F473162

General Info

Members Datasets Scaffolds Average Seq Length
658 398 607 366

Family's Representative Sequence

Representative Sequence 3300006852|Ga0075433_10012867|Ga0075433_100128678
Length 348
Sequence MRRTFALCVKRINFYNWSDYIEPNVLKDFTKETGVEVTYDTFDANEVLETKLLAGKSGYDVVVPTGYFLERQIKAGVFLKLDKAKLPNVVNLWPEITSRLATYDPGNQYAVNYMWGTTGIGYNVKKAREIFSGEQIESWDLVFNPEKLAKFKDCGVYMLDSSDDVFPAALNYLRLDPNSTDAADLQKAADVVTKVRPFVRKFHSSEYLNALASGEICLVLGWSGDIKQAQKRAAEAKGGVEIGYAIPNEGAQMFFDNLAIPKDAKNIEGAHALIDFLQRPDIAARNTNFIAYANGNLASQKFINKEILEDPAVYPDAATMQRLYTITARDQKTLRLANRLWTKVKTGK

Samples

Sample ID Description Type Environment
1 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
2 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
3 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
4 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
5 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
6 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
7 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
8 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
9 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
10 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
11 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
12 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
13 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
14 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
15 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
16 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
17 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
18 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
19 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
20 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
21 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
22 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
23 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
24 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
25 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
26 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
27 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
28 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
29 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
30 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
31 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
32 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
33 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
34 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
35 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
36 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
37 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
38 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
39 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
40 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
41 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
43 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
44 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
45 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
46 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
47 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
48 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
49 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
50 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
51 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
52 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
53 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
54 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
55 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
56 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
57 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
58 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
59 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
60 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
61 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
62 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
63 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
64 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
65 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
66 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
67 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
68 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
69 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
70 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
71 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
72 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
73 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
74 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
75 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
76 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
77 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
78 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
79 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
80 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
81 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
82 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
83 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
84 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
85 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
86 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
87 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
88 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
89 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
90 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
91 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
92 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
93 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
94 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
95 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
96 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
97 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
98 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
99 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
100 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
101 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
102 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
103 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
104 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
105 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
106 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
107 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
108 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
109 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
110 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
111 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
112 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
113 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
114 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
115 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
116 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
117 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
118 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
119 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
120 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
121 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
122 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
123 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
124 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
125 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
126 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
127 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
128 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
129 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
130 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
131 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
132 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
133 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
134 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
135 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
136 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
137 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
138 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
139 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
140 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
141 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
142 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
143 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
144 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
145 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
146 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
147 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
149 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
150 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
151 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
207 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
208 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
209 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
210 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
211 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
212 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
213 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
214 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
215 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
216 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
217 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
218 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
219 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
220 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
221 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
222 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
223 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
224 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
225 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
226 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
227 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
228 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
229 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
230 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
231 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
232 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
233 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
234 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
235 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
236 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
237 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
238 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
239 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
240 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
241 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
242 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
243 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
244 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
245 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
246 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
247 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
248 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
249 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
250 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
251 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
252 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
253 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
254 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
255 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
256 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
257 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
258 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
259 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
260 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
261 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
262 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
263 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
264 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
265 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
266 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
267 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
268 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
269 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
270 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
271 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
272 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
273 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
274 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
275 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
276 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
277 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
278 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
279 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
280 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
281 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
282 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
283 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
284 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
285 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
286 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
287 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
288 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
289 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
290 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
291 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
292 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
293 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
294 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
295 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
296 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
297 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
298 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
299 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
300 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
301 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
302 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
303 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
304 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
305 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
306 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
307 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
308 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
309 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
310 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
311 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
312 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
313 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
314 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
315 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
316 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
317 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
318 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
319 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
320 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
321 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
322 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
323 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
324 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
325 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
326 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
327 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
328 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
329 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
330 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
331 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
332 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
333 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
334 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
335 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
336 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
337 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
338 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
339 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
340 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
341 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
342 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
343 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
344 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
345 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
346 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
347 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
348 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
349 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
350 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
351 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
352 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
353 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
354 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
355 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
356 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
357 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
358 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
359 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
360 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
361 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
362 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
363 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
364 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
365 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
366 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
367 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
368 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
369 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
370 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
371 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
372 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
373 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
374 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
375 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
376 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
377 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
378 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
379 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
380 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
381 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
382 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
383 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
384 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
385 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
386 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
387 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
388 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
389 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
390 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
391 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
392 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
393 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
394 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
395 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
396 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
397 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
398 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.67
Metatranscriptomes 0
Isolates 7.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.66
Nodule 6.99
Rhizoplane 8.81
Rhizosphere 70.82
Stem 0
Stem Tuber 0
Unclassified 4.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10034618 3300001990 Bacteria 1565
2 JGI24743J22301_10004622 3300001991 Bacteria 2254
3 JGI24748J21848_1007608 3300002074 Bacteria 1271
4 JGI24742J22300_10009931 3300002244 Bacteria 1573
5 JGI25153J46596_10007386 3300003215 Bacteria 5415
6 JGI25404J52841_10007721 3300003659 Bacteria 2280
7 JGI25405J52794_10006081 3300003911 Bacteria 2199
8 Ga0065704_10192549 3300005289 Bacteria 1183
9 Ga0070676_10033115 3300005328 Bacteria 2964
10 Ga0070676_10107173 3300005328 Bacteria 1735
11 Ga0070683_100056178 3300005329 Bacteria 3655
12 Ga0070670_100010787 3300005331 Bacteria 7805
13 Ga0070677_10016853 3300005333 Bacteria 2607
14 Ga0068869_100109077 3300005334 Bacteria 2103
15 Ga0070666_10128599 3300005335 Bacteria 1759
16 Ga0070680_100116879 3300005336 Bacteria 2224
17 Ga0070682_100093095 3300005337 Bacteria 1976
18 Ga0068868_100020698 3300005338 Bacteria 4948
19 Ga0070687_100002547 3300005343 Bacteria 6872
20 Ga0070668_100298091 3300005347 Bacteria 1351
21 Ga0070669_100106151 3300005353 Bacteria 2126
22 Ga0070669_100154645 3300005353 Bacteria 1777
23 Ga0070675_100178375 3300005354 Bacteria 1835
24 Ga0070675_100363510 3300005354 Bacteria 1285
25 Ga0070671_100085919 3300005355 Bacteria 2632
26 Ga0070671_100179998 3300005355 Bacteria 1789
27 Ga0070674_100001777 3300005356 Bacteria 11690
28 Ga0070673_100209338 3300005364 Bacteria 1683
29 Ga0070667_100045667 3300005367 Bacteria 3684
30 Ga0070709_10000751 3300005434 Bacteria 18320
31 Ga0070709_10000765 3300005434 Bacteria 18049
32 Ga0070714_100001123 3300005435 Bacteria 19235
33 Ga0070714_100004348 3300005435 Bacteria 10679
34 Ga0070714_100006896 3300005435 Bacteria 8807
35 Ga0070714_100123026 3300005435 Bacteria 2310
36 Ga0070713_100000647 3300005436 Bacteria 22255
37 Ga0070713_100014010 3300005436 Bacteria 5937
38 Ga0070713_100042866 3300005436 Bacteria 3696
39 Ga0070713_100062420 3300005436 Bacteria 3121
40 Ga0070713_100075566 3300005436 Bacteria 2858
41 Ga0070713_100082398 3300005436 Bacteria 2747
42 Ga0070710_10001077 3300005437 Bacteria 12915
43 Ga0070710_10008883 3300005437 Bacteria 4904
44 Ga0070701_10017803 3300005438 Bacteria 3328
45 Ga0070711_100007383 3300005439 Bacteria 6686
46 Ga0070711_100019807 3300005439 Bacteria 4324
47 Ga0070711_100043214 3300005439 Bacteria 3051
48 Ga0070705_100013205 3300005440 Bacteria 4219
49 Ga0070663_100310843 3300005455 Bacteria 1264
50 Ga0070678_100011686 3300005456 Bacteria 5428
51 Ga0070662_100021718 3300005457 Bacteria 4386
52 Ga0070662_100095066 3300005457 Bacteria 2245
53 Ga0070681_10036942 3300005458 Bacteria 4902
54 Ga0068867_100017477 3300005459 Bacteria 5094
55 Ga0070685_10115417 3300005466 Bacteria 1660
56 Ga0070698_100206373 3300005471 Bacteria 1900
57 Ga0070699_100015158 3300005518 Bacteria 6621
58 Ga0070679_100013382 3300005530 Bacteria 7856
59 Ga0070684_100020410 3300005535 Bacteria 5498
60 Ga0070684_100109785 3300005535 Bacteria 2472
61 Ga0070684_100190645 3300005535 Bacteria 1865
62 Ga0068853_100000785 3300005539 Bacteria 22086
63 Ga0070672_100019246 3300005543 Bacteria 4952
64 Ga0070704_100051208 3300005549 Bacteria 2907
65 Ga0068855_100005618 3300005563 Bacteria 15299
66 Ga0068855_100142736 3300005563 Bacteria 2728
67 Ga0070664_100048685 3300005564 Bacteria 3582
68 Ga0070664_100053036 3300005564 Bacteria 3436
69 Ga0068857_100031091 3300005577 Bacteria 4718
70 Ga0068854_100147310 3300005578 Bacteria 1812
71 Ga0068856_100000020 3300005614 Bacteria 146775
72 Ga0068856_100001874 3300005614 Bacteria 21950
73 Ga0068856_100015688 3300005614 Bacteria 7326
74 Ga0070702_100015321 3300005615 Bacteria 3913
75 Ga0068852_100005253 3300005616 Bacteria 9240
76 Ga0068852_100027093 3300005616 Bacteria 4666
77 Ga0068852_100137450 3300005616 Bacteria 2257
78 Ga0068859_100023016 3300005617 Bacteria 6248
79 Ga0068866_10054684 3300005718 Bacteria 2046
80 Ga0068866_10165602 3300005718 Bacteria 1293
81 Ga0068861_100053725 3300005719 Bacteria 3066
82 Ga0068851_10049434 3300005834 Bacteria 2133
83 Ga0068863_100003267 3300005841 Bacteria 16008
84 Ga0068858_100275069 3300005842 Bacteria 1603
85 Ga0068860_100019769 3300005843 Bacteria 6530
86 Ga0068862_100014292 3300005844 Bacteria 6585
87 Ga0081455_10000807 3300005937 Bacteria 40308
88 Ga0081455_10008702 3300005937 Bacteria 10511
89 Ga0081455_10019562 3300005937 Bacteria 6402
90 Ga0081455_10023171 3300005937 Bacteria 5782
91 Ga0081455_10158288 3300005937 Bacteria 1739
92 Ga0081538_10017231 3300005981 Bacteria 5495
93 Ga0081538_10037618 3300005981 Bacteria 3135
94 Ga0081540_1000011 3300005983 Bacteria 191880
95 Ga0081540_1001420 3300005983 Bacteria 20722
96 Ga0081540_1023400 3300005983 Bacteria 3614
97 Ga0081540_1036625 3300005983 Bacteria 2613
98 Ga0081540_1053208 3300005983 Bacteria 1987
99 Ga0081539_10048315 3300005985 Bacteria 2421
100 Ga0070717_10004417 3300006028 Bacteria 10151
101 Ga0070717_10008045 3300006028 Bacteria 7860
102 Ga0075365_10037236 3300006038 Bacteria 3157
103 Ga0075365_10066735 3300006038 Bacteria 2414
104 Ga0075365_10075457 3300006038 Bacteria 2275
105 Ga0075368_10005443 3300006042 Bacteria 4374
106 Ga0075368_10015438 3300006042 Bacteria 2834
107 Ga0075363_100034975 3300006048 Bacteria 2625
108 Ga0075363_100038357 3300006048 Bacteria 2519
109 Ga0075364_10034307 3300006051 Bacteria 3272
110 Ga0075364_10054123 3300006051 Bacteria 2624
111 Ga0075364_10126354 3300006051 Bacteria 1714
112 Ga0070715_10000111 3300006163 Bacteria 20025
113 Ga0070715_10000890 3300006163 Bacteria 8288
114 Ga0070716_100038166 3300006173 Bacteria 2658
115 Ga0070716_100117402 3300006173 Bacteria 1660
116 Ga0070712_100003177 3300006175 Bacteria 10123
117 Ga0070712_100015060 3300006175 Bacteria 4972
118 Ga0070712_100021375 3300006175 Bacteria 4251
119 Ga0070712_100069240 3300006175 Bacteria 2517
120 Ga0070712_100152838 3300006175 Bacteria 1774
121 Ga0075362_10005001 3300006177 Bacteria 4811
122 Ga0075362_10005605 3300006177 Bacteria 4608
123 Ga0075362_10009446 3300006177 Bacteria 3773
124 Ga0075367_10005992 3300006178 Bacteria 6107
125 Ga0075369_10050535 3300006186 Bacteria 1798
126 Ga0075366_10004770 3300006195 Bacteria 7312
127 Ga0075366_10037649 3300006195 Bacteria 2856
128 Ga0097621_100016628 3300006237 Bacteria 5566
129 Ga0075370_10009560 3300006353 Bacteria 5039
130 Ga0075370_10024424 3300006353 Bacteria 3338
131 Ga0075428_100003918 3300006844 Bacteria 16351
132 Ga0075428_100050043 3300006844 Bacteria 4583
133 Ga0075430_100011920 3300006846 Bacteria 7401
134 Ga0075430_100022067 3300006846 Bacteria 5411
135 Ga0075431_100001468 3300006847 Bacteria 21760
136 Ga0075431_100012459 3300006847 Bacteria 8583
137 Ga0075431_100083948 3300006847 Bacteria 3288
138 Ga0075431_100172727 3300006847 Bacteria 2220
139 Ga0075431_100273929 3300006847 Bacteria 1710
140 Ga0075433_10012867 3300006852 Bacteria 6779
141 Ga0075434_100039954 3300006871 Bacteria 4647
142 Ga0075434_100148985 3300006871 Bacteria 2360
143 Ga0075434_100225934 3300006871 Bacteria 1892
144 Ga0075429_100007126 3300006880 Bacteria 9711
145 Ga0075429_100175772 3300006880 Bacteria 1876
146 Ga0068865_100005250 3300006881 Bacteria 7831
147 Ga0097620_100023015 3300006931 Bacteria 6248
148 Ga0099825_1024808 3300006941 Bacteria 3440
149 Ga0099824_1005874 3300006942 Bacteria 17135
150 Ga0099822_1001130 3300006943 Bacteria 29740
151 Ga0099795_10013458 3300007788 Bacteria 2512
152 Ga0105240_10010915 3300009093 Bacteria 12729
153 Ga0105240_10020186 3300009093 Bacteria 8895
154 Ga0111539_10003134 3300009094 Bacteria 21872
155 Ga0105245_10040069 3300009098 Bacteria 4171
156 Ga0105245_10049793 3300009098 Bacteria 3753
157 Ga0105247_10019792 3300009101 Bacteria 4042
158 Ga0114129_10009260 3300009147 Bacteria 14044
159 Ga0114129_10011780 3300009147 Bacteria 12443
160 Ga0114129_10016386 3300009147 Bacteria 10548
161 Ga0114129_10021519 3300009147 Bacteria 9154
162 Ga0114129_10039984 3300009147 Bacteria 6615
163 Ga0114129_10138611 3300009147 Bacteria 3337
164 Ga0114129_10570665 3300009147 Bacteria 1469
165 Ga0105243_10118748 3300009148 Bacteria 2226
166 Ga0105243_10268119 3300009148 Bacteria 1532
167 Ga0105241_10017590 3300009174 Bacteria 5256
168 Ga0105248_10053872 3300009177 Bacteria 4512
169 Ga0105237_10228790 3300009545 Bacteria 1860
170 Ga0105238_10011980 3300009551 Bacteria 8735
171 Ga0105238_10018757 3300009551 Bacteria 7045
172 Ga0105249_10226414 3300009553 Bacteria 1842
173 Ga0099796_10016410 3300010159 Bacteria 2186
174 Ga0105239_10014407 3300010375 Bacteria 8774
175 Ga0105239_10014647 3300010375 Bacteria 8695
176 Ga0105239_10091963 3300010375 Bacteria 3348
177 Ga0105239_10169078 3300010375 Bacteria 2444
178 Ga0105239_10514623 3300010375 Bacteria 1361
179 Ga0157370_10065826 3300013104 Bacteria 3428
180 Ga0157378_10212140 3300013297 Bacteria 1836
181 Ga0157378_10222994 3300013297 Bacteria 1793
182 Ga0157378_10392599 3300013297 Bacteria 1365
183 Ga0163162_10379892 3300013306 Bacteria 1546
184 Ga0163162_10477391 3300013306 Bacteria 1378
185 Ga0163163_10000985 3300014325 Bacteria 24137
186 Ga0163163_10013111 3300014325 Bacteria 7573
187 Ga0163163_10258228 3300014325 Bacteria 1793
188 Ga0157377_10030766 3300014745 Bacteria 2911
189 Ga0157379_10371411 3300014968 Bacteria 1311
190 Ga0163161_10156289 3300017792 Bacteria 1736
191 Ga0213872_10052472 3300021361 Bacteria 1850
192 Ga0213876_10004192 3300021384 Bacteria 8083
193 Ga0213876_10013161 3300021384 Bacteria 4396
194 Ga0209677_105615 3300025253 Bacteria 3221
195 Ga0209233_1018718 3300025261 Bacteria 1857
196 Ga0209564_1001241 3300025295 Bacteria 28590
197 Ga0209758_1003309 3300025297 Bacteria 14898
198 Ga0209758_1005630 3300025297 Bacteria 9509
199 Ga0209758_1053463 3300025297 Bacteria 1387
200 Ga0207656_10078409 3300025321 Bacteria 1480
201 Ga0207653_10006516 3300025885 Bacteria 3645
202 Ga0207682_10000451 3300025893 Bacteria 18904
203 Ga0207692_10001501 3300025898 Bacteria 8767
204 Ga0207692_10002579 3300025898 Bacteria 6963
205 Ga0207710_10010206 3300025900 Bacteria 3951
206 Ga0207710_10049074 3300025900 Bacteria 1890
207 Ga0207710_10087641 3300025900 Bacteria 1452
208 Ga0207688_10000724 3300025901 Bacteria 16358
209 Ga0207688_10017933 3300025901 Bacteria 3852
210 Ga0207647_10046855 3300025904 Bacteria 2691
211 Ga0207685_10002531 3300025905 Bacteria 4212
212 Ga0207699_10015388 3300025906 Bacteria 3971
213 Ga0207699_10027898 3300025906 Bacteria 3132
214 Ga0207645_10033024 3300025907 Bacteria 3327
215 Ga0207645_10074418 3300025907 Bacteria 2174
216 Ga0207643_10002257 3300025908 Bacteria 10508
217 Ga0207643_10053870 3300025908 Bacteria 2285
218 Ga0207684_10028032 3300025910 Bacteria 4797
219 Ga0207654_10000232 3300025911 Bacteria 34089
220 Ga0207654_10052549 3300025911 Bacteria 2349
221 Ga0207654_10062518 3300025911 Bacteria 2182
222 Ga0207707_10000950 3300025912 Bacteria 27902
223 Ga0207695_10000008 3300025913 Bacteria 1058268
224 Ga0207695_10001547 3300025913 Bacteria 37828
225 Ga0207671_10008090 3300025914 Bacteria 8979
226 Ga0207671_10087332 3300025914 Bacteria 2345
227 Ga0207671_10100175 3300025914 Bacteria 2194
228 Ga0207693_10001966 3300025915 Bacteria 18015
229 Ga0207693_10004043 3300025915 Bacteria 12466
230 Ga0207693_10063793 3300025915 Bacteria 2886
231 Ga0207693_10109800 3300025915 Bacteria 2163
232 Ga0207663_10000098 3300025916 Bacteria 41171
233 Ga0207660_10172850 3300025917 Bacteria 1673
234 Ga0207662_10003107 3300025918 Bacteria 8472
235 Ga0207657_10042779 3300025919 Bacteria 3994
236 Ga0207652_10043416 3300025921 Bacteria 3828
237 Ga0207681_10163533 3300025923 Bacteria 1680
238 Ga0207694_10000050 3300025924 Bacteria 159920
239 Ga0207694_10041876 3300025924 Bacteria 3531
240 Ga0207650_10060436 3300025925 Bacteria 2828
241 Ga0207650_10084967 3300025925 Bacteria 2406
242 Ga0207659_10239086 3300025926 Bacteria 1468
243 Ga0207700_10098400 3300025928 Bacteria 2327
244 Ga0207700_10226283 3300025928 Bacteria 1588
245 Ga0207664_10069359 3300025929 Bacteria 2834
246 Ga0207664_10121402 3300025929 Bacteria 2187
247 Ga0207664_10137916 3300025929 Bacteria 2060
248 Ga0207644_10030185 3300025931 Bacteria 3767
249 Ga0207706_10002835 3300025933 Bacteria 16817
250 Ga0207706_10099788 3300025933 Bacteria 2554
251 Ga0207709_10233097 3300025935 Bacteria 1335
252 Ga0207669_10054654 3300025937 Bacteria 2413
253 Ga0207704_10020864 3300025938 Bacteria 3476
254 Ga0207704_10271407 3300025938 Bacteria 1284
255 Ga0207665_10000204 3300025939 Bacteria 39853
256 Ga0207665_10000355 3300025939 Bacteria 31763
257 Ga0207691_10001066 3300025940 Bacteria 27265
258 Ga0207691_10096903 3300025940 Bacteria 2637
259 Ga0207711_10209674 3300025941 Bacteria 1780
260 Ga0207689_10003705 3300025942 Bacteria 13938
261 Ga0207689_10031017 3300025942 Bacteria 4453
262 Ga0207689_10107194 3300025942 Bacteria 2296
263 Ga0207661_10000349 3300025944 Bacteria 29687
264 Ga0207679_10019748 3300025945 Bacteria 4535
265 Ga0207667_10032035 3300025949 Bacteria 5667
266 Ga0207667_10262833 3300025949 Bacteria 1765
267 Ga0207667_10434751 3300025949 Bacteria 1334
268 Ga0207651_10055364 3300025960 Bacteria 2724
269 Ga0207651_10067481 3300025960 Bacteria 2518
270 Ga0207651_10226622 3300025960 Bacteria 1514
271 Ga0207712_10264549 3300025961 Bacteria 1396
272 Ga0207668_10146522 3300025972 Bacteria 1822
273 Ga0207640_10055190 3300025981 Bacteria 2601
274 Ga0207640_10255653 3300025981 Bacteria 1362
275 Ga0207677_10025117 3300026023 Bacteria 3712
276 Ga0207703_10263121 3300026035 Bacteria 1560
277 Ga0207639_10063108 3300026041 Bacteria 2867
278 Ga0207678_10003070 3300026067 Bacteria 15096
279 Ga0207678_10015480 3300026067 Bacteria 6704
280 Ga0207708_10000416 3300026075 Bacteria 33357
281 Ga0207702_10000002 3300026078 Bacteria 491507
282 Ga0207702_10000126 3300026078 Bacteria 90550
283 Ga0207648_10023754 3300026089 Bacteria 5484
284 Ga0207674_10032345 3300026116 Bacteria 5488
285 Ga0207675_100001268 3300026118 Bacteria 25252
286 Ga0207675_100364668 3300026118 Bacteria 1418
287 Ga0207683_10000733 3300026121 Bacteria 29828
288 Ga0207698_10307556 3300026142 Bacteria 1478
289 Ga0209589_1000001 3300027357 Bacteria 794224
290 Ga0209489_100001 3300027361 Bacteria 794224
291 Ga0209700_100001 3300027363 Bacteria 794224
292 Ga0207428_10004211 3300027907 Bacteria 13773
293 Ga0265337_1002468 3300028556 Bacteria 8449
294 Ga0265319_1009070 3300028563 Bacteria 4286
295 Ga0265334_10000456 3300028573 Bacteria 21294
296 Ga0265318_10015114 3300028577 Bacteria 3221
297 Ga0265323_10000424 3300028653 Bacteria 24236
298 Ga0265322_10034843 3300028654 Bacteria 1434
299 Ga0265336_10000431 3300028666 Bacteria 25844
300 Ga0307517_10000008 3300028786 Bacteria 243202
301 Ga0265338_10000321 3300028800 Bacteria 87046
302 Ga0265324_10005870 3300029957 Bacteria 5218
303 Ga0265330_10039647 3300031235 Bacteria 2093
304 Ga0265332_10002663 3300031238 Bacteria 8959
305 Ga0265320_10067525 3300031240 Bacteria 1691
306 Ga0265325_10038114 3300031241 Bacteria 2538
307 Ga0265339_10014916 3300031249 Bacteria 4672
308 Ga0265331_10019579 3300031250 Bacteria 3493
309 Ga0265316_10117758 3300031344 Bacteria 2008
310 Ga0265313_10009487 3300031595 Bacteria 6314
311 Ga0265314_10043127 3300031711 Bacteria 3210
312 Ga0265342_10000210 3300031712 Bacteria 65961
313 Ga0265342_10007904 3300031712 Bacteria 7711
314 Ga0265342_10049675 3300031712 Bacteria 2509
315 Ga0307510_10019107 3300033180 Bacteria 8039
316 Ga0307510_10087045 3300033180 Bacteria 2993
317 Ga0315911_1000006 3300033442 Bacteria 414563
318 Ga0373926_0027317 3300035083 Bacteria 1999
319 Ga0373936_0034336 3300035113 Bacteria 2014
320 Ga0373957_0009374 3300035120 Bacteria 3203
321 Ga0373943_0037581 3300035170 Bacteria 2324
322 Ga0373943_0078006 3300035170 Bacteria 1693
323 Ga0373943_0083101 3300035170 Bacteria 1645
324 Ga0373946_0016456 3300035171 Bacteria 2818
325 Ga0373946_0021549 3300035171 Bacteria 2500
326 Ga0373924_0003483 3300035410 Bacteria 5419
327 Ga0373931_0071835 3300035691 Bacteria 1891
328 Ga0373935_0070498 3300035692 Bacteria 2253
329 Ga0373927_0056973 3300035695 Bacteria 2527
330 Ga0373927_0105322 3300035695 Bacteria 1836
331 Ga0373933_0061486 3300035724 Bacteria 2266
332 Ga0373933_0105181 3300035724 Bacteria 1755
333 Ga0373947_0079108 3300035725 Bacteria 2031
334 Ga0373937_0026472 3300036401 Bacteria 5242
335 Ga0373925_0033765 3300037068 Bacteria 3770
336 Ga0373925_0044060 3300037068 Bacteria 3313
337 Ga0395900_0032586 3300037418 Bacteria 5359
338 Ga0395900_0064143 3300037418 Bacteria 3776
339 Ga0395898_0057370 3300037466 Bacteria 3795
340 Ga0395898_0073526 3300037466 Bacteria 3302
341 Ga0395898_0102868 3300037466 Bacteria 2741
342 Ga0436364_1477382 3300037853 Bacteria 1651
343 Ga0395901_0006650 3300038443 Bacteria 11683
344 Ga0395901_0167889 3300038443 Bacteria 2303
345 Ga0395901_0291362 3300038443 Bacteria 1694
346 Ga0436365_0139392 3300039437 Bacteria 5701
347 Ga0436365_1822185 3300039437 Bacteria 1684
348 Ga0436365_1840276 3300039437 Bacteria 14090
349 Ga0436361_0003682 3300039447 Bacteria 24999
350 Ga0436363_0602269 3300039450 Bacteria 5606
351 Ga0436362_1129034 3300039453 Bacteria 7760
352 Ga0466966_0000334 3300044684 Bacteria 30532
353 Ga0466961_0000509 3300044693 Bacteria 24794
354 Ga0466963_0249073 3300044694 Bacteria 1247
355 Ga0466959_0113858 3300045049 Bacteria 1928
356 Ga0466967_0368085 3300045976 Bacteria 1394
357 Ga0495603_0004733 3300046455 Bacteria 8130
358 Ga0495603_0115785 3300046455 Bacteria 1563
359 Ga0495629_0028160 3300046459 Bacteria 3989
360 Ga0495629_0149967 3300046459 Bacteria 1621
361 Ga0495638_0063674 3300046460 Bacteria 2273
362 Ga0495641_0041147 3300046461 Bacteria 2147
363 Ga0495651_0001733 3300046462 Bacteria 16846
364 Ga0495582_0020761 3300046473 Bacteria 3597
365 Ga0495582_0072596 3300046473 Bacteria 1905
366 Ga0495605_0042617 3300046474 Bacteria 2255
367 Ga0495639_0029136 3300046475 Bacteria 2450
368 Ga0495639_0051376 3300046475 Bacteria 1874
369 Ga0495662_0067536 3300046476 Bacteria 1730
370 Ga0495664_0001939 3300046477 Bacteria 11029
371 Ga0495664_0026626 3300046477 Bacteria 3368
372 Ga0495585_0005858 3300046492 Bacteria 7703
373 Ga0495594_0088940 3300046499 Bacteria 1729
374 Ga0495608_0005911 3300046511 Bacteria 8704
375 Ga0495616_0100779 3300046513 Bacteria 1355
376 Ga0495618_0011828 3300046514 Bacteria 5296
377 Ga0495628_0028739 3300046516 Bacteria 4515
378 Ga0495628_0063069 3300046516 Bacteria 2904
379 Ga0495630_0025233 3300046517 Bacteria 4394
380 Ga0495630_0064928 3300046517 Bacteria 2743
381 Ga0495630_0093563 3300046517 Bacteria 2272
382 Ga0495652_0023334 3300046529 Bacteria 5484
383 Ga0495652_0047738 3300046529 Bacteria 3671
384 Ga0495665_0019583 3300046531 Bacteria 3640
385 Ga0495640_0098441 3300046533 Bacteria 1922
386 Ga0495640_0116833 3300046533 Bacteria 1737
387 Ga0495587_0008847 3300046536 Bacteria 6463
388 Ga0495598_0006018 3300046537 Bacteria 2719
389 Ga0495645_0034948 3300046543 Bacteria 3664
390 Ga0495633_0085906 3300046558 Bacteria 1463
391 Ga0495667_0003089 3300046559 Bacteria 11169
392 Ga0495634_0043804 3300046642 Bacteria 3032
393 Ga0495634_0126719 3300046642 Bacteria 1631
394 Ga0495634_0195751 3300046642 Bacteria 1258
395 Ga0495635_0167153 3300046663 Bacteria 1496
396 Ga0495588_0031257 3300046674 Bacteria 2679
397 Ga0495657_0007669 3300046675 Bacteria 8308
398 Ga0495599_0006216 3300046678 Bacteria 7197
399 Ga0495623_0006875 3300046679 Bacteria 7400
400 Ga0495658_0012702 3300046683 Bacteria 4273
401 Ga0495658_0096637 3300046683 Bacteria 1757
402 Ga0495613_0042699 3300046689 Bacteria 3355
403 Ga0495613_0115649 3300046689 Bacteria 1930
404 Ga0495613_0122659 3300046689 Bacteria 1865
405 Ga0495670_0016822 3300046691 Bacteria 3596
406 Ga0495600_0007437 3300046809 Bacteria 6703
407 Ga0495600_0008276 3300046809 Bacteria 6384
408 Ga0495581_0048953 3300047315 Bacteria 2440
409 Ga0495604_0007727 3300047317 Bacteria 8516
410 Ga0495674_0006216 3300047319 Bacteria 11455
411 Ga0495672_0007644 3300047320 Bacteria 8109
412 Ga0495676_0069561 3300047321 Bacteria 2715
413 Ga0495675_0022639 3300047444 Bacteria 4007
414 Ga0495675_0034458 3300047444 Bacteria 3232
415 Ga0495602_0009411 3300048088 Bacteria 10165
416 Ga0496100_0105166 3300048903 Bacteria 1951
417 Ga0496101_0025063 3300048904 Bacteria 4134
418 Ga0496102_0012241 3300048905 Bacteria 7420
419 Ga0496102_0074594 3300048905 Bacteria 3118
420 Ga0496102_0103808 3300048905 Bacteria 2644
421 Ga0496102_0267262 3300048905 Bacteria 1612
422 Ga0496103_0002528 3300048906 Bacteria 11461
423 Ga0496103_0037576 3300048906 Bacteria 2968
424 Ga0496104_0000575 3300048907 Bacteria 31363
425 Ga0496104_0001976 3300048907 Bacteria 17754
426 Ga0496104_0002098 3300048907 Bacteria 17313
427 Ga0496104_0004574 3300048907 Bacteria 12056
428 Ga0496104_0009294 3300048907 Bacteria 8742
429 Ga0496104_0061521 3300048907 Bacteria 3560
430 Ga0496105_0005756 3300048908 Bacteria 9445
431 Ga0496105_0014700 3300048908 Bacteria 6231
432 Ga0496105_0052505 3300048908 Bacteria 3367
433 Ga0496105_0061924 3300048908 Bacteria 3088
434 Ga0496105_0079136 3300048908 Bacteria 2715
435 Ga0496106_0001378 3300048909 Bacteria 18213
436 Ga0496106_0029780 3300048909 Bacteria 4070
437 Ga0496106_0078914 3300048909 Bacteria 2527
438 Ga0496106_0085154 3300048909 Bacteria 2433
439 Ga0496106_0113498 3300048909 Bacteria 2112
440 Ga0496107_0007064 3300048910 Bacteria 7734
441 Ga0496107_0033908 3300048910 Bacteria 3654
442 Ga0496107_0232810 3300048910 Bacteria 1371
443 Ga0496108_0000501 3300048911 Bacteria 30958
444 Ga0496108_0006248 3300048911 Bacteria 9647
445 Ga0496108_0016034 3300048911 Bacteria 6109
446 Ga0496109_0001015 3300048912 Bacteria 23173
447 Ga0496109_0006607 3300048912 Bacteria 9766
448 Ga0496109_0038535 3300048912 Bacteria 4322
449 Ga0496109_0039798 3300048912 Bacteria 4256
450 Ga0496110_0006375 3300048913 Bacteria 9329
451 Ga0496110_0013491 3300048913 Bacteria 6758
452 Ga0496110_0163361 3300048913 Bacteria 2019
453 Ga0496110_0240001 3300048913 Bacteria 1649
454 Ga0496111_0023099 3300048914 Bacteria 4362
455 Ga0496111_0072818 3300048914 Bacteria 2501
456 Ga0496111_0073294 3300048914 Bacteria 2493
457 Ga0496111_0293623 3300048914 Bacteria 1205
458 Ga0496111_0303801 3300048914 Bacteria 1183
459 Ga0496112_0001095 3300048915 Bacteria 20053
460 Ga0496112_0010513 3300048915 Bacteria 8399
461 Ga0496112_0028750 3300048915 Bacteria 5369
462 Ga0496112_0112207 3300048915 Bacteria 2696
463 Ga0496112_0182993 3300048915 Bacteria 2059
464 Ga0496113_0016119 3300048916 Bacteria 5157
465 Ga0496113_0028731 3300048916 Bacteria 4004
466 Ga0496113_0164925 3300048916 Bacteria 1752
467 Ga0496114_0066028 3300048917 Bacteria 3032
468 Ga0496114_0204106 3300048917 Bacteria 1732
469 Ga0496115_0040104 3300048918 Bacteria 3721
470 Ga0496115_0052630 3300048918 Bacteria 3267
471 Ga0496115_0137366 3300048918 Bacteria 2016
472 Ga0496115_0278383 3300048918 Bacteria 1374
473 Ga0496120_0055950 3300048923 Bacteria 2229
474 Ga0496121_0002279 3300048924 Bacteria 29850
475 Ga0496121_0045710 3300048924 Bacteria 3759
476 Ga0496121_0159730 3300048924 Bacteria 1650
477 Ga0496123_0021676 3300048926 Bacteria 4984
478 Ga0496124_0033059 3300048927 Bacteria 4555
479 Ga0496125_0000060 3300048928 Bacteria 264143
480 Ga0496125_0091464 3300048928 Bacteria 2279
481 Ga0496126_0004957 3300048929 Bacteria 15524
482 Ga0496126_0008467 3300048929 Bacteria 11092
483 Ga0496126_0013579 3300048929 Bacteria 8270
484 Ga0501031_0000268 3300049568 Bacteria 29430
485 Ga0501031_0171178 3300049568 Bacteria 1419
486 Ga0501032_0000765 3300049569 Bacteria 26091
487 Ga0501032_0012456 3300049569 Bacteria 6076
488 Ga0501032_0036807 3300049569 Bacteria 3339
489 Ga0501033_0000282 3300049570 Bacteria 48910
490 Ga0501033_0000344 3300049570 Bacteria 44238
491 Ga0501033_0040568 3300049570 Bacteria 3474
492 Ga0501034_0000100 3300049571 Bacteria 159536
493 Ga0501034_0330070 3300049571 Bacteria 1457
494 Ga0501036_0000228 3300049572 Bacteria 37800
495 Ga0501036_0123100 3300049572 Bacteria 2190
496 Ga0501036_0184752 3300049572 Bacteria 1754
497 Ga0501037_0000704 3300049573 Bacteria 25447
498 Ga0501037_0001227 3300049573 Bacteria 18929
499 Ga0501037_0041315 3300049573 Bacteria 3391
500 Ga0501037_0064152 3300049573 Bacteria 2677
501 Ga0501038_0000350 3300049574 Bacteria 39547
502 Ga0501038_0006039 3300049574 Bacteria 11212
503 Ga0501039_0003428 3300049575 Bacteria 11836
504 Ga0501039_0112299 3300049575 Bacteria 2130
505 Ga0501040_0022745 3300049576 Bacteria 4199
506 Ga0501043_0000106 3300049579 Bacteria 77699
507 Ga0501043_0017698 3300049579 Bacteria 5588
508 Ga0501043_0019319 3300049579 Bacteria 5349
509 Ga0501043_0072182 3300049579 Bacteria 2711
510 Ga0501043_0263165 3300049579 Bacteria 1326
511 Ga0501046_0000426 3300049580 Bacteria 42186
512 Ga0501047_0000493 3300049581 Bacteria 42827
513 Ga0501047_0065589 3300049581 Bacteria 3500
514 Ga0501047_0081958 3300049581 Bacteria 3101
515 Ga0501047_0155514 3300049581 Bacteria 2160
516 Ga0501048_0000233 3300049582 Bacteria 36758
517 Ga0501048_0030608 3300049582 Bacteria 3893
518 Ga0501067_0000384 3300049583 Bacteria 24036
519 Ga0501067_0034761 3300049583 Bacteria 2797
520 Ga0501068_0005924 3300049584 Bacteria 6711
521 Ga0501068_0114452 3300049584 Bacteria 1679
522 Ga0501069_0130537 3300049585 Bacteria 1438
523 Ga0501070_0001419 3300049586 Bacteria 21462
524 Ga0501070_0180419 3300049586 Bacteria 1738
525 Ga0501071_0083386 3300049587 Bacteria 2342
526 Ga0501072_0004603 3300049588 Bacteria 10502
527 Ga0501073_0006215 3300049589 Bacteria 8912
528 Ga0501073_0028392 3300049589 Bacteria 3998
529 Ga0501074_0000382 3300049590 Bacteria 26289
530 Ga0501074_0002758 3300049590 Bacteria 12300
531 Ga0501075_0114580 3300049591 Bacteria 2050
532 Ga0501076_0021610 3300049592 Bacteria 4939
533 Ga0501077_0055053 3300049593 Bacteria 2526
534 Ga0501079_0002879 3300049741 Bacteria 12559
535 Ga0501079_0006063 3300049741 Bacteria 9060
536 Ga0501080_0006214 3300049742 Bacteria 10717
537 Ga0501083_0000116 3300049744 Bacteria 54656
538 Ga0501083_0023703 3300049744 Bacteria 4256
539 Ga0501083_0113119 3300049744 Bacteria 1783
540 Ga0501035_0000496 3300049822 Bacteria 44296
541 Ga0501035_0072843 3300049822 Bacteria 3039
542 Ga0501035_0148289 3300049822 Bacteria 2037
543 Ga0501044_0000857 3300049823 Bacteria 36575
544 Ga0501044_0007497 3300049823 Bacteria 12001
545 Ga0501044_0024267 3300049823 Bacteria 6441
546 Ga0501044_0141372 3300049823 Bacteria 2395
547 Ga0501045_0040349 3300049824 Bacteria 3397
548 nmdc:mga00v17_102158_c1 3300050491 Bacteria 1811
549 nmdc:mga00v17_19178_c1 3300050491 Bacteria 3900
550 nmdc:mga00v17_47087_c1 3300050491 Bacteria 2611
551 nmdc:mga0yw44_204887_c1 3300050492 Bacteria 1304
552 nmdc:mga0yw44_67662_c1 3300050492 Bacteria 2208
553 nmdc:mga0yw44_8401_c1 3300050492 Bacteria 5143
554 nmdc:mga0yw44_8643_c1 3300050492 Bacteria 5088
555 nmdc:mga0k408_26711_c1 3300050493 Bacteria 3275
556 nmdc:mga0k408_96542_c1 3300050493 Bacteria 1425
557 nmdc:mga07m45_103068_c1 3300050496 Bacteria 1640
558 nmdc:mga05p37_2711_c2 3300050507 Bacteria 18727
559 nmdc:mga05p37_430_c1 3300050507 Bacteria 45408
560 nmdc:mga05p37_7402_c1 3300050507 Bacteria 12952
561 nmdc:mga09592_6098_c1 3300050508 Bacteria 9821
562 nmdc:mga0qj67_246139_c1 3300050509 Bacteria 1451
563 nmdc:mga0qj67_83992_c1 3300050509 Bacteria 2553
564 nmdc:mga06r32_1291_c1 3300050510 Bacteria 22555
565 nmdc:mga06r32_197927_c1 3300050510 Bacteria 1997
566 nmdc:mga06r32_228205_c1 3300050510 Bacteria 1261
567 nmdc:mga06r32_492618_c1 3300050510 Bacteria 1203
568 nmdc:mga06r32_51164_c1 3300050510 Bacteria 3953
569 nmdc:mga06r32_89581_c1 3300050510 Bacteria 3004
570 nmdc:mga08y16_1565_c1 3300050511 Bacteria 23071
571 nmdc:mga08y16_66444_c1 3300050511 Bacteria 3763
572 nmdc:mga0n895_100523_c1 3300050512 Bacteria 2901
573 nmdc:mga0n895_280023_c1 3300050512 Bacteria 1691
574 nmdc:mga0n895_53969_c1 3300050512 Bacteria 3951
575 nmdc:mga0rr50_66353_c1 3300050513 Bacteria 2737
576 nmdc:mga0sz30_43442_c2 3300050516 Bacteria 1621
577 nmdc:mga0sz30_50479_c1 3300050516 Bacteria 1764
578 Ga0495601_0010913 3300053077 Bacteria 5421
579 Ga0495601_0135379 3300053077 Bacteria 1606
580 Ga0495601_0161926 3300053077 Bacteria 1462
581 Ga0495612_0022290 3300053078 Bacteria 2539
582 Ga0500635_0003783 3300053080 Bacteria 3835
583 Ga0495595_0007198 3300053084 Bacteria 4548
584 Ga0495595_0154362 3300053084 Bacteria 1131
585 Ga0495619_0003147 3300053085 Bacteria 10703
586 Ga0495619_0178706 3300053085 Bacteria 1468
587 Ga0500641_0003366 3300053096 Bacteria 5655
588 Ga0500641_0020358 3300053096 Bacteria 2518
589 Ga0500554_005155 3300053102 Bacteria 2824
590 Ga0500557_000052 3300053105 Bacteria 50636
591 Ga0500572_000307 3300053111 Bacteria 17413
592 Ga0500594_0019477 3300053118 Bacteria 1683
593 Ga0500595_000932 3300053119 Bacteria 16564
594 Ga0500595_017822 3300053119 Bacteria 2611
595 Ga0500642_0000274 3300053130 Bacteria 19303
596 Ga0500658_0056259 3300053134 Bacteria 1622
597 Ga0500559_0000143 3300053136 Bacteria 55572
598 Ga0500577_0000758 3300053142 Bacteria 8299
599 Ga0500604_0033162 3300053151 Bacteria 1526
600 Ga0500636_0015101 3300053177 Bacteria 4546
601 Ga0500636_0019872 3300053177 Bacteria 3972
602 Ga0500637_0003531 3300053178 Bacteria 7244
603 Ga0500625_022632 3300053729 Bacteria 2968
604 Ga0500609_008204 3300053731 Bacteria 1409
605 Ga0501082_0000452 3300060353 Bacteria 36318
606 Ga0501082_0002875 3300060353 Bacteria 15006
607 Ga0501082_0265651 3300060353 Bacteria 1493

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048903 Ga0496100_0105166 Ga0496100_0105166_967_1941 324
2 3300003911 JGI25405J52794_10006081 JGI25405J52794_100060812 325
3 iso_pu_bacteria 8019565922 8019569115 327
4 3300048910 Ga0496107_0232810 Ga0496107_0232810_347_1336 329
5 3300048914 Ga0496111_0303801 Ga0496111_0303801_177_1166 329
6 3300048924 Ga0496121_0159730 Ga0496121_0159730_17_1006 329
7 3300048918 Ga0496115_0052630 Ga0496115_0052630_2206_3222 338
8 3300049573 Ga0501037_0064152 Ga0501037_0064152_36_1052 338
9 3300049581 Ga0501047_0155514 Ga0501047_0155514_36_1052 338
10 3300006028 Ga0070717_10004417 Ga0070717_100044174 339
11 3300009553 Ga0105249_10226414 Ga0105249_102264141 339
12 3300025938 Ga0207704_10271407 Ga0207704_102714071 339
13 3300003659 JGI25404J52841_10007721 JGI25404J52841_100077211 342
14 3300005434 Ga0070709_10000751 Ga0070709_1000075118 342
15 3300005983 Ga0081540_1000011 Ga0081540_100001167 342
16 3300006163 Ga0070715_10000111 Ga0070715_1000011113 342
17 3300006173 Ga0070716_100038166 Ga0070716_1000381662 342
18 3300025898 Ga0207692_10001501 Ga0207692_100015016 342
19 3300025906 Ga0207699_10015388 Ga0207699_100153884 342
20 3300025915 Ga0207693_10004043 Ga0207693_100040433 342
21 3300025916 Ga0207663_10000098 Ga0207663_100000983 342
22 3300025929 Ga0207664_10121402 Ga0207664_101214022 342
23 3300025939 Ga0207665_10000355 Ga0207665_100003555 342
24 3300048926 Ga0496123_0021676 Ga0496123_0021676_855_1949 343
25 3300005289 Ga0065704_10192549 Ga0065704_101925491 344
26 3300006852 Ga0075433_10012867 Ga0075433_100128678 346
27 3300050513 nmdc:mga0rr50_66353_c1 nmdc:mga0rr50_66353_c1_250_1356 346
28 3300005617 Ga0068859_100023016 Ga0068859_1000230165 347
29 3300006931 Ga0097620_100023015 Ga0097620_1000230153 347
30 3300025900 Ga0207710_10010206 Ga0207710_100102062 347
31 3300025942 Ga0207689_10031017 Ga0207689_100310172 347
32 3300026116 Ga0207674_10032345 Ga0207674_100323453 347
33 3300053118 Ga0500594_0019477 Ga0500594_0019477_404_1456 347
34 3300053151 Ga0500604_0033162 Ga0500604_0033162_294_1346 347
35 3300005331 Ga0070670_100010787 Ga0070670_1000107876 348
36 3300005335 Ga0070666_10128599 Ga0070666_101285992 348
37 3300005355 Ga0070671_100085919 Ga0070671_1000859192 348
38 3300006847 Ga0075431_100273929 Ga0075431_1002739291 348
39 3300006871 Ga0075434_100225934 Ga0075434_1002259342 348
40 3300009101 Ga0105247_10019792 Ga0105247_100197922 348
41 3300009147 Ga0114129_10016386 Ga0114129_100163868 348
42 3300010375 Ga0105239_10514623 Ga0105239_105146231 348
43 3300014325 Ga0163163_10013111 Ga0163163_100131117 348
44 3300014745 Ga0157377_10030766 Ga0157377_100307663 348
45 3300025900 Ga0207710_10087641 Ga0207710_100876411 348
46 3300025925 Ga0207650_10060436 Ga0207650_100604362 348
47 3300046473 Ga0495582_0072596 Ga0495582_0072596_513_1616 348
48 3300046689 Ga0495613_0122659 Ga0495613_0122659_525_1628 348
49 3300048905 Ga0496102_0074594 Ga0496102_0074594_852_1955 348
50 3300048907 Ga0496104_0001976 Ga0496104_0001976_1480_2526 348
51 3300048907 Ga0496104_0009294 Ga0496104_0009294_6509_7612 348
52 3300048909 Ga0496106_0078914 Ga0496106_0078914_895_1998 348
53 3300048911 Ga0496108_0016034 Ga0496108_0016034_3785_4888 348
54 3300048912 Ga0496109_0006607 Ga0496109_0006607_3573_4676 348
55 3300048913 Ga0496110_0006375 Ga0496110_0006375_3391_4494 348
56 3300048914 Ga0496111_0073294 Ga0496111_0073294_945_2048 348
57 3300048915 Ga0496112_0001095 Ga0496112_0001095_15124_16227 348
58 3300048918 Ga0496115_0040104 Ga0496115_0040104_361_1464 348
59 3300049568 Ga0501031_0171178 Ga0501031_0171178_19_1074 348
60 3300050507 nmdc:mga05p37_2711_c2 nmdc:mga05p37_2711_c2_2038_3141 348
61 3300050510 nmdc:mga06r32_492618_c1 nmdc:mga06r32_492618_c1_67_1170 348
62 3300053077 Ga0495601_0161926 Ga0495601_0161926_41_1096 348
63 3300025297 Ga0209758_1003309 Ga0209758_10033094 349
64 3300046499 Ga0495594_0088940 Ga0495594_0088940_16_1068 349
65 3300006846 Ga0075430_100022067 Ga0075430_1000220672 351
66 3300006847 Ga0075431_100172727 Ga0075431_1001727272 351
67 3300009147 Ga0114129_10039984 Ga0114129_100399845 351
68 3300050509 nmdc:mga0qj67_246139_c1 nmdc:mga0qj67_246139_c1_226_1335 351
69 3300050510 nmdc:mga06r32_51164_c1 nmdc:mga06r32_51164_c1_2591_3700 351
70 3300028556 Ga0265337_1002468 Ga0265337_10024682 352
71 3300028563 Ga0265319_1009070 Ga0265319_10090703 352
72 3300028573 Ga0265334_10000456 Ga0265334_100004563 352
73 3300028577 Ga0265318_10015114 Ga0265318_100151142 352
74 3300028653 Ga0265323_10000424 Ga0265323_1000042422 352
75 3300028654 Ga0265322_10034843 Ga0265322_100348431 352
76 3300028666 Ga0265336_10000431 Ga0265336_100004316 352
77 3300028800 Ga0265338_10000321 Ga0265338_1000032150 352
78 3300029957 Ga0265324_10005870 Ga0265324_100058703 352
79 3300005434 Ga0070709_10000765 Ga0070709_1000076512 353
80 3300005435 Ga0070714_100004348 Ga0070714_10000434810 353
81 3300005436 Ga0070713_100042866 Ga0070713_1000428662 353
82 3300005439 Ga0070711_100019807 Ga0070711_1000198073 353
83 3300006028 Ga0070717_10008045 Ga0070717_100080452 353
84 3300006163 Ga0070715_10000890 Ga0070715_100008906 353
85 3300025898 Ga0207692_10002579 Ga0207692_100025794 353
86 3300025905 Ga0207685_10002531 Ga0207685_100025313 353
87 3300025928 Ga0207700_10098400 Ga0207700_100984002 353
88 3300025928 Ga0207700_10226283 Ga0207700_102262832 353
89 3300025929 Ga0207664_10069359 Ga0207664_100693593 353
90 3300025929 Ga0207664_10137916 Ga0207664_101379162 353
91 3300025939 Ga0207665_10000204 Ga0207665_1000020420 353
92 3300035724 Ga0373933_0061486 Ga0373933_0061486_947_2056 353
93 3300048909 Ga0496106_0029780 Ga0496106_0029780_2172_3275 353
94 3300050512 nmdc:mga0n895_100523_c1 nmdc:mga0n895_100523_c1_1336_2439 353
95 3300005937 Ga0081455_10158288 Ga0081455_101582881 354
96 3300046460 Ga0495638_0063674 Ga0495638_0063674_35_1144 354
97 3300048929 Ga0496126_0008467 Ga0496126_0008467_8085_9182 354
98 3300005937 Ga0081455_10019562 Ga0081455_100195625 355
99 3300046459 Ga0495629_0028160 Ga0495629_0028160_2361_3464 355
100 3300049744 Ga0501083_0113119 Ga0501083_0113119_392_1525 355
101 3300005353 Ga0070669_100154645 Ga0070669_1001546452 356
102 3300005983 Ga0081540_1023400 Ga0081540_10234002 356
103 3300005983 Ga0081540_1036625 Ga0081540_10366253 356
104 3300025295 Ga0209564_1001241 Ga0209564_10012418 356
105 3300037068 Ga0373925_0033765 Ga0373925_0033765_2059_3138 356
106 3300049571 Ga0501034_0330070 Ga0501034_0330070_113_1204 356
107 3300049579 Ga0501043_0263165 Ga0501043_0263165_151_1242 356
108 3300049581 Ga0501047_0065589 Ga0501047_0065589_416_1507 356
109 3300049586 Ga0501070_0180419 Ga0501070_0180419_450_1541 356
110 3300049822 Ga0501035_0148289 Ga0501035_0148289_553_1644 356
111 3300005364 Ga0070673_100209338 Ga0070673_1002093381 357
112 3300025960 Ga0207651_10067481 Ga0207651_100674813 357
113 3300039437 Ga0436365_1840276 Ga0436365_1840276_4060_5154 357
114 3300039453 Ga0436362_1129034 Ga0436362_1129034_1928_3022 357
115 3300048913 Ga0496110_0163361 Ga0496110_0163361_257_1372 357
116 3300048915 Ga0496112_0112207 Ga0496112_0112207_1383_2471 357
117 3300050510 nmdc:mga06r32_228205_c1 nmdc:mga06r32_228205_c1_38_1132 357
118 3300050510 nmdc:mga06r32_89581_c1 nmdc:mga06r32_89581_c1_949_2046 357
119 3300053084 Ga0495595_0154362 Ga0495595_0154362_35_1108 357
120 3300048913 Ga0496110_0240001 Ga0496110_0240001_365_1459 358
121 3300050512 nmdc:mga0n895_280023_c1 nmdc:mga0n895_280023_c1_225_1322 358
122 3300053142 Ga0500577_0000758 Ga0500577_0000758_2294_3385 358
123 3300005329 Ga0070683_100056178 Ga0070683_1000561784 359
124 3300005435 Ga0070714_100001123 Ga0070714_10000112316 359
125 3300005436 Ga0070713_100000647 Ga0070713_1000006476 359
126 3300005437 Ga0070710_10001077 Ga0070710_100010776 359
127 3300005439 Ga0070711_100043214 Ga0070711_1000432144 359
128 3300005535 Ga0070684_100109785 Ga0070684_1001097854 359
129 3300025944 Ga0207661_10000349 Ga0207661_100003493 359
130 3300031240 Ga0265320_10067525 Ga0265320_100675252 359
131 3300031595 Ga0265313_10009487 Ga0265313_100094873 359
132 3300031712 Ga0265342_10049675 Ga0265342_100496752 359
133 3300039447 Ga0436361_0003682 Ga0436361_0003682_1984_3105 359
134 3300044694 Ga0466963_0249073 Ga0466963_0249073_74_1219 359
135 3300047320 Ga0495672_0007644 Ga0495672_0007644_909_2009 359
136 3300049576 Ga0501040_0022745 Ga0501040_0022745_2756_3913 359
137 3300049582 Ga0501048_0030608 Ga0501048_0030608_218_1351 359
138 3300049589 Ga0501073_0006215 Ga0501073_0006215_936_2069 359
139 3300049592 Ga0501076_0021610 Ga0501076_0021610_2238_3371 359
140 3300049741 Ga0501079_0006063 Ga0501079_0006063_7647_8804 359
141 3300053096 Ga0500641_0003366 Ga0500641_0003366_1977_3065 359
142 iso_pu_bacteria 2874590934 2874598424 359
143 iso_pu_bacteria 2874645413 2874652521 359
144 iso_pu_bacteria 2876771140 2876778098 359
145 iso_pu_bacteria 2876818435 2876826033 359
146 iso_pu_bacteria 2879074833 2879081892 359
147 iso_pu_bacteria 2879127579 2879135014 359
148 iso_pu_bacteria 2879142872 2879149699 359
149 iso_pu_bacteria 8019619141 8019628591 359
150 iso_pu_bacteria 8019678201 8019684657 359
151 3300005435 Ga0070714_100006896 Ga0070714_1000068964 360
152 3300005436 Ga0070713_100062420 Ga0070713_1000624204 360
153 3300005458 Ga0070681_10036942 Ga0070681_100369423 360
154 3300005530 Ga0070679_100013382 Ga0070679_1000133824 360
155 3300005981 Ga0081538_10017231 Ga0081538_100172313 360
156 3300006042 Ga0075368_10005443 Ga0075368_100054434 360
157 3300006042 Ga0075368_10015438 Ga0075368_100154383 360
158 3300006048 Ga0075363_100034975 Ga0075363_1000349753 360
159 3300006051 Ga0075364_10034307 Ga0075364_100343072 360
160 3300006177 Ga0075362_10005605 Ga0075362_100056053 360
161 3300006353 Ga0075370_10024424 Ga0075370_100244242 360
162 3300006880 Ga0075429_100175772 Ga0075429_1001757722 360
163 3300009545 Ga0105237_10228790 Ga0105237_102287902 360
164 3300010375 Ga0105239_10169078 Ga0105239_101690782 360
165 3300013297 Ga0157378_10392599 Ga0157378_103925992 360
166 3300025253 Ga0209677_105615 Ga0209677_1056153 360
167 3300025912 Ga0207707_10000950 Ga0207707_1000095020 360
168 3300025921 Ga0207652_10043416 Ga0207652_100434164 360
169 3300031238 Ga0265332_10002663 Ga0265332_100026632 360
170 3300031250 Ga0265331_10019579 Ga0265331_100195792 360
171 3300031344 Ga0265316_10117758 Ga0265316_101177583 360
172 3300031712 Ga0265342_10000210 Ga0265342_1000021039 360
173 3300035083 Ga0373926_0027317 Ga0373926_0027317_764_1870 360
174 3300035113 Ga0373936_0034336 Ga0373936_0034336_118_1224 360
175 3300035170 Ga0373943_0037581 Ga0373943_0037581_269_1375 360
176 3300035171 Ga0373946_0021549 Ga0373946_0021549_386_1492 360
177 3300035410 Ga0373924_0003483 Ga0373924_0003483_310_1416 360
178 3300035692 Ga0373935_0070498 Ga0373935_0070498_454_1560 360
179 3300035695 Ga0373927_0105322 Ga0373927_0105322_183_1289 360
180 3300039437 Ga0436365_1822185 Ga0436365_1822185_463_1575 360
181 3300046455 Ga0495603_0115785 Ga0495603_0115785_161_1267 360
182 3300046475 Ga0495639_0051376 Ga0495639_0051376_724_1830 360
183 3300046476 Ga0495662_0067536 Ga0495662_0067536_365_1471 360
184 3300046477 Ga0495664_0026626 Ga0495664_0026626_1277_2383 360
185 3300046514 Ga0495618_0011828 Ga0495618_0011828_609_1715 360
186 3300046516 Ga0495628_0063069 Ga0495628_0063069_393_1499 360
187 3300046517 Ga0495630_0025233 Ga0495630_0025233_310_1416 360
188 3300046531 Ga0495665_0019583 Ga0495665_0019583_2108_3214 360
189 3300046533 Ga0495640_0116833 Ga0495640_0116833_97_1203 360
190 3300046663 Ga0495635_0167153 Ga0495635_0167153_81_1187 360
191 3300046683 Ga0495658_0096637 Ga0495658_0096637_549_1655 360
192 3300047315 Ga0495581_0048953 Ga0495581_0048953_1221_2327 360
193 3300048924 Ga0496121_0045710 Ga0496121_0045710_2200_3306 360
194 3300048928 Ga0496125_0000060 Ga0496125_0000060_85212_86309 360
195 3300049824 Ga0501045_0040349 Ga0501045_0040349_121_1254 360
196 3300050491 nmdc:mga00v17_47087_c1 nmdc:mga00v17_47087_c1_597_1688 360
197 3300050492 nmdc:mga0yw44_204887_c1 nmdc:mga0yw44_204887_c1_49_1140 360
198 3300050496 nmdc:mga07m45_103068_c1 nmdc:mga07m45_103068_c1_221_1312 360
199 3300050516 nmdc:mga0sz30_50479_c1 nmdc:mga0sz30_50479_c1_308_1399 360
200 iso_pu_bacteria 2513237096 2513657066 360
201 iso_pu_bacteria 2513237137 2513855507 360
202 iso_pu_bacteria 2513237145 2513918806 360
203 iso_pu_bacteria 2517572143 2517892053 360
204 iso_pu_bacteria 2524023228 2524534136 360
205 iso_pu_bacteria 2667528175 2671121910 360
206 iso_pu_bacteria 2728368998 2728753007 360
207 iso_pu_bacteria 2791355197 2793068873 360
208 iso_pu_bacteria 2885374607 2885375915 360
209 iso_pu_bacteria 2903748898 2903753440 360
210 iso_pu_bacteria 2904699407 2904702161 360
211 iso_pu_bacteria 2906610324 2906617180 360
212 iso_pu_bacteria 2906635258 2906639243 360
213 iso_pu_bacteria 2906660503 2906662442 360
214 iso_pu_bacteria 2908739725 2908742328 360
215 iso_pu_bacteria 2922386360 2922391319 360
216 iso_pu_bacteria 2922425934 2922430650 360
217 iso_pu_bacteria 2935630451 2935631188 360
218 iso_pu_bacteria 2941507105 2941509929 360
219 iso_pu_bacteria 2941515067 2941518984 360
220 iso_pu_bacteria 2941523033 2941525328 360
221 iso_pu_bacteria 8006933436 8006940212 360
222 iso_pu_bacteria 8006973647 8006979991 360
223 iso_pu_bacteria 8019555841 8019556195 360
224 iso_pu_bacteria 8056681323 8056689252 360
225 3300003215 JGI25153J46596_10007386 JGI25153J46596_100073864 361
226 3300005336 Ga0070680_100116879 Ga0070680_1001168791 361
227 3300005614 Ga0068856_100000020 Ga0068856_100000020131 361
228 3300005985 Ga0081539_10048315 Ga0081539_100483153 361
229 3300006038 Ga0075365_10066735 Ga0075365_100667352 361
230 3300006186 Ga0075369_10050535 Ga0075369_100505352 361
231 3300006941 Ga0099825_1024808 Ga0099825_10248082 361
232 3300006942 Ga0099824_1005874 Ga0099824_100587413 361
233 3300006943 Ga0099822_1001130 Ga0099822_10011307 361
234 3300025261 Ga0209233_1018718 Ga0209233_10187182 361
235 3300025297 Ga0209758_1005630 Ga0209758_10056305 361
236 3300025900 Ga0207710_10049074 Ga0207710_100490742 361
237 3300025914 Ga0207671_10100175 Ga0207671_101001752 361
238 3300025961 Ga0207712_10264549 Ga0207712_102645492 361
239 3300026078 Ga0207702_10000126 Ga0207702_1000012618 361
240 3300027357 Ga0209589_1000001 Ga0209589_1000001288 361
241 3300027361 Ga0209489_100001 Ga0209489_100001288 361
242 3300027363 Ga0209700_100001 Ga0209700_100001288 361
243 3300028786 Ga0307517_10000008 Ga0307517_10000008184 361
244 3300031235 Ga0265330_10039647 Ga0265330_100396473 361
245 3300031241 Ga0265325_10038114 Ga0265325_100381142 361
246 3300031249 Ga0265339_10014916 Ga0265339_100149162 361
247 3300031711 Ga0265314_10043127 Ga0265314_100431273 361
248 3300031712 Ga0265342_10007904 Ga0265342_100079044 361
249 3300033442 Ga0315911_1000006 Ga0315911_1000006363 361
250 3300035691 Ga0373931_0071835 Ga0373931_0071835_316_1422 361
251 3300037466 Ga0395898_0057370 Ga0395898_0057370_1059_2162 361
252 3300046513 Ga0495616_0100779 Ga0495616_0100779_217_1323 361
253 3300048905 Ga0496102_0012241 Ga0496102_0012241_4794_5900 361
254 3300048905 Ga0496102_0103808 Ga0496102_0103808_599_1708 361
255 3300048906 Ga0496103_0037576 Ga0496103_0037576_845_1951 361
256 3300048915 Ga0496112_0182993 Ga0496112_0182993_852_1958 361
257 3300048916 Ga0496113_0016119 Ga0496113_0016119_457_1563 361
258 3300048918 Ga0496115_0137366 Ga0496115_0137366_447_1544 361
259 3300048929 Ga0496126_0004957 Ga0496126_0004957_8982_10100 361
260 3300048929 Ga0496126_0013579 Ga0496126_0013579_7053_8162 361
261 3300050516 nmdc:mga0sz30_43442_c2 nmdc:mga0sz30_43442_c2_392_1501 361
262 3300053096 Ga0500641_0020358 Ga0500641_0020358_575_1681 361
263 3300053119 Ga0500595_000932 Ga0500595_000932_14745_15869 361
264 3300053177 Ga0500636_0015101 Ga0500636_0015101_3159_4283 361
265 3300053177 Ga0500636_0019872 Ga0500636_0019872_1154_2269 361
266 3300053731 Ga0500609_008204 Ga0500609_008204_285_1397 361
267 iso_pu_bacteria 2508501128 2509151471 361
268 iso_pu_bacteria 2511231028 2511398747 361
269 iso_pu_bacteria 2844315083 2844319430 361
270 iso_pu_bacteria 2876761206 2876764973 361
271 iso_pu_bacteria 2906602504 2906609164 361
272 iso_pu_bacteria 2935777560 2935778924 361
273 iso_pu_bacteria 8016530956 8016534425 361
274 iso_pu_bacteria 8016539877 8016547650 361
275 iso_pu_bacteria 8016548790 8016554490 361
276 iso_pu_bacteria 8016557553 8016562862 361
277 iso_pu_bacteria 8016595262 8016600637 361
278 iso_pu_bacteria 8016603502 8016610100 361
279 iso_pu_bacteria 8016613128 8016614838 361
280 3300005436 Ga0070713_100075566 Ga0070713_1000755663 362
281 3300005437 Ga0070710_10008883 Ga0070710_100088832 362
282 3300005439 Ga0070711_100007383 Ga0070711_1000073837 362
283 3300005457 Ga0070662_100095066 Ga0070662_1000950663 362
284 3300005471 Ga0070698_100206373 Ga0070698_1002063731 362
285 3300005535 Ga0070684_100190645 Ga0070684_1001906451 362
286 3300005563 Ga0068855_100142736 Ga0068855_1001427362 362
287 3300005564 Ga0070664_100053036 Ga0070664_1000530363 362
288 3300005578 Ga0068854_100147310 Ga0068854_1001473102 362
289 3300005614 Ga0068856_100015688 Ga0068856_1000156884 362
290 3300005616 Ga0068852_100027093 Ga0068852_1000270934 362
291 3300005616 Ga0068852_100137450 Ga0068852_1001374502 362
292 3300006173 Ga0070716_100117402 Ga0070716_1001174022 362
293 3300006175 Ga0070712_100003177 Ga0070712_1000031778 362
294 3300006175 Ga0070712_100021375 Ga0070712_1000213754 362
295 3300006175 Ga0070712_100069240 Ga0070712_1000692401 362
296 3300006844 Ga0075428_100003918 Ga0075428_1000039188 362
297 3300006846 Ga0075430_100011920 Ga0075430_1000119202 362
298 3300006847 Ga0075431_100001468 Ga0075431_10000146814 362
299 3300006880 Ga0075429_100007126 Ga0075429_1000071265 362
300 3300009093 Ga0105240_10010915 Ga0105240_100109153 362
301 3300009094 Ga0111539_10003134 Ga0111539_1000313413 362
302 3300009098 Ga0105245_10049793 Ga0105245_100497932 362
303 3300009147 Ga0114129_10009260 Ga0114129_1000926013 362
304 3300009174 Ga0105241_10017590 Ga0105241_100175905 362
305 3300010375 Ga0105239_10091963 Ga0105239_100919632 362
306 3300013104 Ga0157370_10065826 Ga0157370_100658263 362
307 3300014325 Ga0163163_10000985 Ga0163163_1000098517 362
308 3300021384 Ga0213876_10004192 Ga0213876_100041928 362
309 3300025906 Ga0207699_10027898 Ga0207699_100278982 362
310 3300025911 Ga0207654_10052549 Ga0207654_100525491 362
311 3300025911 Ga0207654_10062518 Ga0207654_100625182 362
312 3300025913 Ga0207695_10000008 Ga0207695_10000008182 362
313 3300025914 Ga0207671_10008090 Ga0207671_100080906 362
314 3300025914 Ga0207671_10087332 Ga0207671_100873322 362
315 3300025915 Ga0207693_10001966 Ga0207693_100019667 362
316 3300025933 Ga0207706_10099788 Ga0207706_100997882 362
317 3300025941 Ga0207711_10209674 Ga0207711_102096741 362
318 3300025942 Ga0207689_10107194 Ga0207689_101071941 362
319 3300025945 Ga0207679_10019748 Ga0207679_100197484 362
320 3300025949 Ga0207667_10434751 Ga0207667_104347512 362
321 3300026067 Ga0207678_10015480 Ga0207678_100154805 362
322 3300026118 Ga0207675_100364668 Ga0207675_1003646681 362
323 3300026142 Ga0207698_10307556 Ga0207698_103075562 362
324 3300027907 Ga0207428_10004211 Ga0207428_100042117 362
325 3300033180 Ga0307510_10019107 Ga0307510_100191075 362
326 3300033180 Ga0307510_10087045 Ga0307510_100870453 362
327 3300037418 Ga0395900_0032586 Ga0395900_0032586_2354_3457 362
328 3300037418 Ga0395900_0064143 Ga0395900_0064143_938_2041 362
329 3300037466 Ga0395898_0073526 Ga0395898_0073526_1903_3006 362
330 3300037853 Ga0436364_1477382 Ga0436364_1477382_440_1540 362
331 3300038443 Ga0395901_0006650 Ga0395901_0006650_9598_10701 362
332 3300038443 Ga0395901_0291362 Ga0395901_0291362_458_1549 362
333 3300044684 Ga0466966_0000334 Ga0466966_0000334_15144_16256 362
334 3300044693 Ga0466961_0000509 Ga0466961_0000509_8672_9784 362
335 3300045049 Ga0466959_0113858 Ga0466959_0113858_170_1282 362
336 3300046455 Ga0495603_0004733 Ga0495603_0004733_6120_7232 362
337 3300046462 Ga0495651_0001733 Ga0495651_0001733_4952_6064 362
338 3300046477 Ga0495664_0001939 Ga0495664_0001939_8524_9636 362
339 3300046511 Ga0495608_0005911 Ga0495608_0005911_2005_3117 362
340 3300046516 Ga0495628_0028739 Ga0495628_0028739_1725_2837 362
341 3300046517 Ga0495630_0064928 Ga0495630_0064928_537_1655 362
342 3300046517 Ga0495630_0093563 Ga0495630_0093563_487_1599 362
343 3300046529 Ga0495652_0047738 Ga0495652_0047738_1966_3078 362
344 3300046536 Ga0495587_0008847 Ga0495587_0008847_302_1414 362
345 3300046543 Ga0495645_0034948 Ga0495645_0034948_2050_3162 362
346 3300046559 Ga0495667_0003089 Ga0495667_0003089_5258_6370 362
347 3300046642 Ga0495634_0043804 Ga0495634_0043804_156_1268 362
348 3300046642 Ga0495634_0126719 Ga0495634_0126719_203_1321 362
349 3300046675 Ga0495657_0007669 Ga0495657_0007669_482_1594 362
350 3300046689 Ga0495613_0115649 Ga0495613_0115649_451_1563 362
351 3300046809 Ga0495600_0008276 Ga0495600_0008276_1691_2803 362
352 3300047317 Ga0495604_0007727 Ga0495604_0007727_4456_5568 362
353 3300047319 Ga0495674_0006216 Ga0495674_0006216_6368_7480 362
354 3300047444 Ga0495675_0034458 Ga0495675_0034458_632_1744 362
355 3300048907 Ga0496104_0004574 Ga0496104_0004574_5424_6539 362
356 3300048907 Ga0496104_0061521 Ga0496104_0061521_262_1371 362
357 3300048908 Ga0496105_0052505 Ga0496105_0052505_370_1479 362
358 3300048908 Ga0496105_0061924 Ga0496105_0061924_1016_2131 362
359 3300048909 Ga0496106_0001378 Ga0496106_0001378_13635_14744 362
360 3300048910 Ga0496107_0033908 Ga0496107_0033908_527_1636 362
361 3300048911 Ga0496108_0000501 Ga0496108_0000501_14078_15187 362
362 3300048912 Ga0496109_0001015 Ga0496109_0001015_3172_4281 362
363 3300048912 Ga0496109_0039798 Ga0496109_0039798_2984_4096 362
364 3300048914 Ga0496111_0072818 Ga0496111_0072818_1049_2158 362
365 3300048915 Ga0496112_0010513 Ga0496112_0010513_1691_2806 362
366 3300048916 Ga0496113_0028731 Ga0496113_0028731_731_1840 362
367 3300048924 Ga0496121_0002279 Ga0496121_0002279_20043_21170 362
368 3300049569 Ga0501032_0012456 Ga0501032_0012456_28_1152 362
369 3300049570 Ga0501033_0000282 Ga0501033_0000282_33564_34688 362
370 3300049573 Ga0501037_0001227 Ga0501037_0001227_10397_11521 362
371 3300049575 Ga0501039_0003428 Ga0501039_0003428_10310_11434 362
372 3300049579 Ga0501043_0019319 Ga0501043_0019319_893_2017 362
373 3300049584 Ga0501068_0114452 Ga0501068_0114452_288_1412 362
374 3300049822 Ga0501035_0072843 Ga0501035_0072843_318_1442 362
375 3300049823 Ga0501044_0024267 Ga0501044_0024267_4230_5354 362
376 3300050507 nmdc:mga05p37_430_c1 nmdc:mga05p37_430_c1_34950_36056 362
377 3300050508 nmdc:mga09592_6098_c1 nmdc:mga09592_6098_c1_2891_3997 362
378 3300050509 nmdc:mga0qj67_83992_c1 nmdc:mga0qj67_83992_c1_380_1486 362
379 3300050510 nmdc:mga06r32_1291_c1 nmdc:mga06r32_1291_c1_12523_13629 362
380 3300050511 nmdc:mga08y16_1565_c1 nmdc:mga08y16_1565_c1_11368_12474 362
381 3300053077 Ga0495601_0135379 Ga0495601_0135379_11_1147 362
382 3300053080 Ga0500635_0003783 Ga0500635_0003783_93_1205 362
383 3300053102 Ga0500554_005155 Ga0500554_005155_370_1482 362
384 3300053105 Ga0500557_000052 Ga0500557_000052_2050_3162 362
385 3300053119 Ga0500595_017822 Ga0500595_017822_135_1250 362
386 3300053130 Ga0500642_0000274 Ga0500642_0000274_12668_13780 362
387 3300053178 Ga0500637_0003531 Ga0500637_0003531_834_1946 362
388 3300053729 Ga0500625_022632 Ga0500625_022632_185_1297 362
389 3300060353 Ga0501082_0265651 Ga0501082_0265651_311_1408 362
390 iso_pu_bacteria 2513237095 2513645424 362
391 iso_pu_bacteria 2816332527 2818239661 362
392 iso_pu_bacteria 2888378607 2888384497 362
393 3300005328 Ga0070676_10033115 Ga0070676_100331153 363
394 3300005333 Ga0070677_10016853 Ga0070677_100168533 363
395 3300005353 Ga0070669_100106151 Ga0070669_1001061512 363
396 3300005354 Ga0070675_100363510 Ga0070675_1003635101 363
397 3300005356 Ga0070674_100001777 Ga0070674_10000177712 363
398 3300005436 Ga0070713_100082398 Ga0070713_1000823983 363
399 3300005456 Ga0070678_100011686 Ga0070678_1000116863 363
400 3300005539 Ga0068853_100000785 Ga0068853_1000007854 363
401 3300005563 Ga0068855_100005618 Ga0068855_10000561810 363
402 3300005577 Ga0068857_100031091 Ga0068857_1000310914 363
403 3300005614 Ga0068856_100001874 Ga0068856_1000018747 363
404 3300005616 Ga0068852_100005253 Ga0068852_1000052533 363
405 3300005718 Ga0068866_10165602 Ga0068866_101656021 363
406 3300005842 Ga0068858_100275069 Ga0068858_1002750691 363
407 3300006051 Ga0075364_10126354 Ga0075364_101263542 363
408 3300006177 Ga0075362_10005001 Ga0075362_100050013 363
409 3300006195 Ga0075366_10004770 Ga0075366_100047707 363
410 3300007788 Ga0099795_10013458 Ga0099795_100134581 363
411 3300009093 Ga0105240_10020186 Ga0105240_100201864 363
412 3300009147 Ga0114129_10570665 Ga0114129_105706652 363
413 3300009148 Ga0105243_10268119 Ga0105243_102681192 363
414 3300009551 Ga0105238_10011980 Ga0105238_100119804 363
415 3300009551 Ga0105238_10018757 Ga0105238_100187574 363
416 3300010159 Ga0099796_10016410 Ga0099796_100164103 363
417 3300010375 Ga0105239_10014407 Ga0105239_100144075 363
418 3300010375 Ga0105239_10014647 Ga0105239_100146474 363
419 3300013297 Ga0157378_10212140 Ga0157378_102121402 363
420 3300013306 Ga0163162_10477391 Ga0163162_104773911 363
421 3300021384 Ga0213876_10013161 Ga0213876_100131614 363
422 3300025297 Ga0209758_1053463 Ga0209758_10534632 363
423 3300025893 Ga0207682_10000451 Ga0207682_1000045110 363
424 3300025901 Ga0207688_10017933 Ga0207688_100179333 363
425 3300025907 Ga0207645_10074418 Ga0207645_100744182 363
426 3300025908 Ga0207643_10053870 Ga0207643_100538702 363
427 3300025911 Ga0207654_10000232 Ga0207654_100002324 363
428 3300025913 Ga0207695_10001547 Ga0207695_1000154719 363
429 3300025923 Ga0207681_10163533 Ga0207681_101635332 363
430 3300025924 Ga0207694_10000050 Ga0207694_1000005092 363
431 3300025924 Ga0207694_10041876 Ga0207694_100418762 363
432 3300025926 Ga0207659_10239086 Ga0207659_102390861 363
433 3300025940 Ga0207691_10001066 Ga0207691_1000106616 363
434 3300025940 Ga0207691_10096903 Ga0207691_100969032 363
435 3300025949 Ga0207667_10032035 Ga0207667_100320354 363
436 3300025960 Ga0207651_10226622 Ga0207651_102266222 363
437 3300025981 Ga0207640_10055190 Ga0207640_100551902 363
438 3300026035 Ga0207703_10263121 Ga0207703_102631211 363
439 3300026078 Ga0207702_10000002 Ga0207702_10000002202 363
440 3300026089 Ga0207648_10023754 Ga0207648_100237543 363
441 3300026121 Ga0207683_10000733 Ga0207683_100007332 363
442 3300035120 Ga0373957_0009374 Ga0373957_0009374_1450_2610 363
443 3300035724 Ga0373933_0105181 Ga0373933_0105181_260_1420 363
444 3300036401 Ga0373937_0026472 Ga0373937_0026472_3547_4707 363
445 3300037068 Ga0373925_0044060 Ga0373925_0044060_1690_2850 363
446 3300039437 Ga0436365_0139392 Ga0436365_0139392_2040_3137 363
447 3300039450 Ga0436363_0602269 Ga0436363_0602269_4005_5123 363
448 3300045976 Ga0466967_0368085 Ga0466967_0368085_96_1202 363
449 3300046474 Ga0495605_0042617 Ga0495605_0042617_549_1646 363
450 3300046529 Ga0495652_0023334 Ga0495652_0023334_1534_2694 363
451 3300046678 Ga0495599_0006216 Ga0495599_0006216_5346_6506 363
452 3300046679 Ga0495623_0006875 Ga0495623_0006875_3591_4751 363
453 3300046809 Ga0495600_0007437 Ga0495600_0007437_4460_5620 363
454 3300047444 Ga0495675_0022639 Ga0495675_0022639_2111_3271 363
455 3300048088 Ga0495602_0009411 Ga0495602_0009411_6459_7619 363
456 3300048907 Ga0496104_0000575 Ga0496104_0000575_25075_26178 363
457 3300048908 Ga0496105_0005756 Ga0496105_0005756_7713_8816 363
458 3300048917 Ga0496114_0204106 Ga0496114_0204106_392_1492 363
459 3300048918 Ga0496115_0278383 Ga0496115_0278383_101_1198 363
460 3300048923 Ga0496120_0055950 Ga0496120_0055950_966_2075 363
461 3300048927 Ga0496124_0033059 Ga0496124_0033059_3029_4135 363
462 3300048928 Ga0496125_0091464 Ga0496125_0091464_1114_2226 363
463 3300049568 Ga0501031_0000268 Ga0501031_0000268_2777_3892 363
464 3300049569 Ga0501032_0000765 Ga0501032_0000765_3624_4739 363
465 3300049569 Ga0501032_0036807 Ga0501032_0036807_2122_3252 363
466 3300049570 Ga0501033_0000344 Ga0501033_0000344_9053_10168 363
467 3300049570 Ga0501033_0040568 Ga0501033_0040568_1074_2231 363
468 3300049571 Ga0501034_0000100 Ga0501034_0000100_87027_88142 363
469 3300049572 Ga0501036_0000228 Ga0501036_0000228_35402_36517 363
470 3300049572 Ga0501036_0123100 Ga0501036_0123100_669_1799 363
471 3300049572 Ga0501036_0184752 Ga0501036_0184752_299_1429 363
472 3300049573 Ga0501037_0000704 Ga0501037_0000704_378_1493 363
473 3300049573 Ga0501037_0041315 Ga0501037_0041315_37_1167 363
474 3300049574 Ga0501038_0000350 Ga0501038_0000350_21353_22468 363
475 3300049574 Ga0501038_0006039 Ga0501038_0006039_7660_8790 363
476 3300049575 Ga0501039_0112299 Ga0501039_0112299_368_1525 363
477 3300049579 Ga0501043_0000106 Ga0501043_0000106_5014_6129 363
478 3300049579 Ga0501043_0017698 Ga0501043_0017698_102_1232 363
479 3300049579 Ga0501043_0072182 Ga0501043_0072182_617_1774 363
480 3300049580 Ga0501046_0000426 Ga0501046_0000426_35943_37058 363
481 3300049581 Ga0501047_0000493 Ga0501047_0000493_7770_8885 363
482 3300049581 Ga0501047_0081958 Ga0501047_0081958_1406_2536 363
483 3300049582 Ga0501048_0000233 Ga0501048_0000233_25608_26723 363
484 3300049583 Ga0501067_0000384 Ga0501067_0000384_89_1204 363
485 3300049583 Ga0501067_0034761 Ga0501067_0034761_1221_2378 363
486 3300049584 Ga0501068_0005924 Ga0501068_0005924_5537_6652 363
487 3300049585 Ga0501069_0130537 Ga0501069_0130537_74_1207 363
488 3300049586 Ga0501070_0001419 Ga0501070_0001419_7770_8885 363
489 3300049587 Ga0501071_0083386 Ga0501071_0083386_997_2124 363
490 3300049588 Ga0501072_0004603 Ga0501072_0004603_5346_6461 363
491 3300049589 Ga0501073_0028392 Ga0501073_0028392_2029_3144 363
492 3300049590 Ga0501074_0000382 Ga0501074_0000382_5221_6336 363
493 3300049590 Ga0501074_0002758 Ga0501074_0002758_6464_7621 363
494 3300049591 Ga0501075_0114580 Ga0501075_0114580_550_1707 363
495 3300049593 Ga0501077_0055053 Ga0501077_0055053_458_1591 363
496 3300049741 Ga0501079_0002879 Ga0501079_0002879_8746_9861 363
497 3300049742 Ga0501080_0006214 Ga0501080_0006214_7898_9013 363
498 3300049744 Ga0501083_0000116 Ga0501083_0000116_2798_3913 363
499 3300049822 Ga0501035_0000496 Ga0501035_0000496_14798_15913 363
500 3300049823 Ga0501044_0000857 Ga0501044_0000857_32462_33577 363
501 3300049823 Ga0501044_0007497 Ga0501044_0007497_4291_5421 363
502 3300049823 Ga0501044_0141372 Ga0501044_0141372_938_2095 363
503 3300050491 nmdc:mga00v17_102158_c1 nmdc:mga00v17_102158_c1_466_1572 363
504 3300050493 nmdc:mga0k408_26711_c1 nmdc:mga0k408_26711_c1_1920_3026 363
505 3300053077 Ga0495601_0010913 Ga0495601_0010913_1094_2254 363
506 3300053078 Ga0495612_0022290 Ga0495612_0022290_266_1426 363
507 3300053084 Ga0495595_0007198 Ga0495595_0007198_163_1323 363
508 3300053085 Ga0495619_0003147 Ga0495619_0003147_4323_5483 363
509 3300053111 Ga0500572_000307 Ga0500572_000307_14003_15130 363
510 3300053136 Ga0500559_0000143 Ga0500559_0000143_42217_43344 363
511 3300060353 Ga0501082_0000452 Ga0501082_0000452_12610_13725 363
512 3300060353 Ga0501082_0002875 Ga0501082_0002875_5786_6889 363
513 3300005937 Ga0081455_10008702 Ga0081455_100087029 364
514 3300006038 Ga0075365_10075457 Ga0075365_100754572 364
515 3300006051 Ga0075364_10054123 Ga0075364_100541233 364
516 3300006844 Ga0075428_100050043 Ga0075428_1000500434 364
517 3300006847 Ga0075431_100012459 Ga0075431_1000124594 364
518 3300006847 Ga0075431_100083948 Ga0075431_1000839483 364
519 3300009147 Ga0114129_10011780 Ga0114129_100117803 364
520 3300037466 Ga0395898_0102868 Ga0395898_0102868_1602_2699 364
521 3300038443 Ga0395901_0167889 Ga0395901_0167889_368_1465 364
522 3300049744 Ga0501083_0023703 Ga0501083_0023703_947_2050 364
523 3300050507 nmdc:mga05p37_7402_c1 nmdc:mga05p37_7402_c1_9671_10768 364
524 3300050510 nmdc:mga06r32_197927_c1 nmdc:mga06r32_197927_c1_532_1629 364
525 3300005435 Ga0070714_100123026 Ga0070714_1001230263 365
526 3300005436 Ga0070713_100014010 Ga0070713_1000140103 365
527 3300005518 Ga0070699_100015158 Ga0070699_1000151584 365
528 3300005937 Ga0081455_10023171 Ga0081455_100231713 365
529 3300005981 Ga0081538_10037618 Ga0081538_100376182 365
530 3300005983 Ga0081540_1053208 Ga0081540_10532082 365
531 3300006038 Ga0075365_10037236 Ga0075365_100372363 365
532 3300006048 Ga0075363_100038357 Ga0075363_1000383573 365
533 3300006175 Ga0070712_100015060 Ga0070712_1000150602 365
534 3300006177 Ga0075362_10009446 Ga0075362_100094463 365
535 3300006178 Ga0075367_10005992 Ga0075367_100059924 365
536 3300006195 Ga0075366_10037649 Ga0075366_100376493 365
537 3300006353 Ga0075370_10009560 Ga0075370_100095603 365
538 3300009147 Ga0114129_10021519 Ga0114129_1002151910 365
539 3300009147 Ga0114129_10138611 Ga0114129_101386113 365
540 3300021361 Ga0213872_10052472 Ga0213872_100524722 365
541 3300025885 Ga0207653_10006516 Ga0207653_100065164 365
542 3300025910 Ga0207684_10028032 Ga0207684_100280323 365
543 3300025915 Ga0207693_10063793 Ga0207693_100637933 365
544 3300035170 Ga0373943_0078006 Ga0373943_0078006_22_1233 365
545 3300035171 Ga0373946_0016456 Ga0373946_0016456_457_1566 365
546 3300035725 Ga0373947_0079108 Ga0373947_0079108_900_2009 365
547 3300046459 Ga0495629_0149967 Ga0495629_0149967_70_1179 365
548 3300046533 Ga0495640_0098441 Ga0495640_0098441_478_1587 365
549 3300046642 Ga0495634_0195751 Ga0495634_0195751_110_1219 365
550 3300048914 Ga0496111_0293623 Ga0496111_0293623_55_1155 365
551 3300050491 nmdc:mga00v17_19178_c1 nmdc:mga00v17_19178_c1_1888_2994 365
552 3300050492 nmdc:mga0yw44_67662_c1 nmdc:mga0yw44_67662_c1_1073_2179 365
553 3300050493 nmdc:mga0k408_96542_c1 nmdc:mga0k408_96542_c1_74_1180 365
554 3300053134 Ga0500658_0056259 Ga0500658_0056259_303_1409 365
555 3300001990 JGI24737J22298_10034618 JGI24737J22298_100346181 366
556 3300001991 JGI24743J22301_10004622 JGI24743J22301_100046222 366
557 3300002074 JGI24748J21848_1007608 JGI24748J21848_10076081 366
558 3300002244 JGI24742J22300_10009931 JGI24742J22300_100099312 366
559 3300005328 Ga0070676_10107173 Ga0070676_101071732 366
560 3300005334 Ga0068869_100109077 Ga0068869_1001090772 366
561 3300005337 Ga0070682_100093095 Ga0070682_1000930952 366
562 3300005338 Ga0068868_100020698 Ga0068868_1000206983 366
563 3300005343 Ga0070687_100002547 Ga0070687_1000025475 366
564 3300005347 Ga0070668_100298091 Ga0070668_1002980911 366
565 3300005354 Ga0070675_100178375 Ga0070675_1001783752 366
566 3300005355 Ga0070671_100179998 Ga0070671_1001799982 366
567 3300005367 Ga0070667_100045667 Ga0070667_1000456672 366
568 3300005438 Ga0070701_10017803 Ga0070701_100178032 366
569 3300005440 Ga0070705_100013205 Ga0070705_1000132054 366
570 3300005455 Ga0070663_100310843 Ga0070663_1003108431 366
571 3300005457 Ga0070662_100021718 Ga0070662_1000217181 366
572 3300005459 Ga0068867_100017477 Ga0068867_1000174772 366
573 3300005466 Ga0070685_10115417 Ga0070685_101154171 366
574 3300005535 Ga0070684_100020410 Ga0070684_1000204105 366
575 3300005543 Ga0070672_100019246 Ga0070672_1000192462 366
576 3300005549 Ga0070704_100051208 Ga0070704_1000512083 366
577 3300005564 Ga0070664_100048685 Ga0070664_1000486853 366
578 3300005615 Ga0070702_100015321 Ga0070702_1000153213 366
579 3300005718 Ga0068866_10054684 Ga0068866_100546841 366
580 3300005719 Ga0068861_100053725 Ga0068861_1000537253 366
581 3300005834 Ga0068851_10049434 Ga0068851_100494342 366
582 3300005841 Ga0068863_100003267 Ga0068863_1000032674 366
583 3300005843 Ga0068860_100019769 Ga0068860_1000197696 366
584 3300005844 Ga0068862_100014292 Ga0068862_1000142926 366
585 3300005937 Ga0081455_10000807 Ga0081455_100008074 366
586 3300005983 Ga0081540_1001420 Ga0081540_100142016 366
587 3300006175 Ga0070712_100152838 Ga0070712_1001528381 366
588 3300006237 Ga0097621_100016628 Ga0097621_1000166285 366
589 3300006871 Ga0075434_100039954 Ga0075434_1000399543 366
590 3300006871 Ga0075434_100148985 Ga0075434_1001489853 366
591 3300006881 Ga0068865_100005250 Ga0068865_1000052507 366
592 3300009098 Ga0105245_10040069 Ga0105245_100400692 366
593 3300009148 Ga0105243_10118748 Ga0105243_101187483 366
594 3300009177 Ga0105248_10053872 Ga0105248_100538722 366
595 3300013297 Ga0157378_10222994 Ga0157378_102229943 366
596 3300013306 Ga0163162_10379892 Ga0163162_103798922 366
597 3300014325 Ga0163163_10258228 Ga0163163_102582282 366
598 3300014968 Ga0157379_10371411 Ga0157379_103714111 366
599 3300017792 Ga0163161_10156289 Ga0163161_101562892 366
600 3300025321 Ga0207656_10078409 Ga0207656_100784092 366
601 3300025901 Ga0207688_10000724 Ga0207688_1000072410 366
602 3300025904 Ga0207647_10046855 Ga0207647_100468552 366
603 3300025907 Ga0207645_10033024 Ga0207645_100330243 366
604 3300025908 Ga0207643_10002257 Ga0207643_1000225710 366
605 3300025915 Ga0207693_10109800 Ga0207693_101098002 366
606 3300025917 Ga0207660_10172850 Ga0207660_101728501 366
607 3300025918 Ga0207662_10003107 Ga0207662_100031077 366
608 3300025919 Ga0207657_10042779 Ga0207657_100427793 366
609 3300025925 Ga0207650_10084967 Ga0207650_100849673 366
610 3300025931 Ga0207644_10030185 Ga0207644_100301852 366
611 3300025933 Ga0207706_10002835 Ga0207706_1000283510 366
612 3300025935 Ga0207709_10233097 Ga0207709_102330972 366
613 3300025937 Ga0207669_10054654 Ga0207669_100546543 366
614 3300025938 Ga0207704_10020864 Ga0207704_100208642 366
615 3300025942 Ga0207689_10003705 Ga0207689_1000370515 366
616 3300025949 Ga0207667_10262833 Ga0207667_102628331 366
617 3300025960 Ga0207651_10055364 Ga0207651_100553643 366
618 3300025972 Ga0207668_10146522 Ga0207668_101465222 366
619 3300025981 Ga0207640_10255653 Ga0207640_102556531 366
620 3300026023 Ga0207677_10025117 Ga0207677_100251173 366
621 3300026041 Ga0207639_10063108 Ga0207639_100631083 366
622 3300026067 Ga0207678_10003070 Ga0207678_100030703 366
623 3300026075 Ga0207708_10000416 Ga0207708_1000041613 366
624 3300026118 Ga0207675_100001268 Ga0207675_10000126813 366
625 3300035170 Ga0373943_0083101 Ga0373943_0083101_447_1559 366
626 3300035695 Ga0373927_0056973 Ga0373927_0056973_972_2084 366
627 3300046461 Ga0495641_0041147 Ga0495641_0041147_517_1629 366
628 3300046473 Ga0495582_0020761 Ga0495582_0020761_348_1460 366
629 3300046475 Ga0495639_0029136 Ga0495639_0029136_1161_2273 366
630 3300046492 Ga0495585_0005858 Ga0495585_0005858_5588_6700 366
631 3300046537 Ga0495598_0006018 Ga0495598_0006018_490_1602 366
632 3300046558 Ga0495633_0085906 Ga0495633_0085906_260_1372 366
633 3300046674 Ga0495588_0031257 Ga0495588_0031257_1215_2408 366
634 3300046683 Ga0495658_0012702 Ga0495658_0012702_1354_2466 366
635 3300046689 Ga0495613_0042699 Ga0495613_0042699_1182_2294 366
636 3300046691 Ga0495670_0016822 Ga0495670_0016822_1184_2296 366
637 3300047321 Ga0495676_0069561 Ga0495676_0069561_1341_2453 366
638 3300048904 Ga0496101_0025063 Ga0496101_0025063_1687_2787 366
639 3300048905 Ga0496102_0267262 Ga0496102_0267262_81_1181 366
640 3300048906 Ga0496103_0002528 Ga0496103_0002528_6436_7536 366
641 3300048907 Ga0496104_0002098 Ga0496104_0002098_7430_8542 366
642 3300048908 Ga0496105_0014700 Ga0496105_0014700_4700_5800 366
643 3300048908 Ga0496105_0079136 Ga0496105_0079136_76_1188 366
644 3300048909 Ga0496106_0085154 Ga0496106_0085154_326_1426 366
645 3300048909 Ga0496106_0113498 Ga0496106_0113498_187_1299 366
646 3300048910 Ga0496107_0007064 Ga0496107_0007064_1696_2796 366
647 3300048911 Ga0496108_0006248 Ga0496108_0006248_3609_4709 366
648 3300048912 Ga0496109_0038535 Ga0496109_0038535_634_1737 366
649 3300048913 Ga0496110_0013491 Ga0496110_0013491_1488_2588 366
650 3300048914 Ga0496111_0023099 Ga0496111_0023099_90_1190 366
651 3300048915 Ga0496112_0028750 Ga0496112_0028750_3232_4332 366
652 3300048916 Ga0496113_0164925 Ga0496113_0164925_98_1198 366
653 3300048917 Ga0496114_0066028 Ga0496114_0066028_971_2071 366
654 3300050492 nmdc:mga0yw44_8401_c1 nmdc:mga0yw44_8401_c1_4013_5113 366
655 3300050492 nmdc:mga0yw44_8643_c1 nmdc:mga0yw44_8643_c1_1979_3079 366
656 3300050511 nmdc:mga08y16_66444_c1 nmdc:mga08y16_66444_c1_791_1891 366
657 3300050512 nmdc:mga0n895_53969_c1 nmdc:mga0n895_53969_c1_2117_3226 366
658 3300053085 Ga0495619_0178706 Ga0495619_0178706_85_1185 366

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13343

SBP_bac_6

Bacterial extracellular solute-binding protein

57

321

0.83

PF13416

SBP_bac_8

Bacterial extracellular solute-binding protein

24

315

0.82

PF01547

SBP_bac_1

Bacterial extracellular solute-binding protein

16

284

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
7oyt-assembly1.cif.gz_A e.coli's putrescine receptor variant potf/d (4jdf) with mutations e39d f88l in complex with spermidine 0.9804 26 365
7oyu-assembly1.cif.gz_A e.coli's putrescine receptor variant potf/d (4jdf) with mutations e39d y87s f88y in complex with spermidine 0.9785 26 365
7oys-assembly1.cif.gz_A e.coli's putrescine receptor variant potf/d (4jdf) with mutations e39d y87s in complex with spermidine 0.977 26 365
7oyz-assembly1.cif.gz_A e.coli's putrescine receptor variant potf/d in complex with spermidine 0.9763 26 365
7oyy-assembly1.cif.gz_A e.coli's putrescine receptor variant potf/d (4jdf) with mutation s247d in complex with spermidine 0.975 26 365
ID Description Score Start End Superfamily
af_P31133_32_136_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9876 29 132 3.40.190.10
3ttnB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9805 29 332 3.40.190.10
af_P31133_137_369_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9771 134 365 3.40.190.10
3ttnB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9745 29 332 3.40.190.10
af_P31133_32_136_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9692 29 132 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A5R2MU04-F1-model_v4 Spermidine/putrescine ABC transporter substrate-binding protein PotF 0.9975 161 256 GO:0015846
GO:0019808
GO:0042597
AF-A0A3B8TQX5-F1-model_v4 deleted 0.9962 157 268
AF-A0A3M4DHW7-F1-model_v4 deleted 0.9903 71 366
AF-A0A7Y2KZL3-F1-model_v4 Extracellular solute-binding protein 0.9889 176 366 GO:0015846
GO:0019808
GO:0042597
AF-A0A4Q6C456-F1-model_v4 Extracellular solute-binding protein 0.9879 74 366 GO:0015846
GO:0019808
GO:0042597

Feature Viewer

pLDDT pTM Quality
91.88 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map