160278
937 Ga0105238_10042520
938 Ga0105238_10230934
939 Ga0105238_11376319
940 Ga0105249_10396233
941 Ga0099796_10051647
942 Ga0105239_10816112
943 Ga0105246_10110617
944 Ga0157373_10000051
945 Ga0157373_10185371
946 Ga0157371_10307315
947 Ga0157370_10371724
948 Ga0157369_10010586
949 Ga0157369_10025725
950 Ga0163162_10389334
951 Ga0163162_11098915
952 Ga0157372_10001083
953 Ga0157372_10032114
954 Ga0157372_10497580
955 Ga0157372_10797068
956 Ga0157372_12343289
957 Ga0157372_12466530
958 Ga0163163_10062290
959 Ga0157377_10041102
960 Ga0157379_10244762
961 Ga0182007_10029010
962 Ga0163161_10439200
963 Ga0206350_10295288
964 Ga0206350_10646724
965 Ga0154015_1169539
966 Ga0154015_1662471
967 Ga0224712_10010958
968 Ga0207653_10000824
969 Ga0207653_10001098
970 Ga0207653_10002427
971 Ga0207710_10075550
972 Ga0207680_10149862
973 Ga0207647_10136191
974 Ga0207685_10137365
975 Ga0207699_10176956
976 Ga0207645_10000062
977 Ga0207645_10229836
978 Ga0207643_10000219
979 Ga0207705_10792929
980 Ga0207684_10000035
981 Ga0207684_10005095
982 Ga0207684_10005357
983 Ga0207684_10006721
984 Ga0207684_10010175
985 Ga0207684_10013567
986 Ga0207684_10051786
987 Ga0207684_10080139
988 Ga0207684_10114708
989 Ga0207684_10242639
990 Ga0207684_10291647
991 Ga0207654_10016553
992 Ga0207654_10987586
993 Ga0207707_10000047
994 Ga0207707_10080058
995 Ga0207707_10154217
996 Ga0207707_10200898
997 Ga0207671_10016883
998 Ga0207671_10365736
999 Ga0207693_10013161
1000 Ga0207693_10115810
1001 Ga0207693_11147283
1002 Ga0207663_10037521
1003 Ga0207663_10074795
1004 Ga0207660_10001817
1005 Ga0207660_11411135
1006 Ga0207662_11067552
1007 Ga0207657_10000021
1008 Ga0207649_10008334
1009 Ga0207649_10373260
1010 Ga0207652_10000922
1011 Ga0207652_10016152
1012 Ga0207652_10170693
1013 Ga0207646_10000127
1014 Ga0207646_10001275
1015 Ga0207646_10006816
1016 Ga0207646_10009589
1017 Ga0207646_10011893
1018 Ga0207646_10013824
1019 Ga0207646_10026904
1020 Ga0207646_10027191
1021 Ga0207646_10054273
1022 Ga0207646_10061957
1023 Ga0207646_10064236
1024 Ga0207646_10078842
1025 Ga0207646_10106352
1026 Ga0207646_10123585
1027 Ga0207646_10123778
1028 Ga0207646_10167098
1029 Ga0207646_10260137
1030 Ga0207646_10334694
1031 Ga0207646_10442863
1032 Ga0207681_10031576
1033 Ga0207694_10069964
1034 Ga0207694_10884110
1035 Ga0207650_10015740
1036 Ga0207687_10299589
1037 Ga0207700_10003827
1038 Ga0207700_10065566
1039 Ga0207700_10114039
1040 Ga0207664_10007423
1041 Ga0207664_10066742
1042 Ga0207664_10158478
1043 Ga0207664_10253130
1044 Ga0207690_10004322
1045 Ga0207690_10763568
1046 Ga0207706_10005155
1047 Ga0207686_10615159
1048 Ga0207709_10193929
1049 Ga0207709_11608687
1050 Ga0207670_10024124
1051 Ga0207669_10873078
1052 Ga0207665_10000261
1053 Ga0207665_10016024
1054 Ga0207665_10134477
1055 Ga0207665_10763233
1056 Ga0207711_10131410
1057 Ga0207711_10281233
1058 Ga0207689_10000516
1059 Ga0207689_10130414
1060 Ga0207661_10000910
1061 Ga0207661_10001421
1062 Ga0207661_10193629
1063 Ga0207679_10000705
1064 Ga0207679_10804514
1065 Ga0207679_10928523
1066 Ga0207667_10005241
1067 Ga0207667_10874410
1068 Ga0207712_10436679
1069 Ga0207640_10005506
1070 Ga0207640_10795682
1071 Ga0207640_11092251
1072 Ga0207658_10068623
1073 Ga0207703_10247677
1074 Ga0207703_10889950
1075 Ga0207639_10010246
1076 Ga0207639_10076362
1077 Ga0207639_10932104
1078 Ga0207678_10001391
1079 Ga0207678_10839978
1080 Ga0207708_10040893
1081 Ga0207702_10001148
1082 Ga0207702_10016684
1083 Ga0207702_10018134
1084 Ga0207702_10874148
1085 Ga0207641_10035878
1086 Ga0207648_10009287
1087 Ga0207648_10466842
1088 Ga0207648_10887512
1089 Ga0207676_10148550
1090 Ga0207676_10208545
1091 Ga0207674_10000137
1092 Ga0207674_10002627
1093 Ga0207674_10080429
1094 Ga0207674_10874622
1095 Ga0207675_100005591
1096 Ga0207675_100108774
1097 Ga0207698_10013879
1098 Ga0209996_1004023
1099 Ga0209968_1001059
1100 Ga0209970_1005879
1101 Ga0209971_1000030
1102 Ga0209966_1000518
1103 Ga0209998_10000007
1104 Ga0209974_10005666
1105 Ga0207428_10463056
1106 Ga0268265_10008195
1107 Ga0268265_10124103
1108 Ga0268264_10255667
1109 Ga0268264_11679737
1110 Ga0268264_12226500
1111 Ga0265338_10021958
1112 Ga0307406_11111089
1113 Ga0307406_12080911
1114 Ga0307407_10179460
1115 Ga0307407_10991351
1116 Ga0307412_10594322
1117 Ga0307409_100388941
1118 Ga0307409_100390543
1119 Ga0307416_100036888
1120 Ga0307416_101002724
1121 Ga0307416_101335460
1122 Ga0307414_10053595
1123 Ga0307415_100145941
1124 Ga0373948_0007310
1125 Ga0373950_0005212
1126 Ga0373929_0030774
1127 Ga0373940_0168555
1128 Ga0373940_0181411
1129 Ga0373944_0148940
1130 Ga0373949_0102571
1131 Ga0373951_0005575
1132 Ga0373939_0101818
1133 Ga0373941_0069242
1134 Ga0373941_0257795
1135 Ga0373953_0030319
1136 Ga0373960_0021009
1137 Ga0373943_0011516
1138 Ga0373955_0064542
1139 Ga0373961_0196905
1140 Ga0373962_0086344
1141 Ga0373931_0030828
1142 Ga0373931_0071700
1143 Ga0373935_0769913
1144 Ga0373927_0177637
1145 Ga0373947_0018173
1146 Ga0373947_0290725
1147 Ga0373937_0464517
1148 Ga0373937_0658199
1149 Ga0373937_1616910
1150 Ga0373925_1683592
1151 Ga0242420_128848
1152 Ga0451839_1328708
1153 Ga0439448_0012354
1154 Ga0439450_005787
1155 Ga0439455_0029996
1156 Ga0439459_0007577
1157 Ga0439460_0000543
1158 Ga0451577_0007768
1159 Ga0451577_0099946
1160 Ga0451577_0284121
1161 Ga0466969_0385503
1162 Ga0466966_0213154
1163 Ga0453684_0097361
1164 Ga0453684_0654914
1165 Ga0451576_0006733
1166 Ga0451576_0181980
1167 Ga0451576_0421452
1168 Ga0451576_0435155
1169 Ga0466967_1498033
1170 Ga0495618_0020262
1171 Ga0495628_0037485
1172 Ga0495630_0057279
1173 Ga0495640_0086872
1174 Ga0495586_0155989
1175 Ga0495634_0116211
1176 Ga0495658_0253652
1177 Ga0495674_0225847
1178 Ga0495674_0434742
1179 Ga0495686_0463077
1180 Ga0496101_1295154
1181 Ga0496102_0571845
1182 Ga0496104_0003857
1183 Ga0496105_0001646
1184 Ga0496106_0047042
1185 Ga0496106_0569942
1186 Ga0496107_0094047
1187 Ga0496109_0342696
1188 Ga0496109_0376060
1189 Ga0496109_0410860
1190 Ga0496110_0080123
1191 Ga0496111_0851054
1192 Ga0496112_0011876
1193 Ga0496112_0472587
1194 Ga0496112_0750895
1195 Ga0496112_1507336
1196 Ga0496113_0921183
1197 Ga0496114_0004681
1198 Ga0496115_0005310
1199 Ga0496115_0007377
1200 Ga0496115_0072359
1201 Ga0496115_0209302
1202 Ga0501032_0817353
1203 Ga0501036_0050972
1204 Ga0501037_0104159
1205 Ga0501039_0045196
1206 Ga0501040_0037643
1207 Ga0501040_0079557
1208 Ga0501040_0116812
1209 Ga0501041_0003130
1210 Ga0501042_0162834
1211 Ga0501043_0024003
1212 Ga0501046_0001249
1213 Ga0501046_0115465
1214 Ga0501047_0161380
1215 Ga0501048_0001345
1216 Ga0501067_0001495
1217 Ga0501067_0013578
1218 Ga0501067_0046842
1219 Ga0501067_0252487
1220 Ga0501068_0151979
1221 Ga0501068_0289680
1222 Ga0501069_0014678
1223 Ga0501069_0168077
1224 Ga0501070_0072501
1225 Ga0501070_0110047
1226 Ga0501070_1183212
1227 Ga0501071_0028506
1228 Ga0501071_0369603
1229 Ga0501072_0073900
1230 Ga0501072_0679305
1231 Ga0501075_0059316
1232 Ga0501075_0149397
1233 Ga0501075_0691354
1234 Ga0501076_0008426
1235 Ga0501076_0135700
1236 Ga0501076_0430081
1237 Ga0501076_1031146
1238 Ga0501077_0195330
1239 Ga0501199_031090
1240 Ga0501202_166165
1241 Ga0501235_161569
1242 Ga0501257_117665
1243 Ga0501079_0000310
1244 Ga0501079_0173858
1245 Ga0501079_0410973
1246 Ga0501080_0882551
1247 Ga0501080_1053134
1248 Ga0501083_0053862
1249 Ga0501035_0142670
1250 Ga0501044_0063758
1251 Ga0501044_0501574
1252 Ga0501045_0014624
1253 Ga0501045_0164502
1254 Ga0501045_0254066
1255 Ga0501045_0400265
1256 nmdc:mga05p37_1070541_c1
1257 nmdc:mga05p37_123539_c1
1258 nmdc:mga05p37_2019013_c1
1259 nmdc:mga05p37_223404_c1
1260 nmdc:mga05p37_310687_c1
1261 nmdc:mga05p37_452536_c1
1262 nmdc:mga05p37_515006_c1
1263 nmdc:mga05p37_578129_c1
1264 nmdc:mga05p37_74471_c1
1265 nmdc:mga05p37_830811_c1
1266 nmdc:mga05p37_85663_c1
1267 nmdc:mga09592_16057_c1
1268 nmdc:mga09592_224516_c1
1269 nmdc:mga06r32_1080124_c1
1270 nmdc:mga06r32_429174_c1
1271 nmdc:mga06r32_602979_c1
1272 nmdc:mga06r32_69950_c1
1273 nmdc:mga08y16_828933_c1
1274 nmdc:mga0n895_117732_c1
1275 nmdc:mga0n895_1247225_c1
1276 nmdc:mga0n895_1664_c1
1277 nmdc:mga0n895_236865_c1
1278 nmdc:mga0n895_252472_c1
1279 nmdc:mga0n895_262738_c1
1280 nmdc:mga0rr50_122419_c1
1281 nmdc:mga0rr50_1259854_c1
1282 nmdc:mga0rr50_1406211_c1
1283 nmdc:mga0rr50_1435232_c1
1284 nmdc:mga0rr50_15743_c1
1285 nmdc:mga0rr50_23893_c1
1286 nmdc:mga0rr50_429964_c1
1287 nmdc:mga0rr50_448015_c1
1288 nmdc:mga0rr50_51456_c1
1289 nmdc:mga0rr50_62886_c1
1290 nmdc:mga0rr50_67274_c1
1291 nmdc:mga08x19_1079941_c1
1292 nmdc:mga08x19_130868_c1
1293 nmdc:mga08x19_199904_c1
1294 nmdc:mga08x19_233064_c1
1295 nmdc:mga08x19_24742_c1
1296 nmdc:mga08x19_24964_c1
1297 nmdc:mga08x19_38580_c1
1298 nmdc:mga08x19_50929_c1
1299 nmdc:mga08x19_571175_c1
1300 nmdc:mga08x19_85527_c1
1301 nmdc:mga0a205_10622_c1
1302 nmdc:mga0a205_127397_c1
1303 nmdc:mga0a205_133168_c1
1304 nmdc:mga0a205_16621_c1
1305 nmdc:mga0a205_2400_c1
1306 nmdc:mga0a205_73463_c1
1307 Ga0495601_1053237
1308 Ga0501084_0001384
1309 Ga0501084_0512701
1310 Ga0501084_1041254
1311 Ga0501082_0001189
1312 Ga0501082_0351601
1313 Ga0501082_0740056
1314 Ga0501082_0865154
1315 Ga0530510_0054996
1316 2894026545

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12903

DUF3830

Protein of unknown function (DUF3830)

27

163

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3kop-assembly1.cif.gz_B crystal structure of protein with a cyclophilin-like fold (yp_831253.1) from arthrobacter sp. fb24 at 1.90 a resolution 0.7874 6 148
3x27-assembly2.cif.gz_C structure of mcbb in complex with tryptophan 0.7704 8 146
3kop-assembly1.cif.gz_F crystal structure of protein with a cyclophilin-like fold (yp_831253.1) from arthrobacter sp. fb24 at 1.90 a resolution 0.7652 6 148
3kop-assembly1.cif.gz_B crystal structure of protein with a cyclophilin-like fold (yp_831253.1) from arthrobacter sp. fb24 at 1.90 a resolution 0.7579 6 148
3kop-assembly1.cif.gz_D crystal structure of protein with a cyclophilin-like fold (yp_831253.1) from arthrobacter sp. fb24 at 1.90 a resolution 0.752 6 148
ID Description Score Start End Superfamily
3x27B01 Mainly Beta;Beta Barrel;Cyclophilin; 0.7724 8 146 2.40.100.20
3kopF01 Mainly Beta;Beta Barrel;Cyclophilin; 0.7573 5 148 2.40.100.20
2ka0A00 Mainly Beta;Beta Barrel;Cyclophilin; 0.75 8 148 2.40.100.20
3kopF01 Mainly Beta;Beta Barrel;Cyclophilin; 0.734 5 148 2.40.100.20
2ka0A00 Mainly Beta;Beta Barrel;Cyclophilin; 0.7239 8 148 2.40.100.20
ID Description Score Start End GO Terms
AF-A0A522AQS3-F1-model_v4 DUF3830 family protein 0.9746 7 101
AF-A0A537UNQ7-F1-model_v4 DUF3830 family protein 0.9608 5 114
AF-T1XAE7-F1-model_v4 Cyclophilin-like superfamily protein 0.9598 15 146
AF-A0A538HA05-F1-model_v4 DUF3830 family protein 0.9588 8 148
AF-A0A2M6VRG0-F1-model_v4 Cyclophilin-like superfamily protein 0.9562 5 148

Map