F473162
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 658 | 398 | 607 | 366 |
Family's Representative Sequence
| Representative Sequence | 3300006852|Ga0075433_10012867|Ga0075433_100128678 |
| Length | 348 |
| Sequence | MRRTFALCVKRINFYNWSDYIEPNVLKDFTKETGVEVTYDTFDANEVLETKLLAGKSGYDVVVPTGYFLERQIKAGVFLKLDKAKLPNVVNLWPEITSRLATYDPGNQYAVNYMWGTTGIGYNVKKAREIFSGEQIESWDLVFNPEKLAKFKDCGVYMLDSSDDVFPAALNYLRLDPNSTDAADLQKAADVVTKVRPFVRKFHSSEYLNALASGEICLVLGWSGDIKQAQKRAAEAKGGVEIGYAIPNEGAQMFFDNLAIPKDAKNIEGAHALIDFLQRPDIAARNTNFIAYANGNLASQKFINKEILEDPAVYPDAATMQRLYTITARDQKTLRLANRLWTKVKTGK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 2 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 3 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 4 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 5 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 6 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 7 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 8 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 9 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 10 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 11 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 12 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 13 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 14 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 15 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 16 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 17 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 18 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 19 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 20 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 21 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 22 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 23 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 24 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 25 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 26 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 27 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 28 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 29 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 30 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 31 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 32 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 33 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 34 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 35 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 36 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 37 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 38 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 39 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 40 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 41 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 42 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 43 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 48 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 52 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 71 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 72 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 73 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 76 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 77 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 78 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 81 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 83 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 84 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 85 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 87 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 88 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 89 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 90 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 91 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 92 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 93 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 94 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 95 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 96 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 97 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 98 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 99 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 101 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 102 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 103 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 104 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 105 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 106 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 107 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 108 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 109 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 110 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 111 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 113 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 114 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 115 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 116 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 117 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 118 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 119 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 120 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 122 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 123 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 124 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 125 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 137 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 146 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 147 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 150 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 207 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 208 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 209 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 210 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 211 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 212 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 213 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 214 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 215 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 216 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 217 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 218 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 219 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 220 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 221 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 222 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 223 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 224 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 225 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 226 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 227 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 228 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 229 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 230 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 231 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 232 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 233 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 234 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 235 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 236 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 237 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 238 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 239 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 240 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 241 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 242 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 243 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 244 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 245 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 246 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 247 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 248 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 249 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 250 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 251 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 252 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 253 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 254 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 255 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 256 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 257 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 258 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 301 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 302 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 303 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 304 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 305 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 306 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 307 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 308 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 309 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 310 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 311 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 312 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 313 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 314 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 315 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 316 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 317 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 318 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 319 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 320 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 321 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 322 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 335 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 353 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 354 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 355 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 356 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 357 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 358 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 359 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 360 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 361 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 362 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 363 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 364 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 367 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 370 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 371 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 372 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 373 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 374 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 375 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 376 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 377 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 378 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 379 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 380 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 381 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 382 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 383 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 384 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 385 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 386 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 387 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 388 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 389 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 390 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 391 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 392 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 393 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 394 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 395 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 396 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 397 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 398 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.67 |
| Metatranscriptomes | 0 |
| Isolates | 7.33 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.66 |
| Nodule | 6.99 |
| Rhizoplane | 8.81 |
| Rhizosphere | 70.82 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.71 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24737J22298_10034618 | 3300001990 | Bacteria | 1565 |
| 2 | JGI24743J22301_10004622 | 3300001991 | Bacteria | 2254 |
| 3 | JGI24748J21848_1007608 | 3300002074 | Bacteria | 1271 |
| 4 | JGI24742J22300_10009931 | 3300002244 | Bacteria | 1573 |
| 5 | JGI25153J46596_10007386 | 3300003215 | Bacteria | 5415 |
| 6 | JGI25404J52841_10007721 | 3300003659 | Bacteria | 2280 |
| 7 | JGI25405J52794_10006081 | 3300003911 | Bacteria | 2199 |
| 8 | Ga0065704_10192549 | 3300005289 | Bacteria | 1183 |
| 9 | Ga0070676_10033115 | 3300005328 | Bacteria | 2964 |
| 10 | Ga0070676_10107173 | 3300005328 | Bacteria | 1735 |
| 11 | Ga0070683_100056178 | 3300005329 | Bacteria | 3655 |
| 12 | Ga0070670_100010787 | 3300005331 | Bacteria | 7805 |
| 13 | Ga0070677_10016853 | 3300005333 | Bacteria | 2607 |
| 14 | Ga0068869_100109077 | 3300005334 | Bacteria | 2103 |
| 15 | Ga0070666_10128599 | 3300005335 | Bacteria | 1759 |
| 16 | Ga0070680_100116879 | 3300005336 | Bacteria | 2224 |
| 17 | Ga0070682_100093095 | 3300005337 | Bacteria | 1976 |
| 18 | Ga0068868_100020698 | 3300005338 | Bacteria | 4948 |
| 19 | Ga0070687_100002547 | 3300005343 | Bacteria | 6872 |
| 20 | Ga0070668_100298091 | 3300005347 | Bacteria | 1351 |
| 21 | Ga0070669_100106151 | 3300005353 | Bacteria | 2126 |
| 22 | Ga0070669_100154645 | 3300005353 | Bacteria | 1777 |
| 23 | Ga0070675_100178375 | 3300005354 | Bacteria | 1835 |
| 24 | Ga0070675_100363510 | 3300005354 | Bacteria | 1285 |
| 25 | Ga0070671_100085919 | 3300005355 | Bacteria | 2632 |
| 26 | Ga0070671_100179998 | 3300005355 | Bacteria | 1789 |
| 27 | Ga0070674_100001777 | 3300005356 | Bacteria | 11690 |
| 28 | Ga0070673_100209338 | 3300005364 | Bacteria | 1683 |
| 29 | Ga0070667_100045667 | 3300005367 | Bacteria | 3684 |
| 30 | Ga0070709_10000751 | 3300005434 | Bacteria | 18320 |
| 31 | Ga0070709_10000765 | 3300005434 | Bacteria | 18049 |
| 32 | Ga0070714_100001123 | 3300005435 | Bacteria | 19235 |
| 33 | Ga0070714_100004348 | 3300005435 | Bacteria | 10679 |
| 34 | Ga0070714_100006896 | 3300005435 | Bacteria | 8807 |
| 35 | Ga0070714_100123026 | 3300005435 | Bacteria | 2310 |
| 36 | Ga0070713_100000647 | 3300005436 | Bacteria | 22255 |
| 37 | Ga0070713_100014010 | 3300005436 | Bacteria | 5937 |
| 38 | Ga0070713_100042866 | 3300005436 | Bacteria | 3696 |
| 39 | Ga0070713_100062420 | 3300005436 | Bacteria | 3121 |
| 40 | Ga0070713_100075566 | 3300005436 | Bacteria | 2858 |
| 41 | Ga0070713_100082398 | 3300005436 | Bacteria | 2747 |
| 42 | Ga0070710_10001077 | 3300005437 | Bacteria | 12915 |
| 43 | Ga0070710_10008883 | 3300005437 | Bacteria | 4904 |
| 44 | Ga0070701_10017803 | 3300005438 | Bacteria | 3328 |
| 45 | Ga0070711_100007383 | 3300005439 | Bacteria | 6686 |
| 46 | Ga0070711_100019807 | 3300005439 | Bacteria | 4324 |
| 47 | Ga0070711_100043214 | 3300005439 | Bacteria | 3051 |
| 48 | Ga0070705_100013205 | 3300005440 | Bacteria | 4219 |
| 49 | Ga0070663_100310843 | 3300005455 | Bacteria | 1264 |
| 50 | Ga0070678_100011686 | 3300005456 | Bacteria | 5428 |
| 51 | Ga0070662_100021718 | 3300005457 | Bacteria | 4386 |
| 52 | Ga0070662_100095066 | 3300005457 | Bacteria | 2245 |
| 53 | Ga0070681_10036942 | 3300005458 | Bacteria | 4902 |
| 54 | Ga0068867_100017477 | 3300005459 | Bacteria | 5094 |
| 55 | Ga0070685_10115417 | 3300005466 | Bacteria | 1660 |
| 56 | Ga0070698_100206373 | 3300005471 | Bacteria | 1900 |
| 57 | Ga0070699_100015158 | 3300005518 | Bacteria | 6621 |
| 58 | Ga0070679_100013382 | 3300005530 | Bacteria | 7856 |
| 59 | Ga0070684_100020410 | 3300005535 | Bacteria | 5498 |
| 60 | Ga0070684_100109785 | 3300005535 | Bacteria | 2472 |
| 61 | Ga0070684_100190645 | 3300005535 | Bacteria | 1865 |
| 62 | Ga0068853_100000785 | 3300005539 | Bacteria | 22086 |
| 63 | Ga0070672_100019246 | 3300005543 | Bacteria | 4952 |
| 64 | Ga0070704_100051208 | 3300005549 | Bacteria | 2907 |
| 65 | Ga0068855_100005618 | 3300005563 | Bacteria | 15299 |
| 66 | Ga0068855_100142736 | 3300005563 | Bacteria | 2728 |
| 67 | Ga0070664_100048685 | 3300005564 | Bacteria | 3582 |
| 68 | Ga0070664_100053036 | 3300005564 | Bacteria | 3436 |
| 69 | Ga0068857_100031091 | 3300005577 | Bacteria | 4718 |
| 70 | Ga0068854_100147310 | 3300005578 | Bacteria | 1812 |
| 71 | Ga0068856_100000020 | 3300005614 | Bacteria | 146775 |
| 72 | Ga0068856_100001874 | 3300005614 | Bacteria | 21950 |
| 73 | Ga0068856_100015688 | 3300005614 | Bacteria | 7326 |
| 74 | Ga0070702_100015321 | 3300005615 | Bacteria | 3913 |
| 75 | Ga0068852_100005253 | 3300005616 | Bacteria | 9240 |
| 76 | Ga0068852_100027093 | 3300005616 | Bacteria | 4666 |
| 77 | Ga0068852_100137450 | 3300005616 | Bacteria | 2257 |
| 78 | Ga0068859_100023016 | 3300005617 | Bacteria | 6248 |
| 79 | Ga0068866_10054684 | 3300005718 | Bacteria | 2046 |
| 80 | Ga0068866_10165602 | 3300005718 | Bacteria | 1293 |
| 81 | Ga0068861_100053725 | 3300005719 | Bacteria | 3066 |
| 82 | Ga0068851_10049434 | 3300005834 | Bacteria | 2133 |
| 83 | Ga0068863_100003267 | 3300005841 | Bacteria | 16008 |
| 84 | Ga0068858_100275069 | 3300005842 | Bacteria | 1603 |
| 85 | Ga0068860_100019769 | 3300005843 | Bacteria | 6530 |
| 86 | Ga0068862_100014292 | 3300005844 | Bacteria | 6585 |
| 87 | Ga0081455_10000807 | 3300005937 | Bacteria | 40308 |
| 88 | Ga0081455_10008702 | 3300005937 | Bacteria | 10511 |
| 89 | Ga0081455_10019562 | 3300005937 | Bacteria | 6402 |
| 90 | Ga0081455_10023171 | 3300005937 | Bacteria | 5782 |
| 91 | Ga0081455_10158288 | 3300005937 | Bacteria | 1739 |
| 92 | Ga0081538_10017231 | 3300005981 | Bacteria | 5495 |
| 93 | Ga0081538_10037618 | 3300005981 | Bacteria | 3135 |
| 94 | Ga0081540_1000011 | 3300005983 | Bacteria | 191880 |
| 95 | Ga0081540_1001420 | 3300005983 | Bacteria | 20722 |
| 96 | Ga0081540_1023400 | 3300005983 | Bacteria | 3614 |
| 97 | Ga0081540_1036625 | 3300005983 | Bacteria | 2613 |
| 98 | Ga0081540_1053208 | 3300005983 | Bacteria | 1987 |
| 99 | Ga0081539_10048315 | 3300005985 | Bacteria | 2421 |
| 100 | Ga0070717_10004417 | 3300006028 | Bacteria | 10151 |
| 101 | Ga0070717_10008045 | 3300006028 | Bacteria | 7860 |
| 102 | Ga0075365_10037236 | 3300006038 | Bacteria | 3157 |
| 103 | Ga0075365_10066735 | 3300006038 | Bacteria | 2414 |
| 104 | Ga0075365_10075457 | 3300006038 | Bacteria | 2275 |
| 105 | Ga0075368_10005443 | 3300006042 | Bacteria | 4374 |
| 106 | Ga0075368_10015438 | 3300006042 | Bacteria | 2834 |
| 107 | Ga0075363_100034975 | 3300006048 | Bacteria | 2625 |
| 108 | Ga0075363_100038357 | 3300006048 | Bacteria | 2519 |
| 109 | Ga0075364_10034307 | 3300006051 | Bacteria | 3272 |
| 110 | Ga0075364_10054123 | 3300006051 | Bacteria | 2624 |
| 111 | Ga0075364_10126354 | 3300006051 | Bacteria | 1714 |
| 112 | Ga0070715_10000111 | 3300006163 | Bacteria | 20025 |
| 113 | Ga0070715_10000890 | 3300006163 | Bacteria | 8288 |
| 114 | Ga0070716_100038166 | 3300006173 | Bacteria | 2658 |
| 115 | Ga0070716_100117402 | 3300006173 | Bacteria | 1660 |
| 116 | Ga0070712_100003177 | 3300006175 | Bacteria | 10123 |
| 117 | Ga0070712_100015060 | 3300006175 | Bacteria | 4972 |
| 118 | Ga0070712_100021375 | 3300006175 | Bacteria | 4251 |
| 119 | Ga0070712_100069240 | 3300006175 | Bacteria | 2517 |
| 120 | Ga0070712_100152838 | 3300006175 | Bacteria | 1774 |
| 121 | Ga0075362_10005001 | 3300006177 | Bacteria | 4811 |
| 122 | Ga0075362_10005605 | 3300006177 | Bacteria | 4608 |
| 123 | Ga0075362_10009446 | 3300006177 | Bacteria | 3773 |
| 124 | Ga0075367_10005992 | 3300006178 | Bacteria | 6107 |
| 125 | Ga0075369_10050535 | 3300006186 | Bacteria | 1798 |
| 126 | Ga0075366_10004770 | 3300006195 | Bacteria | 7312 |
| 127 | Ga0075366_10037649 | 3300006195 | Bacteria | 2856 |
| 128 | Ga0097621_100016628 | 3300006237 | Bacteria | 5566 |
| 129 | Ga0075370_10009560 | 3300006353 | Bacteria | 5039 |
| 130 | Ga0075370_10024424 | 3300006353 | Bacteria | 3338 |
| 131 | Ga0075428_100003918 | 3300006844 | Bacteria | 16351 |
| 132 | Ga0075428_100050043 | 3300006844 | Bacteria | 4583 |
| 133 | Ga0075430_100011920 | 3300006846 | Bacteria | 7401 |
| 134 | Ga0075430_100022067 | 3300006846 | Bacteria | 5411 |
| 135 | Ga0075431_100001468 | 3300006847 | Bacteria | 21760 |
| 136 | Ga0075431_100012459 | 3300006847 | Bacteria | 8583 |
| 137 | Ga0075431_100083948 | 3300006847 | Bacteria | 3288 |
| 138 | Ga0075431_100172727 | 3300006847 | Bacteria | 2220 |
| 139 | Ga0075431_100273929 | 3300006847 | Bacteria | 1710 |
| 140 | Ga0075433_10012867 | 3300006852 | Bacteria | 6779 |
| 141 | Ga0075434_100039954 | 3300006871 | Bacteria | 4647 |
| 142 | Ga0075434_100148985 | 3300006871 | Bacteria | 2360 |
| 143 | Ga0075434_100225934 | 3300006871 | Bacteria | 1892 |
| 144 | Ga0075429_100007126 | 3300006880 | Bacteria | 9711 |
| 145 | Ga0075429_100175772 | 3300006880 | Bacteria | 1876 |
| 146 | Ga0068865_100005250 | 3300006881 | Bacteria | 7831 |
| 147 | Ga0097620_100023015 | 3300006931 | Bacteria | 6248 |
| 148 | Ga0099825_1024808 | 3300006941 | Bacteria | 3440 |
| 149 | Ga0099824_1005874 | 3300006942 | Bacteria | 17135 |
| 150 | Ga0099822_1001130 | 3300006943 | Bacteria | 29740 |
| 151 | Ga0099795_10013458 | 3300007788 | Bacteria | 2512 |
| 152 | Ga0105240_10010915 | 3300009093 | Bacteria | 12729 |
| 153 | Ga0105240_10020186 | 3300009093 | Bacteria | 8895 |
| 154 | Ga0111539_10003134 | 3300009094 | Bacteria | 21872 |
| 155 | Ga0105245_10040069 | 3300009098 | Bacteria | 4171 |
| 156 | Ga0105245_10049793 | 3300009098 | Bacteria | 3753 |
| 157 | Ga0105247_10019792 | 3300009101 | Bacteria | 4042 |
| 158 | Ga0114129_10009260 | 3300009147 | Bacteria | 14044 |
| 159 | Ga0114129_10011780 | 3300009147 | Bacteria | 12443 |
| 160 | Ga0114129_10016386 | 3300009147 | Bacteria | 10548 |
| 161 | Ga0114129_10021519 | 3300009147 | Bacteria | 9154 |
| 162 | Ga0114129_10039984 | 3300009147 | Bacteria | 6615 |
| 163 | Ga0114129_10138611 | 3300009147 | Bacteria | 3337 |
| 164 | Ga0114129_10570665 | 3300009147 | Bacteria | 1469 |
| 165 | Ga0105243_10118748 | 3300009148 | Bacteria | 2226 |
| 166 | Ga0105243_10268119 | 3300009148 | Bacteria | 1532 |
| 167 | Ga0105241_10017590 | 3300009174 | Bacteria | 5256 |
| 168 | Ga0105248_10053872 | 3300009177 | Bacteria | 4512 |
| 169 | Ga0105237_10228790 | 3300009545 | Bacteria | 1860 |
| 170 | Ga0105238_10011980 | 3300009551 | Bacteria | 8735 |
| 171 | Ga0105238_10018757 | 3300009551 | Bacteria | 7045 |
| 172 | Ga0105249_10226414 | 3300009553 | Bacteria | 1842 |
| 173 | Ga0099796_10016410 | 3300010159 | Bacteria | 2186 |
| 174 | Ga0105239_10014407 | 3300010375 | Bacteria | 8774 |
| 175 | Ga0105239_10014647 | 3300010375 | Bacteria | 8695 |
| 176 | Ga0105239_10091963 | 3300010375 | Bacteria | 3348 |
| 177 | Ga0105239_10169078 | 3300010375 | Bacteria | 2444 |
| 178 | Ga0105239_10514623 | 3300010375 | Bacteria | 1361 |
| 179 | Ga0157370_10065826 | 3300013104 | Bacteria | 3428 |
| 180 | Ga0157378_10212140 | 3300013297 | Bacteria | 1836 |
| 181 | Ga0157378_10222994 | 3300013297 | Bacteria | 1793 |
| 182 | Ga0157378_10392599 | 3300013297 | Bacteria | 1365 |
| 183 | Ga0163162_10379892 | 3300013306 | Bacteria | 1546 |
| 184 | Ga0163162_10477391 | 3300013306 | Bacteria | 1378 |
| 185 | Ga0163163_10000985 | 3300014325 | Bacteria | 24137 |
| 186 | Ga0163163_10013111 | 3300014325 | Bacteria | 7573 |
| 187 | Ga0163163_10258228 | 3300014325 | Bacteria | 1793 |
| 188 | Ga0157377_10030766 | 3300014745 | Bacteria | 2911 |
| 189 | Ga0157379_10371411 | 3300014968 | Bacteria | 1311 |
| 190 | Ga0163161_10156289 | 3300017792 | Bacteria | 1736 |
| 191 | Ga0213872_10052472 | 3300021361 | Bacteria | 1850 |
| 192 | Ga0213876_10004192 | 3300021384 | Bacteria | 8083 |
| 193 | Ga0213876_10013161 | 3300021384 | Bacteria | 4396 |
| 194 | Ga0209677_105615 | 3300025253 | Bacteria | 3221 |
| 195 | Ga0209233_1018718 | 3300025261 | Bacteria | 1857 |
| 196 | Ga0209564_1001241 | 3300025295 | Bacteria | 28590 |
| 197 | Ga0209758_1003309 | 3300025297 | Bacteria | 14898 |
| 198 | Ga0209758_1005630 | 3300025297 | Bacteria | 9509 |
| 199 | Ga0209758_1053463 | 3300025297 | Bacteria | 1387 |
| 200 | Ga0207656_10078409 | 3300025321 | Bacteria | 1480 |
| 201 | Ga0207653_10006516 | 3300025885 | Bacteria | 3645 |
| 202 | Ga0207682_10000451 | 3300025893 | Bacteria | 18904 |
| 203 | Ga0207692_10001501 | 3300025898 | Bacteria | 8767 |
| 204 | Ga0207692_10002579 | 3300025898 | Bacteria | 6963 |
| 205 | Ga0207710_10010206 | 3300025900 | Bacteria | 3951 |
| 206 | Ga0207710_10049074 | 3300025900 | Bacteria | 1890 |
| 207 | Ga0207710_10087641 | 3300025900 | Bacteria | 1452 |
| 208 | Ga0207688_10000724 | 3300025901 | Bacteria | 16358 |
| 209 | Ga0207688_10017933 | 3300025901 | Bacteria | 3852 |
| 210 | Ga0207647_10046855 | 3300025904 | Bacteria | 2691 |
| 211 | Ga0207685_10002531 | 3300025905 | Bacteria | 4212 |
| 212 | Ga0207699_10015388 | 3300025906 | Bacteria | 3971 |
| 213 | Ga0207699_10027898 | 3300025906 | Bacteria | 3132 |
| 214 | Ga0207645_10033024 | 3300025907 | Bacteria | 3327 |
| 215 | Ga0207645_10074418 | 3300025907 | Bacteria | 2174 |
| 216 | Ga0207643_10002257 | 3300025908 | Bacteria | 10508 |
| 217 | Ga0207643_10053870 | 3300025908 | Bacteria | 2285 |
| 218 | Ga0207684_10028032 | 3300025910 | Bacteria | 4797 |
| 219 | Ga0207654_10000232 | 3300025911 | Bacteria | 34089 |
| 220 | Ga0207654_10052549 | 3300025911 | Bacteria | 2349 |
| 221 | Ga0207654_10062518 | 3300025911 | Bacteria | 2182 |
| 222 | Ga0207707_10000950 | 3300025912 | Bacteria | 27902 |
| 223 | Ga0207695_10000008 | 3300025913 | Bacteria | 1058268 |
| 224 | Ga0207695_10001547 | 3300025913 | Bacteria | 37828 |
| 225 | Ga0207671_10008090 | 3300025914 | Bacteria | 8979 |
| 226 | Ga0207671_10087332 | 3300025914 | Bacteria | 2345 |
| 227 | Ga0207671_10100175 | 3300025914 | Bacteria | 2194 |
| 228 | Ga0207693_10001966 | 3300025915 | Bacteria | 18015 |
| 229 | Ga0207693_10004043 | 3300025915 | Bacteria | 12466 |
| 230 | Ga0207693_10063793 | 3300025915 | Bacteria | 2886 |
| 231 | Ga0207693_10109800 | 3300025915 | Bacteria | 2163 |
| 232 | Ga0207663_10000098 | 3300025916 | Bacteria | 41171 |
| 233 | Ga0207660_10172850 | 3300025917 | Bacteria | 1673 |
| 234 | Ga0207662_10003107 | 3300025918 | Bacteria | 8472 |
| 235 | Ga0207657_10042779 | 3300025919 | Bacteria | 3994 |
| 236 | Ga0207652_10043416 | 3300025921 | Bacteria | 3828 |
| 237 | Ga0207681_10163533 | 3300025923 | Bacteria | 1680 |
| 238 | Ga0207694_10000050 | 3300025924 | Bacteria | 159920 |
| 239 | Ga0207694_10041876 | 3300025924 | Bacteria | 3531 |
| 240 | Ga0207650_10060436 | 3300025925 | Bacteria | 2828 |
| 241 | Ga0207650_10084967 | 3300025925 | Bacteria | 2406 |
| 242 | Ga0207659_10239086 | 3300025926 | Bacteria | 1468 |
| 243 | Ga0207700_10098400 | 3300025928 | Bacteria | 2327 |
| 244 | Ga0207700_10226283 | 3300025928 | Bacteria | 1588 |
| 245 | Ga0207664_10069359 | 3300025929 | Bacteria | 2834 |
| 246 | Ga0207664_10121402 | 3300025929 | Bacteria | 2187 |
| 247 | Ga0207664_10137916 | 3300025929 | Bacteria | 2060 |
| 248 | Ga0207644_10030185 | 3300025931 | Bacteria | 3767 |
| 249 | Ga0207706_10002835 | 3300025933 | Bacteria | 16817 |
| 250 | Ga0207706_10099788 | 3300025933 | Bacteria | 2554 |
| 251 | Ga0207709_10233097 | 3300025935 | Bacteria | 1335 |
| 252 | Ga0207669_10054654 | 3300025937 | Bacteria | 2413 |
| 253 | Ga0207704_10020864 | 3300025938 | Bacteria | 3476 |
| 254 | Ga0207704_10271407 | 3300025938 | Bacteria | 1284 |
| 255 | Ga0207665_10000204 | 3300025939 | Bacteria | 39853 |
| 256 | Ga0207665_10000355 | 3300025939 | Bacteria | 31763 |
| 257 | Ga0207691_10001066 | 3300025940 | Bacteria | 27265 |
| 258 | Ga0207691_10096903 | 3300025940 | Bacteria | 2637 |
| 259 | Ga0207711_10209674 | 3300025941 | Bacteria | 1780 |
| 260 | Ga0207689_10003705 | 3300025942 | Bacteria | 13938 |
| 261 | Ga0207689_10031017 | 3300025942 | Bacteria | 4453 |
| 262 | Ga0207689_10107194 | 3300025942 | Bacteria | 2296 |
| 263 | Ga0207661_10000349 | 3300025944 | Bacteria | 29687 |
| 264 | Ga0207679_10019748 | 3300025945 | Bacteria | 4535 |
| 265 | Ga0207667_10032035 | 3300025949 | Bacteria | 5667 |
| 266 | Ga0207667_10262833 | 3300025949 | Bacteria | 1765 |
| 267 | Ga0207667_10434751 | 3300025949 | Bacteria | 1334 |
| 268 | Ga0207651_10055364 | 3300025960 | Bacteria | 2724 |
| 269 | Ga0207651_10067481 | 3300025960 | Bacteria | 2518 |
| 270 | Ga0207651_10226622 | 3300025960 | Bacteria | 1514 |
| 271 | Ga0207712_10264549 | 3300025961 | Bacteria | 1396 |
| 272 | Ga0207668_10146522 | 3300025972 | Bacteria | 1822 |
| 273 | Ga0207640_10055190 | 3300025981 | Bacteria | 2601 |
| 274 | Ga0207640_10255653 | 3300025981 | Bacteria | 1362 |
| 275 | Ga0207677_10025117 | 3300026023 | Bacteria | 3712 |
| 276 | Ga0207703_10263121 | 3300026035 | Bacteria | 1560 |
| 277 | Ga0207639_10063108 | 3300026041 | Bacteria | 2867 |
| 278 | Ga0207678_10003070 | 3300026067 | Bacteria | 15096 |
| 279 | Ga0207678_10015480 | 3300026067 | Bacteria | 6704 |
| 280 | Ga0207708_10000416 | 3300026075 | Bacteria | 33357 |
| 281 | Ga0207702_10000002 | 3300026078 | Bacteria | 491507 |
| 282 | Ga0207702_10000126 | 3300026078 | Bacteria | 90550 |
| 283 | Ga0207648_10023754 | 3300026089 | Bacteria | 5484 |
| 284 | Ga0207674_10032345 | 3300026116 | Bacteria | 5488 |
| 285 | Ga0207675_100001268 | 3300026118 | Bacteria | 25252 |
| 286 | Ga0207675_100364668 | 3300026118 | Bacteria | 1418 |
| 287 | Ga0207683_10000733 | 3300026121 | Bacteria | 29828 |
| 288 | Ga0207698_10307556 | 3300026142 | Bacteria | 1478 |
| 289 | Ga0209589_1000001 | 3300027357 | Bacteria | 794224 |
| 290 | Ga0209489_100001 | 3300027361 | Bacteria | 794224 |
| 291 | Ga0209700_100001 | 3300027363 | Bacteria | 794224 |
| 292 | Ga0207428_10004211 | 3300027907 | Bacteria | 13773 |
| 293 | Ga0265337_1002468 | 3300028556 | Bacteria | 8449 |
| 294 | Ga0265319_1009070 | 3300028563 | Bacteria | 4286 |
| 295 | Ga0265334_10000456 | 3300028573 | Bacteria | 21294 |
| 296 | Ga0265318_10015114 | 3300028577 | Bacteria | 3221 |
| 297 | Ga0265323_10000424 | 3300028653 | Bacteria | 24236 |
| 298 | Ga0265322_10034843 | 3300028654 | Bacteria | 1434 |
| 299 | Ga0265336_10000431 | 3300028666 | Bacteria | 25844 |
| 300 | Ga0307517_10000008 | 3300028786 | Bacteria | 243202 |
| 301 | Ga0265338_10000321 | 3300028800 | Bacteria | 87046 |
| 302 | Ga0265324_10005870 | 3300029957 | Bacteria | 5218 |
| 303 | Ga0265330_10039647 | 3300031235 | Bacteria | 2093 |
| 304 | Ga0265332_10002663 | 3300031238 | Bacteria | 8959 |
| 305 | Ga0265320_10067525 | 3300031240 | Bacteria | 1691 |
| 306 | Ga0265325_10038114 | 3300031241 | Bacteria | 2538 |
| 307 | Ga0265339_10014916 | 3300031249 | Bacteria | 4672 |
| 308 | Ga0265331_10019579 | 3300031250 | Bacteria | 3493 |
| 309 | Ga0265316_10117758 | 3300031344 | Bacteria | 2008 |
| 310 | Ga0265313_10009487 | 3300031595 | Bacteria | 6314 |
| 311 | Ga0265314_10043127 | 3300031711 | Bacteria | 3210 |
| 312 | Ga0265342_10000210 | 3300031712 | Bacteria | 65961 |
| 313 | Ga0265342_10007904 | 3300031712 | Bacteria | 7711 |
| 314 | Ga0265342_10049675 | 3300031712 | Bacteria | 2509 |
| 315 | Ga0307510_10019107 | 3300033180 | Bacteria | 8039 |
| 316 | Ga0307510_10087045 | 3300033180 | Bacteria | 2993 |
| 317 | Ga0315911_1000006 | 3300033442 | Bacteria | 414563 |
| 318 | Ga0373926_0027317 | 3300035083 | Bacteria | 1999 |
| 319 | Ga0373936_0034336 | 3300035113 | Bacteria | 2014 |
| 320 | Ga0373957_0009374 | 3300035120 | Bacteria | 3203 |
| 321 | Ga0373943_0037581 | 3300035170 | Bacteria | 2324 |
| 322 | Ga0373943_0078006 | 3300035170 | Bacteria | 1693 |
| 323 | Ga0373943_0083101 | 3300035170 | Bacteria | 1645 |
| 324 | Ga0373946_0016456 | 3300035171 | Bacteria | 2818 |
| 325 | Ga0373946_0021549 | 3300035171 | Bacteria | 2500 |
| 326 | Ga0373924_0003483 | 3300035410 | Bacteria | 5419 |
| 327 | Ga0373931_0071835 | 3300035691 | Bacteria | 1891 |
| 328 | Ga0373935_0070498 | 3300035692 | Bacteria | 2253 |
| 329 | Ga0373927_0056973 | 3300035695 | Bacteria | 2527 |
| 330 | Ga0373927_0105322 | 3300035695 | Bacteria | 1836 |
| 331 | Ga0373933_0061486 | 3300035724 | Bacteria | 2266 |
| 332 | Ga0373933_0105181 | 3300035724 | Bacteria | 1755 |
| 333 | Ga0373947_0079108 | 3300035725 | Bacteria | 2031 |
| 334 | Ga0373937_0026472 | 3300036401 | Bacteria | 5242 |
| 335 | Ga0373925_0033765 | 3300037068 | Bacteria | 3770 |
| 336 | Ga0373925_0044060 | 3300037068 | Bacteria | 3313 |
| 337 | Ga0395900_0032586 | 3300037418 | Bacteria | 5359 |
| 338 | Ga0395900_0064143 | 3300037418 | Bacteria | 3776 |
| 339 | Ga0395898_0057370 | 3300037466 | Bacteria | 3795 |
| 340 | Ga0395898_0073526 | 3300037466 | Bacteria | 3302 |
| 341 | Ga0395898_0102868 | 3300037466 | Bacteria | 2741 |
| 342 | Ga0436364_1477382 | 3300037853 | Bacteria | 1651 |
| 343 | Ga0395901_0006650 | 3300038443 | Bacteria | 11683 |
| 344 | Ga0395901_0167889 | 3300038443 | Bacteria | 2303 |
| 345 | Ga0395901_0291362 | 3300038443 | Bacteria | 1694 |
| 346 | Ga0436365_0139392 | 3300039437 | Bacteria | 5701 |
| 347 | Ga0436365_1822185 | 3300039437 | Bacteria | 1684 |
| 348 | Ga0436365_1840276 | 3300039437 | Bacteria | 14090 |
| 349 | Ga0436361_0003682 | 3300039447 | Bacteria | 24999 |
| 350 | Ga0436363_0602269 | 3300039450 | Bacteria | 5606 |
| 351 | Ga0436362_1129034 | 3300039453 | Bacteria | 7760 |
| 352 | Ga0466966_0000334 | 3300044684 | Bacteria | 30532 |
| 353 | Ga0466961_0000509 | 3300044693 | Bacteria | 24794 |
| 354 | Ga0466963_0249073 | 3300044694 | Bacteria | 1247 |
| 355 | Ga0466959_0113858 | 3300045049 | Bacteria | 1928 |
| 356 | Ga0466967_0368085 | 3300045976 | Bacteria | 1394 |
| 357 | Ga0495603_0004733 | 3300046455 | Bacteria | 8130 |
| 358 | Ga0495603_0115785 | 3300046455 | Bacteria | 1563 |
| 359 | Ga0495629_0028160 | 3300046459 | Bacteria | 3989 |
| 360 | Ga0495629_0149967 | 3300046459 | Bacteria | 1621 |
| 361 | Ga0495638_0063674 | 3300046460 | Bacteria | 2273 |
| 362 | Ga0495641_0041147 | 3300046461 | Bacteria | 2147 |
| 363 | Ga0495651_0001733 | 3300046462 | Bacteria | 16846 |
| 364 | Ga0495582_0020761 | 3300046473 | Bacteria | 3597 |
| 365 | Ga0495582_0072596 | 3300046473 | Bacteria | 1905 |
| 366 | Ga0495605_0042617 | 3300046474 | Bacteria | 2255 |
| 367 | Ga0495639_0029136 | 3300046475 | Bacteria | 2450 |
| 368 | Ga0495639_0051376 | 3300046475 | Bacteria | 1874 |
| 369 | Ga0495662_0067536 | 3300046476 | Bacteria | 1730 |
| 370 | Ga0495664_0001939 | 3300046477 | Bacteria | 11029 |
| 371 | Ga0495664_0026626 | 3300046477 | Bacteria | 3368 |
| 372 | Ga0495585_0005858 | 3300046492 | Bacteria | 7703 |
| 373 | Ga0495594_0088940 | 3300046499 | Bacteria | 1729 |
| 374 | Ga0495608_0005911 | 3300046511 | Bacteria | 8704 |
| 375 | Ga0495616_0100779 | 3300046513 | Bacteria | 1355 |
| 376 | Ga0495618_0011828 | 3300046514 | Bacteria | 5296 |
| 377 | Ga0495628_0028739 | 3300046516 | Bacteria | 4515 |
| 378 | Ga0495628_0063069 | 3300046516 | Bacteria | 2904 |
| 379 | Ga0495630_0025233 | 3300046517 | Bacteria | 4394 |
| 380 | Ga0495630_0064928 | 3300046517 | Bacteria | 2743 |
| 381 | Ga0495630_0093563 | 3300046517 | Bacteria | 2272 |
| 382 | Ga0495652_0023334 | 3300046529 | Bacteria | 5484 |
| 383 | Ga0495652_0047738 | 3300046529 | Bacteria | 3671 |
| 384 | Ga0495665_0019583 | 3300046531 | Bacteria | 3640 |
| 385 | Ga0495640_0098441 | 3300046533 | Bacteria | 1922 |
| 386 | Ga0495640_0116833 | 3300046533 | Bacteria | 1737 |
| 387 | Ga0495587_0008847 | 3300046536 | Bacteria | 6463 |
| 388 | Ga0495598_0006018 | 3300046537 | Bacteria | 2719 |
| 389 | Ga0495645_0034948 | 3300046543 | Bacteria | 3664 |
| 390 | Ga0495633_0085906 | 3300046558 | Bacteria | 1463 |
| 391 | Ga0495667_0003089 | 3300046559 | Bacteria | 11169 |
| 392 | Ga0495634_0043804 | 3300046642 | Bacteria | 3032 |
| 393 | Ga0495634_0126719 | 3300046642 | Bacteria | 1631 |
| 394 | Ga0495634_0195751 | 3300046642 | Bacteria | 1258 |
| 395 | Ga0495635_0167153 | 3300046663 | Bacteria | 1496 |
| 396 | Ga0495588_0031257 | 3300046674 | Bacteria | 2679 |
| 397 | Ga0495657_0007669 | 3300046675 | Bacteria | 8308 |
| 398 | Ga0495599_0006216 | 3300046678 | Bacteria | 7197 |
| 399 | Ga0495623_0006875 | 3300046679 | Bacteria | 7400 |
| 400 | Ga0495658_0012702 | 3300046683 | Bacteria | 4273 |
| 401 | Ga0495658_0096637 | 3300046683 | Bacteria | 1757 |
| 402 | Ga0495613_0042699 | 3300046689 | Bacteria | 3355 |
| 403 | Ga0495613_0115649 | 3300046689 | Bacteria | 1930 |
| 404 | Ga0495613_0122659 | 3300046689 | Bacteria | 1865 |
| 405 | Ga0495670_0016822 | 3300046691 | Bacteria | 3596 |
| 406 | Ga0495600_0007437 | 3300046809 | Bacteria | 6703 |
| 407 | Ga0495600_0008276 | 3300046809 | Bacteria | 6384 |
| 408 | Ga0495581_0048953 | 3300047315 | Bacteria | 2440 |
| 409 | Ga0495604_0007727 | 3300047317 | Bacteria | 8516 |
| 410 | Ga0495674_0006216 | 3300047319 | Bacteria | 11455 |
| 411 | Ga0495672_0007644 | 3300047320 | Bacteria | 8109 |
| 412 | Ga0495676_0069561 | 3300047321 | Bacteria | 2715 |
| 413 | Ga0495675_0022639 | 3300047444 | Bacteria | 4007 |
| 414 | Ga0495675_0034458 | 3300047444 | Bacteria | 3232 |
| 415 | Ga0495602_0009411 | 3300048088 | Bacteria | 10165 |
| 416 | Ga0496100_0105166 | 3300048903 | Bacteria | 1951 |
| 417 | Ga0496101_0025063 | 3300048904 | Bacteria | 4134 |
| 418 | Ga0496102_0012241 | 3300048905 | Bacteria | 7420 |
| 419 | Ga0496102_0074594 | 3300048905 | Bacteria | 3118 |
| 420 | Ga0496102_0103808 | 3300048905 | Bacteria | 2644 |
| 421 | Ga0496102_0267262 | 3300048905 | Bacteria | 1612 |
| 422 | Ga0496103_0002528 | 3300048906 | Bacteria | 11461 |
| 423 | Ga0496103_0037576 | 3300048906 | Bacteria | 2968 |
| 424 | Ga0496104_0000575 | 3300048907 | Bacteria | 31363 |
| 425 | Ga0496104_0001976 | 3300048907 | Bacteria | 17754 |
| 426 | Ga0496104_0002098 | 3300048907 | Bacteria | 17313 |
| 427 | Ga0496104_0004574 | 3300048907 | Bacteria | 12056 |
| 428 | Ga0496104_0009294 | 3300048907 | Bacteria | 8742 |
| 429 | Ga0496104_0061521 | 3300048907 | Bacteria | 3560 |
| 430 | Ga0496105_0005756 | 3300048908 | Bacteria | 9445 |
| 431 | Ga0496105_0014700 | 3300048908 | Bacteria | 6231 |
| 432 | Ga0496105_0052505 | 3300048908 | Bacteria | 3367 |
| 433 | Ga0496105_0061924 | 3300048908 | Bacteria | 3088 |
| 434 | Ga0496105_0079136 | 3300048908 | Bacteria | 2715 |
| 435 | Ga0496106_0001378 | 3300048909 | Bacteria | 18213 |
| 436 | Ga0496106_0029780 | 3300048909 | Bacteria | 4070 |
| 437 | Ga0496106_0078914 | 3300048909 | Bacteria | 2527 |
| 438 | Ga0496106_0085154 | 3300048909 | Bacteria | 2433 |
| 439 | Ga0496106_0113498 | 3300048909 | Bacteria | 2112 |
| 440 | Ga0496107_0007064 | 3300048910 | Bacteria | 7734 |
| 441 | Ga0496107_0033908 | 3300048910 | Bacteria | 3654 |
| 442 | Ga0496107_0232810 | 3300048910 | Bacteria | 1371 |
| 443 | Ga0496108_0000501 | 3300048911 | Bacteria | 30958 |
| 444 | Ga0496108_0006248 | 3300048911 | Bacteria | 9647 |
| 445 | Ga0496108_0016034 | 3300048911 | Bacteria | 6109 |
| 446 | Ga0496109_0001015 | 3300048912 | Bacteria | 23173 |
| 447 | Ga0496109_0006607 | 3300048912 | Bacteria | 9766 |
| 448 | Ga0496109_0038535 | 3300048912 | Bacteria | 4322 |
| 449 | Ga0496109_0039798 | 3300048912 | Bacteria | 4256 |
| 450 | Ga0496110_0006375 | 3300048913 | Bacteria | 9329 |
| 451 | Ga0496110_0013491 | 3300048913 | Bacteria | 6758 |
| 452 | Ga0496110_0163361 | 3300048913 | Bacteria | 2019 |
| 453 | Ga0496110_0240001 | 3300048913 | Bacteria | 1649 |
| 454 | Ga0496111_0023099 | 3300048914 | Bacteria | 4362 |
| 455 | Ga0496111_0072818 | 3300048914 | Bacteria | 2501 |
| 456 | Ga0496111_0073294 | 3300048914 | Bacteria | 2493 |
| 457 | Ga0496111_0293623 | 3300048914 | Bacteria | 1205 |
| 458 | Ga0496111_0303801 | 3300048914 | Bacteria | 1183 |
| 459 | Ga0496112_0001095 | 3300048915 | Bacteria | 20053 |
| 460 | Ga0496112_0010513 | 3300048915 | Bacteria | 8399 |
| 461 | Ga0496112_0028750 | 3300048915 | Bacteria | 5369 |
| 462 | Ga0496112_0112207 | 3300048915 | Bacteria | 2696 |
| 463 | Ga0496112_0182993 | 3300048915 | Bacteria | 2059 |
| 464 | Ga0496113_0016119 | 3300048916 | Bacteria | 5157 |
| 465 | Ga0496113_0028731 | 3300048916 | Bacteria | 4004 |
| 466 | Ga0496113_0164925 | 3300048916 | Bacteria | 1752 |
| 467 | Ga0496114_0066028 | 3300048917 | Bacteria | 3032 |
| 468 | Ga0496114_0204106 | 3300048917 | Bacteria | 1732 |
| 469 | Ga0496115_0040104 | 3300048918 | Bacteria | 3721 |
| 470 | Ga0496115_0052630 | 3300048918 | Bacteria | 3267 |
| 471 | Ga0496115_0137366 | 3300048918 | Bacteria | 2016 |
| 472 | Ga0496115_0278383 | 3300048918 | Bacteria | 1374 |
| 473 | Ga0496120_0055950 | 3300048923 | Bacteria | 2229 |
| 474 | Ga0496121_0002279 | 3300048924 | Bacteria | 29850 |
| 475 | Ga0496121_0045710 | 3300048924 | Bacteria | 3759 |
| 476 | Ga0496121_0159730 | 3300048924 | Bacteria | 1650 |
| 477 | Ga0496123_0021676 | 3300048926 | Bacteria | 4984 |
| 478 | Ga0496124_0033059 | 3300048927 | Bacteria | 4555 |
| 479 | Ga0496125_0000060 | 3300048928 | Bacteria | 264143 |
| 480 | Ga0496125_0091464 | 3300048928 | Bacteria | 2279 |
| 481 | Ga0496126_0004957 | 3300048929 | Bacteria | 15524 |
| 482 | Ga0496126_0008467 | 3300048929 | Bacteria | 11092 |
| 483 | Ga0496126_0013579 | 3300048929 | Bacteria | 8270 |
| 484 | Ga0501031_0000268 | 3300049568 | Bacteria | 29430 |
| 485 | Ga0501031_0171178 | 3300049568 | Bacteria | 1419 |
| 486 | Ga0501032_0000765 | 3300049569 | Bacteria | 26091 |
| 487 | Ga0501032_0012456 | 3300049569 | Bacteria | 6076 |
| 488 | Ga0501032_0036807 | 3300049569 | Bacteria | 3339 |
| 489 | Ga0501033_0000282 | 3300049570 | Bacteria | 48910 |
| 490 | Ga0501033_0000344 | 3300049570 | Bacteria | 44238 |
| 491 | Ga0501033_0040568 | 3300049570 | Bacteria | 3474 |
| 492 | Ga0501034_0000100 | 3300049571 | Bacteria | 159536 |
| 493 | Ga0501034_0330070 | 3300049571 | Bacteria | 1457 |
| 494 | Ga0501036_0000228 | 3300049572 | Bacteria | 37800 |
| 495 | Ga0501036_0123100 | 3300049572 | Bacteria | 2190 |
| 496 | Ga0501036_0184752 | 3300049572 | Bacteria | 1754 |
| 497 | Ga0501037_0000704 | 3300049573 | Bacteria | 25447 |
| 498 | Ga0501037_0001227 | 3300049573 | Bacteria | 18929 |
| 499 | Ga0501037_0041315 | 3300049573 | Bacteria | 3391 |
| 500 | Ga0501037_0064152 | 3300049573 | Bacteria | 2677 |
| 501 | Ga0501038_0000350 | 3300049574 | Bacteria | 39547 |
| 502 | Ga0501038_0006039 | 3300049574 | Bacteria | 11212 |
| 503 | Ga0501039_0003428 | 3300049575 | Bacteria | 11836 |
| 504 | Ga0501039_0112299 | 3300049575 | Bacteria | 2130 |
| 505 | Ga0501040_0022745 | 3300049576 | Bacteria | 4199 |
| 506 | Ga0501043_0000106 | 3300049579 | Bacteria | 77699 |
| 507 | Ga0501043_0017698 | 3300049579 | Bacteria | 5588 |
| 508 | Ga0501043_0019319 | 3300049579 | Bacteria | 5349 |
| 509 | Ga0501043_0072182 | 3300049579 | Bacteria | 2711 |
| 510 | Ga0501043_0263165 | 3300049579 | Bacteria | 1326 |
| 511 | Ga0501046_0000426 | 3300049580 | Bacteria | 42186 |
| 512 | Ga0501047_0000493 | 3300049581 | Bacteria | 42827 |
| 513 | Ga0501047_0065589 | 3300049581 | Bacteria | 3500 |
| 514 | Ga0501047_0081958 | 3300049581 | Bacteria | 3101 |
| 515 | Ga0501047_0155514 | 3300049581 | Bacteria | 2160 |
| 516 | Ga0501048_0000233 | 3300049582 | Bacteria | 36758 |
| 517 | Ga0501048_0030608 | 3300049582 | Bacteria | 3893 |
| 518 | Ga0501067_0000384 | 3300049583 | Bacteria | 24036 |
| 519 | Ga0501067_0034761 | 3300049583 | Bacteria | 2797 |
| 520 | Ga0501068_0005924 | 3300049584 | Bacteria | 6711 |
| 521 | Ga0501068_0114452 | 3300049584 | Bacteria | 1679 |
| 522 | Ga0501069_0130537 | 3300049585 | Bacteria | 1438 |
| 523 | Ga0501070_0001419 | 3300049586 | Bacteria | 21462 |
| 524 | Ga0501070_0180419 | 3300049586 | Bacteria | 1738 |
| 525 | Ga0501071_0083386 | 3300049587 | Bacteria | 2342 |
| 526 | Ga0501072_0004603 | 3300049588 | Bacteria | 10502 |
| 527 | Ga0501073_0006215 | 3300049589 | Bacteria | 8912 |
| 528 | Ga0501073_0028392 | 3300049589 | Bacteria | 3998 |
| 529 | Ga0501074_0000382 | 3300049590 | Bacteria | 26289 |
| 530 | Ga0501074_0002758 | 3300049590 | Bacteria | 12300 |
| 531 | Ga0501075_0114580 | 3300049591 | Bacteria | 2050 |
| 532 | Ga0501076_0021610 | 3300049592 | Bacteria | 4939 |
| 533 | Ga0501077_0055053 | 3300049593 | Bacteria | 2526 |
| 534 | Ga0501079_0002879 | 3300049741 | Bacteria | 12559 |
| 535 | Ga0501079_0006063 | 3300049741 | Bacteria | 9060 |
| 536 | Ga0501080_0006214 | 3300049742 | Bacteria | 10717 |
| 537 | Ga0501083_0000116 | 3300049744 | Bacteria | 54656 |
| 538 | Ga0501083_0023703 | 3300049744 | Bacteria | 4256 |
| 539 | Ga0501083_0113119 | 3300049744 | Bacteria | 1783 |
| 540 | Ga0501035_0000496 | 3300049822 | Bacteria | 44296 |
| 541 | Ga0501035_0072843 | 3300049822 | Bacteria | 3039 |
| 542 | Ga0501035_0148289 | 3300049822 | Bacteria | 2037 |
| 543 | Ga0501044_0000857 | 3300049823 | Bacteria | 36575 |
| 544 | Ga0501044_0007497 | 3300049823 | Bacteria | 12001 |
| 545 | Ga0501044_0024267 | 3300049823 | Bacteria | 6441 |
| 546 | Ga0501044_0141372 | 3300049823 | Bacteria | 2395 |
| 547 | Ga0501045_0040349 | 3300049824 | Bacteria | 3397 |
| 548 | nmdc:mga00v17_102158_c1 | 3300050491 | Bacteria | 1811 |
| 549 | nmdc:mga00v17_19178_c1 | 3300050491 | Bacteria | 3900 |
| 550 | nmdc:mga00v17_47087_c1 | 3300050491 | Bacteria | 2611 |
| 551 | nmdc:mga0yw44_204887_c1 | 3300050492 | Bacteria | 1304 |
| 552 | nmdc:mga0yw44_67662_c1 | 3300050492 | Bacteria | 2208 |
| 553 | nmdc:mga0yw44_8401_c1 | 3300050492 | Bacteria | 5143 |
| 554 | nmdc:mga0yw44_8643_c1 | 3300050492 | Bacteria | 5088 |
| 555 | nmdc:mga0k408_26711_c1 | 3300050493 | Bacteria | 3275 |
| 556 | nmdc:mga0k408_96542_c1 | 3300050493 | Bacteria | 1425 |
| 557 | nmdc:mga07m45_103068_c1 | 3300050496 | Bacteria | 1640 |
| 558 | nmdc:mga05p37_2711_c2 | 3300050507 | Bacteria | 18727 |
| 559 | nmdc:mga05p37_430_c1 | 3300050507 | Bacteria | 45408 |
| 560 | nmdc:mga05p37_7402_c1 | 3300050507 | Bacteria | 12952 |
| 561 | nmdc:mga09592_6098_c1 | 3300050508 | Bacteria | 9821 |
| 562 | nmdc:mga0qj67_246139_c1 | 3300050509 | Bacteria | 1451 |
| 563 | nmdc:mga0qj67_83992_c1 | 3300050509 | Bacteria | 2553 |
| 564 | nmdc:mga06r32_1291_c1 | 3300050510 | Bacteria | 22555 |
| 565 | nmdc:mga06r32_197927_c1 | 3300050510 | Bacteria | 1997 |
| 566 | nmdc:mga06r32_228205_c1 | 3300050510 | Bacteria | 1261 |
| 567 | nmdc:mga06r32_492618_c1 | 3300050510 | Bacteria | 1203 |
| 568 | nmdc:mga06r32_51164_c1 | 3300050510 | Bacteria | 3953 |
| 569 | nmdc:mga06r32_89581_c1 | 3300050510 | Bacteria | 3004 |
| 570 | nmdc:mga08y16_1565_c1 | 3300050511 | Bacteria | 23071 |
| 571 | nmdc:mga08y16_66444_c1 | 3300050511 | Bacteria | 3763 |
| 572 | nmdc:mga0n895_100523_c1 | 3300050512 | Bacteria | 2901 |
| 573 | nmdc:mga0n895_280023_c1 | 3300050512 | Bacteria | 1691 |
| 574 | nmdc:mga0n895_53969_c1 | 3300050512 | Bacteria | 3951 |
| 575 | nmdc:mga0rr50_66353_c1 | 3300050513 | Bacteria | 2737 |
| 576 | nmdc:mga0sz30_43442_c2 | 3300050516 | Bacteria | 1621 |
| 577 | nmdc:mga0sz30_50479_c1 | 3300050516 | Bacteria | 1764 |
| 578 | Ga0495601_0010913 | 3300053077 | Bacteria | 5421 |
| 579 | Ga0495601_0135379 | 3300053077 | Bacteria | 1606 |
| 580 | Ga0495601_0161926 | 3300053077 | Bacteria | 1462 |
| 581 | Ga0495612_0022290 | 3300053078 | Bacteria | 2539 |
| 582 | Ga0500635_0003783 | 3300053080 | Bacteria | 3835 |
| 583 | Ga0495595_0007198 | 3300053084 | Bacteria | 4548 |
| 584 | Ga0495595_0154362 | 3300053084 | Bacteria | 1131 |
| 585 | Ga0495619_0003147 | 3300053085 | Bacteria | 10703 |
| 586 | Ga0495619_0178706 | 3300053085 | Bacteria | 1468 |
| 587 | Ga0500641_0003366 | 3300053096 | Bacteria | 5655 |
| 588 | Ga0500641_0020358 | 3300053096 | Bacteria | 2518 |
| 589 | Ga0500554_005155 | 3300053102 | Bacteria | 2824 |
| 590 | Ga0500557_000052 | 3300053105 | Bacteria | 50636 |
| 591 | Ga0500572_000307 | 3300053111 | Bacteria | 17413 |
| 592 | Ga0500594_0019477 | 3300053118 | Bacteria | 1683 |
| 593 | Ga0500595_000932 | 3300053119 | Bacteria | 16564 |
| 594 | Ga0500595_017822 | 3300053119 | Bacteria | 2611 |
| 595 | Ga0500642_0000274 | 3300053130 | Bacteria | 19303 |
| 596 | Ga0500658_0056259 | 3300053134 | Bacteria | 1622 |
| 597 | Ga0500559_0000143 | 3300053136 | Bacteria | 55572 |
| 598 | Ga0500577_0000758 | 3300053142 | Bacteria | 8299 |
| 599 | Ga0500604_0033162 | 3300053151 | Bacteria | 1526 |
| 600 | Ga0500636_0015101 | 3300053177 | Bacteria | 4546 |
| 601 | Ga0500636_0019872 | 3300053177 | Bacteria | 3972 |
| 602 | Ga0500637_0003531 | 3300053178 | Bacteria | 7244 |
| 603 | Ga0500625_022632 | 3300053729 | Bacteria | 2968 |
| 604 | Ga0500609_008204 | 3300053731 | Bacteria | 1409 |
| 605 | Ga0501082_0000452 | 3300060353 | Bacteria | 36318 |
| 606 | Ga0501082_0002875 | 3300060353 | Bacteria | 15006 |
| 607 | Ga0501082_0265651 | 3300060353 | Bacteria | 1493 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048903 | Ga0496100_0105166 | Ga0496100_0105166_967_1941 | 324 |
| 2 | 3300003911 | JGI25405J52794_10006081 | JGI25405J52794_100060812 | 325 |
| 3 | iso_pu_bacteria | 8019565922 | 8019569115 | 327 |
| 4 | 3300048910 | Ga0496107_0232810 | Ga0496107_0232810_347_1336 | 329 |
| 5 | 3300048914 | Ga0496111_0303801 | Ga0496111_0303801_177_1166 | 329 |
| 6 | 3300048924 | Ga0496121_0159730 | Ga0496121_0159730_17_1006 | 329 |
| 7 | 3300048918 | Ga0496115_0052630 | Ga0496115_0052630_2206_3222 | 338 |
| 8 | 3300049573 | Ga0501037_0064152 | Ga0501037_0064152_36_1052 | 338 |
| 9 | 3300049581 | Ga0501047_0155514 | Ga0501047_0155514_36_1052 | 338 |
| 10 | 3300006028 | Ga0070717_10004417 | Ga0070717_100044174 | 339 |
| 11 | 3300009553 | Ga0105249_10226414 | Ga0105249_102264141 | 339 |
| 12 | 3300025938 | Ga0207704_10271407 | Ga0207704_102714071 | 339 |
| 13 | 3300003659 | JGI25404J52841_10007721 | JGI25404J52841_100077211 | 342 |
| 14 | 3300005434 | Ga0070709_10000751 | Ga0070709_1000075118 | 342 |
| 15 | 3300005983 | Ga0081540_1000011 | Ga0081540_100001167 | 342 |
| 16 | 3300006163 | Ga0070715_10000111 | Ga0070715_1000011113 | 342 |
| 17 | 3300006173 | Ga0070716_100038166 | Ga0070716_1000381662 | 342 |
| 18 | 3300025898 | Ga0207692_10001501 | Ga0207692_100015016 | 342 |
| 19 | 3300025906 | Ga0207699_10015388 | Ga0207699_100153884 | 342 |
| 20 | 3300025915 | Ga0207693_10004043 | Ga0207693_100040433 | 342 |
| 21 | 3300025916 | Ga0207663_10000098 | Ga0207663_100000983 | 342 |
| 22 | 3300025929 | Ga0207664_10121402 | Ga0207664_101214022 | 342 |
| 23 | 3300025939 | Ga0207665_10000355 | Ga0207665_100003555 | 342 |
| 24 | 3300048926 | Ga0496123_0021676 | Ga0496123_0021676_855_1949 | 343 |
| 25 | 3300005289 | Ga0065704_10192549 | Ga0065704_101925491 | 344 |
| 26 | 3300006852 | Ga0075433_10012867 | Ga0075433_100128678 | 346 |
| 27 | 3300050513 | nmdc:mga0rr50_66353_c1 | nmdc:mga0rr50_66353_c1_250_1356 | 346 |
| 28 | 3300005617 | Ga0068859_100023016 | Ga0068859_1000230165 | 347 |
| 29 | 3300006931 | Ga0097620_100023015 | Ga0097620_1000230153 | 347 |
| 30 | 3300025900 | Ga0207710_10010206 | Ga0207710_100102062 | 347 |
| 31 | 3300025942 | Ga0207689_10031017 | Ga0207689_100310172 | 347 |
| 32 | 3300026116 | Ga0207674_10032345 | Ga0207674_100323453 | 347 |
| 33 | 3300053118 | Ga0500594_0019477 | Ga0500594_0019477_404_1456 | 347 |
| 34 | 3300053151 | Ga0500604_0033162 | Ga0500604_0033162_294_1346 | 347 |
| 35 | 3300005331 | Ga0070670_100010787 | Ga0070670_1000107876 | 348 |
| 36 | 3300005335 | Ga0070666_10128599 | Ga0070666_101285992 | 348 |
| 37 | 3300005355 | Ga0070671_100085919 | Ga0070671_1000859192 | 348 |
| 38 | 3300006847 | Ga0075431_100273929 | Ga0075431_1002739291 | 348 |
| 39 | 3300006871 | Ga0075434_100225934 | Ga0075434_1002259342 | 348 |
| 40 | 3300009101 | Ga0105247_10019792 | Ga0105247_100197922 | 348 |
| 41 | 3300009147 | Ga0114129_10016386 | Ga0114129_100163868 | 348 |
| 42 | 3300010375 | Ga0105239_10514623 | Ga0105239_105146231 | 348 |
| 43 | 3300014325 | Ga0163163_10013111 | Ga0163163_100131117 | 348 |
| 44 | 3300014745 | Ga0157377_10030766 | Ga0157377_100307663 | 348 |
| 45 | 3300025900 | Ga0207710_10087641 | Ga0207710_100876411 | 348 |
| 46 | 3300025925 | Ga0207650_10060436 | Ga0207650_100604362 | 348 |
| 47 | 3300046473 | Ga0495582_0072596 | Ga0495582_0072596_513_1616 | 348 |
| 48 | 3300046689 | Ga0495613_0122659 | Ga0495613_0122659_525_1628 | 348 |
| 49 | 3300048905 | Ga0496102_0074594 | Ga0496102_0074594_852_1955 | 348 |
| 50 | 3300048907 | Ga0496104_0001976 | Ga0496104_0001976_1480_2526 | 348 |
| 51 | 3300048907 | Ga0496104_0009294 | Ga0496104_0009294_6509_7612 | 348 |
| 52 | 3300048909 | Ga0496106_0078914 | Ga0496106_0078914_895_1998 | 348 |
| 53 | 3300048911 | Ga0496108_0016034 | Ga0496108_0016034_3785_4888 | 348 |
| 54 | 3300048912 | Ga0496109_0006607 | Ga0496109_0006607_3573_4676 | 348 |
| 55 | 3300048913 | Ga0496110_0006375 | Ga0496110_0006375_3391_4494 | 348 |
| 56 | 3300048914 | Ga0496111_0073294 | Ga0496111_0073294_945_2048 | 348 |
| 57 | 3300048915 | Ga0496112_0001095 | Ga0496112_0001095_15124_16227 | 348 |
| 58 | 3300048918 | Ga0496115_0040104 | Ga0496115_0040104_361_1464 | 348 |
| 59 | 3300049568 | Ga0501031_0171178 | Ga0501031_0171178_19_1074 | 348 |
| 60 | 3300050507 | nmdc:mga05p37_2711_c2 | nmdc:mga05p37_2711_c2_2038_3141 | 348 |
| 61 | 3300050510 | nmdc:mga06r32_492618_c1 | nmdc:mga06r32_492618_c1_67_1170 | 348 |
| 62 | 3300053077 | Ga0495601_0161926 | Ga0495601_0161926_41_1096 | 348 |
| 63 | 3300025297 | Ga0209758_1003309 | Ga0209758_10033094 | 349 |
| 64 | 3300046499 | Ga0495594_0088940 | Ga0495594_0088940_16_1068 | 349 |
| 65 | 3300006846 | Ga0075430_100022067 | Ga0075430_1000220672 | 351 |
| 66 | 3300006847 | Ga0075431_100172727 | Ga0075431_1001727272 | 351 |
| 67 | 3300009147 | Ga0114129_10039984 | Ga0114129_100399845 | 351 |
| 68 | 3300050509 | nmdc:mga0qj67_246139_c1 | nmdc:mga0qj67_246139_c1_226_1335 | 351 |
| 69 | 3300050510 | nmdc:mga06r32_51164_c1 | nmdc:mga06r32_51164_c1_2591_3700 | 351 |
| 70 | 3300028556 | Ga0265337_1002468 | Ga0265337_10024682 | 352 |
| 71 | 3300028563 | Ga0265319_1009070 | Ga0265319_10090703 | 352 |
| 72 | 3300028573 | Ga0265334_10000456 | Ga0265334_100004563 | 352 |
| 73 | 3300028577 | Ga0265318_10015114 | Ga0265318_100151142 | 352 |
| 74 | 3300028653 | Ga0265323_10000424 | Ga0265323_1000042422 | 352 |
| 75 | 3300028654 | Ga0265322_10034843 | Ga0265322_100348431 | 352 |
| 76 | 3300028666 | Ga0265336_10000431 | Ga0265336_100004316 | 352 |
| 77 | 3300028800 | Ga0265338_10000321 | Ga0265338_1000032150 | 352 |
| 78 | 3300029957 | Ga0265324_10005870 | Ga0265324_100058703 | 352 |
| 79 | 3300005434 | Ga0070709_10000765 | Ga0070709_1000076512 | 353 |
| 80 | 3300005435 | Ga0070714_100004348 | Ga0070714_10000434810 | 353 |
| 81 | 3300005436 | Ga0070713_100042866 | Ga0070713_1000428662 | 353 |
| 82 | 3300005439 | Ga0070711_100019807 | Ga0070711_1000198073 | 353 |
| 83 | 3300006028 | Ga0070717_10008045 | Ga0070717_100080452 | 353 |
| 84 | 3300006163 | Ga0070715_10000890 | Ga0070715_100008906 | 353 |
| 85 | 3300025898 | Ga0207692_10002579 | Ga0207692_100025794 | 353 |
| 86 | 3300025905 | Ga0207685_10002531 | Ga0207685_100025313 | 353 |
| 87 | 3300025928 | Ga0207700_10098400 | Ga0207700_100984002 | 353 |
| 88 | 3300025928 | Ga0207700_10226283 | Ga0207700_102262832 | 353 |
| 89 | 3300025929 | Ga0207664_10069359 | Ga0207664_100693593 | 353 |
| 90 | 3300025929 | Ga0207664_10137916 | Ga0207664_101379162 | 353 |
| 91 | 3300025939 | Ga0207665_10000204 | Ga0207665_1000020420 | 353 |
| 92 | 3300035724 | Ga0373933_0061486 | Ga0373933_0061486_947_2056 | 353 |
| 93 | 3300048909 | Ga0496106_0029780 | Ga0496106_0029780_2172_3275 | 353 |
| 94 | 3300050512 | nmdc:mga0n895_100523_c1 | nmdc:mga0n895_100523_c1_1336_2439 | 353 |
| 95 | 3300005937 | Ga0081455_10158288 | Ga0081455_101582881 | 354 |
| 96 | 3300046460 | Ga0495638_0063674 | Ga0495638_0063674_35_1144 | 354 |
| 97 | 3300048929 | Ga0496126_0008467 | Ga0496126_0008467_8085_9182 | 354 |
| 98 | 3300005937 | Ga0081455_10019562 | Ga0081455_100195625 | 355 |
| 99 | 3300046459 | Ga0495629_0028160 | Ga0495629_0028160_2361_3464 | 355 |
| 100 | 3300049744 | Ga0501083_0113119 | Ga0501083_0113119_392_1525 | 355 |
| 101 | 3300005353 | Ga0070669_100154645 | Ga0070669_1001546452 | 356 |
| 102 | 3300005983 | Ga0081540_1023400 | Ga0081540_10234002 | 356 |
| 103 | 3300005983 | Ga0081540_1036625 | Ga0081540_10366253 | 356 |
| 104 | 3300025295 | Ga0209564_1001241 | Ga0209564_10012418 | 356 |
| 105 | 3300037068 | Ga0373925_0033765 | Ga0373925_0033765_2059_3138 | 356 |
| 106 | 3300049571 | Ga0501034_0330070 | Ga0501034_0330070_113_1204 | 356 |
| 107 | 3300049579 | Ga0501043_0263165 | Ga0501043_0263165_151_1242 | 356 |
| 108 | 3300049581 | Ga0501047_0065589 | Ga0501047_0065589_416_1507 | 356 |
| 109 | 3300049586 | Ga0501070_0180419 | Ga0501070_0180419_450_1541 | 356 |
| 110 | 3300049822 | Ga0501035_0148289 | Ga0501035_0148289_553_1644 | 356 |
| 111 | 3300005364 | Ga0070673_100209338 | Ga0070673_1002093381 | 357 |
| 112 | 3300025960 | Ga0207651_10067481 | Ga0207651_100674813 | 357 |
| 113 | 3300039437 | Ga0436365_1840276 | Ga0436365_1840276_4060_5154 | 357 |
| 114 | 3300039453 | Ga0436362_1129034 | Ga0436362_1129034_1928_3022 | 357 |
| 115 | 3300048913 | Ga0496110_0163361 | Ga0496110_0163361_257_1372 | 357 |
| 116 | 3300048915 | Ga0496112_0112207 | Ga0496112_0112207_1383_2471 | 357 |
| 117 | 3300050510 | nmdc:mga06r32_228205_c1 | nmdc:mga06r32_228205_c1_38_1132 | 357 |
| 118 | 3300050510 | nmdc:mga06r32_89581_c1 | nmdc:mga06r32_89581_c1_949_2046 | 357 |
| 119 | 3300053084 | Ga0495595_0154362 | Ga0495595_0154362_35_1108 | 357 |
| 120 | 3300048913 | Ga0496110_0240001 | Ga0496110_0240001_365_1459 | 358 |
| 121 | 3300050512 | nmdc:mga0n895_280023_c1 | nmdc:mga0n895_280023_c1_225_1322 | 358 |
| 122 | 3300053142 | Ga0500577_0000758 | Ga0500577_0000758_2294_3385 | 358 |
| 123 | 3300005329 | Ga0070683_100056178 | Ga0070683_1000561784 | 359 |
| 124 | 3300005435 | Ga0070714_100001123 | Ga0070714_10000112316 | 359 |
| 125 | 3300005436 | Ga0070713_100000647 | Ga0070713_1000006476 | 359 |
| 126 | 3300005437 | Ga0070710_10001077 | Ga0070710_100010776 | 359 |
| 127 | 3300005439 | Ga0070711_100043214 | Ga0070711_1000432144 | 359 |
| 128 | 3300005535 | Ga0070684_100109785 | Ga0070684_1001097854 | 359 |
| 129 | 3300025944 | Ga0207661_10000349 | Ga0207661_100003493 | 359 |
| 130 | 3300031240 | Ga0265320_10067525 | Ga0265320_100675252 | 359 |
| 131 | 3300031595 | Ga0265313_10009487 | Ga0265313_100094873 | 359 |
| 132 | 3300031712 | Ga0265342_10049675 | Ga0265342_100496752 | 359 |
| 133 | 3300039447 | Ga0436361_0003682 | Ga0436361_0003682_1984_3105 | 359 |
| 134 | 3300044694 | Ga0466963_0249073 | Ga0466963_0249073_74_1219 | 359 |
| 135 | 3300047320 | Ga0495672_0007644 | Ga0495672_0007644_909_2009 | 359 |
| 136 | 3300049576 | Ga0501040_0022745 | Ga0501040_0022745_2756_3913 | 359 |
| 137 | 3300049582 | Ga0501048_0030608 | Ga0501048_0030608_218_1351 | 359 |
| 138 | 3300049589 | Ga0501073_0006215 | Ga0501073_0006215_936_2069 | 359 |
| 139 | 3300049592 | Ga0501076_0021610 | Ga0501076_0021610_2238_3371 | 359 |
| 140 | 3300049741 | Ga0501079_0006063 | Ga0501079_0006063_7647_8804 | 359 |
| 141 | 3300053096 | Ga0500641_0003366 | Ga0500641_0003366_1977_3065 | 359 |
| 142 | iso_pu_bacteria | 2874590934 | 2874598424 | 359 |
| 143 | iso_pu_bacteria | 2874645413 | 2874652521 | 359 |
| 144 | iso_pu_bacteria | 2876771140 | 2876778098 | 359 |
| 145 | iso_pu_bacteria | 2876818435 | 2876826033 | 359 |
| 146 | iso_pu_bacteria | 2879074833 | 2879081892 | 359 |
| 147 | iso_pu_bacteria | 2879127579 | 2879135014 | 359 |
| 148 | iso_pu_bacteria | 2879142872 | 2879149699 | 359 |
| 149 | iso_pu_bacteria | 8019619141 | 8019628591 | 359 |
| 150 | iso_pu_bacteria | 8019678201 | 8019684657 | 359 |
| 151 | 3300005435 | Ga0070714_100006896 | Ga0070714_1000068964 | 360 |
| 152 | 3300005436 | Ga0070713_100062420 | Ga0070713_1000624204 | 360 |
| 153 | 3300005458 | Ga0070681_10036942 | Ga0070681_100369423 | 360 |
| 154 | 3300005530 | Ga0070679_100013382 | Ga0070679_1000133824 | 360 |
| 155 | 3300005981 | Ga0081538_10017231 | Ga0081538_100172313 | 360 |
| 156 | 3300006042 | Ga0075368_10005443 | Ga0075368_100054434 | 360 |
| 157 | 3300006042 | Ga0075368_10015438 | Ga0075368_100154383 | 360 |
| 158 | 3300006048 | Ga0075363_100034975 | Ga0075363_1000349753 | 360 |
| 159 | 3300006051 | Ga0075364_10034307 | Ga0075364_100343072 | 360 |
| 160 | 3300006177 | Ga0075362_10005605 | Ga0075362_100056053 | 360 |
| 161 | 3300006353 | Ga0075370_10024424 | Ga0075370_100244242 | 360 |
| 162 | 3300006880 | Ga0075429_100175772 | Ga0075429_1001757722 | 360 |
| 163 | 3300009545 | Ga0105237_10228790 | Ga0105237_102287902 | 360 |
| 164 | 3300010375 | Ga0105239_10169078 | Ga0105239_101690782 | 360 |
| 165 | 3300013297 | Ga0157378_10392599 | Ga0157378_103925992 | 360 |
| 166 | 3300025253 | Ga0209677_105615 | Ga0209677_1056153 | 360 |
| 167 | 3300025912 | Ga0207707_10000950 | Ga0207707_1000095020 | 360 |
| 168 | 3300025921 | Ga0207652_10043416 | Ga0207652_100434164 | 360 |
| 169 | 3300031238 | Ga0265332_10002663 | Ga0265332_100026632 | 360 |
| 170 | 3300031250 | Ga0265331_10019579 | Ga0265331_100195792 | 360 |
| 171 | 3300031344 | Ga0265316_10117758 | Ga0265316_101177583 | 360 |
| 172 | 3300031712 | Ga0265342_10000210 | Ga0265342_1000021039 | 360 |
| 173 | 3300035083 | Ga0373926_0027317 | Ga0373926_0027317_764_1870 | 360 |
| 174 | 3300035113 | Ga0373936_0034336 | Ga0373936_0034336_118_1224 | 360 |
| 175 | 3300035170 | Ga0373943_0037581 | Ga0373943_0037581_269_1375 | 360 |
| 176 | 3300035171 | Ga0373946_0021549 | Ga0373946_0021549_386_1492 | 360 |
| 177 | 3300035410 | Ga0373924_0003483 | Ga0373924_0003483_310_1416 | 360 |
| 178 | 3300035692 | Ga0373935_0070498 | Ga0373935_0070498_454_1560 | 360 |
| 179 | 3300035695 | Ga0373927_0105322 | Ga0373927_0105322_183_1289 | 360 |
| 180 | 3300039437 | Ga0436365_1822185 | Ga0436365_1822185_463_1575 | 360 |
| 181 | 3300046455 | Ga0495603_0115785 | Ga0495603_0115785_161_1267 | 360 |
| 182 | 3300046475 | Ga0495639_0051376 | Ga0495639_0051376_724_1830 | 360 |
| 183 | 3300046476 | Ga0495662_0067536 | Ga0495662_0067536_365_1471 | 360 |
| 184 | 3300046477 | Ga0495664_0026626 | Ga0495664_0026626_1277_2383 | 360 |
| 185 | 3300046514 | Ga0495618_0011828 | Ga0495618_0011828_609_1715 | 360 |
| 186 | 3300046516 | Ga0495628_0063069 | Ga0495628_0063069_393_1499 | 360 |
| 187 | 3300046517 | Ga0495630_0025233 | Ga0495630_0025233_310_1416 | 360 |
| 188 | 3300046531 | Ga0495665_0019583 | Ga0495665_0019583_2108_3214 | 360 |
| 189 | 3300046533 | Ga0495640_0116833 | Ga0495640_0116833_97_1203 | 360 |
| 190 | 3300046663 | Ga0495635_0167153 | Ga0495635_0167153_81_1187 | 360 |
| 191 | 3300046683 | Ga0495658_0096637 | Ga0495658_0096637_549_1655 | 360 |
| 192 | 3300047315 | Ga0495581_0048953 | Ga0495581_0048953_1221_2327 | 360 |
| 193 | 3300048924 | Ga0496121_0045710 | Ga0496121_0045710_2200_3306 | 360 |
| 194 | 3300048928 | Ga0496125_0000060 | Ga0496125_0000060_85212_86309 | 360 |
| 195 | 3300049824 | Ga0501045_0040349 | Ga0501045_0040349_121_1254 | 360 |
| 196 | 3300050491 | nmdc:mga00v17_47087_c1 | nmdc:mga00v17_47087_c1_597_1688 | 360 |
| 197 | 3300050492 | nmdc:mga0yw44_204887_c1 | nmdc:mga0yw44_204887_c1_49_1140 | 360 |
| 198 | 3300050496 | nmdc:mga07m45_103068_c1 | nmdc:mga07m45_103068_c1_221_1312 | 360 |
| 199 | 3300050516 | nmdc:mga0sz30_50479_c1 | nmdc:mga0sz30_50479_c1_308_1399 | 360 |
| 200 | iso_pu_bacteria | 2513237096 | 2513657066 | 360 |
| 201 | iso_pu_bacteria | 2513237137 | 2513855507 | 360 |
| 202 | iso_pu_bacteria | 2513237145 | 2513918806 | 360 |
| 203 | iso_pu_bacteria | 2517572143 | 2517892053 | 360 |
| 204 | iso_pu_bacteria | 2524023228 | 2524534136 | 360 |
| 205 | iso_pu_bacteria | 2667528175 | 2671121910 | 360 |
| 206 | iso_pu_bacteria | 2728368998 | 2728753007 | 360 |
| 207 | iso_pu_bacteria | 2791355197 | 2793068873 | 360 |
| 208 | iso_pu_bacteria | 2885374607 | 2885375915 | 360 |
| 209 | iso_pu_bacteria | 2903748898 | 2903753440 | 360 |
| 210 | iso_pu_bacteria | 2904699407 | 2904702161 | 360 |
| 211 | iso_pu_bacteria | 2906610324 | 2906617180 | 360 |
| 212 | iso_pu_bacteria | 2906635258 | 2906639243 | 360 |
| 213 | iso_pu_bacteria | 2906660503 | 2906662442 | 360 |
| 214 | iso_pu_bacteria | 2908739725 | 2908742328 | 360 |
| 215 | iso_pu_bacteria | 2922386360 | 2922391319 | 360 |
| 216 | iso_pu_bacteria | 2922425934 | 2922430650 | 360 |
| 217 | iso_pu_bacteria | 2935630451 | 2935631188 | 360 |
| 218 | iso_pu_bacteria | 2941507105 | 2941509929 | 360 |
| 219 | iso_pu_bacteria | 2941515067 | 2941518984 | 360 |
| 220 | iso_pu_bacteria | 2941523033 | 2941525328 | 360 |
| 221 | iso_pu_bacteria | 8006933436 | 8006940212 | 360 |
| 222 | iso_pu_bacteria | 8006973647 | 8006979991 | 360 |
| 223 | iso_pu_bacteria | 8019555841 | 8019556195 | 360 |
| 224 | iso_pu_bacteria | 8056681323 | 8056689252 | 360 |
| 225 | 3300003215 | JGI25153J46596_10007386 | JGI25153J46596_100073864 | 361 |
| 226 | 3300005336 | Ga0070680_100116879 | Ga0070680_1001168791 | 361 |
| 227 | 3300005614 | Ga0068856_100000020 | Ga0068856_100000020131 | 361 |
| 228 | 3300005985 | Ga0081539_10048315 | Ga0081539_100483153 | 361 |
| 229 | 3300006038 | Ga0075365_10066735 | Ga0075365_100667352 | 361 |
| 230 | 3300006186 | Ga0075369_10050535 | Ga0075369_100505352 | 361 |
| 231 | 3300006941 | Ga0099825_1024808 | Ga0099825_10248082 | 361 |
| 232 | 3300006942 | Ga0099824_1005874 | Ga0099824_100587413 | 361 |
| 233 | 3300006943 | Ga0099822_1001130 | Ga0099822_10011307 | 361 |
| 234 | 3300025261 | Ga0209233_1018718 | Ga0209233_10187182 | 361 |
| 235 | 3300025297 | Ga0209758_1005630 | Ga0209758_10056305 | 361 |
| 236 | 3300025900 | Ga0207710_10049074 | Ga0207710_100490742 | 361 |
| 237 | 3300025914 | Ga0207671_10100175 | Ga0207671_101001752 | 361 |
| 238 | 3300025961 | Ga0207712_10264549 | Ga0207712_102645492 | 361 |
| 239 | 3300026078 | Ga0207702_10000126 | Ga0207702_1000012618 | 361 |
| 240 | 3300027357 | Ga0209589_1000001 | Ga0209589_1000001288 | 361 |
| 241 | 3300027361 | Ga0209489_100001 | Ga0209489_100001288 | 361 |
| 242 | 3300027363 | Ga0209700_100001 | Ga0209700_100001288 | 361 |
| 243 | 3300028786 | Ga0307517_10000008 | Ga0307517_10000008184 | 361 |
| 244 | 3300031235 | Ga0265330_10039647 | Ga0265330_100396473 | 361 |
| 245 | 3300031241 | Ga0265325_10038114 | Ga0265325_100381142 | 361 |
| 246 | 3300031249 | Ga0265339_10014916 | Ga0265339_100149162 | 361 |
| 247 | 3300031711 | Ga0265314_10043127 | Ga0265314_100431273 | 361 |
| 248 | 3300031712 | Ga0265342_10007904 | Ga0265342_100079044 | 361 |
| 249 | 3300033442 | Ga0315911_1000006 | Ga0315911_1000006363 | 361 |
| 250 | 3300035691 | Ga0373931_0071835 | Ga0373931_0071835_316_1422 | 361 |
| 251 | 3300037466 | Ga0395898_0057370 | Ga0395898_0057370_1059_2162 | 361 |
| 252 | 3300046513 | Ga0495616_0100779 | Ga0495616_0100779_217_1323 | 361 |
| 253 | 3300048905 | Ga0496102_0012241 | Ga0496102_0012241_4794_5900 | 361 |
| 254 | 3300048905 | Ga0496102_0103808 | Ga0496102_0103808_599_1708 | 361 |
| 255 | 3300048906 | Ga0496103_0037576 | Ga0496103_0037576_845_1951 | 361 |
| 256 | 3300048915 | Ga0496112_0182993 | Ga0496112_0182993_852_1958 | 361 |
| 257 | 3300048916 | Ga0496113_0016119 | Ga0496113_0016119_457_1563 | 361 |
| 258 | 3300048918 | Ga0496115_0137366 | Ga0496115_0137366_447_1544 | 361 |
| 259 | 3300048929 | Ga0496126_0004957 | Ga0496126_0004957_8982_10100 | 361 |
| 260 | 3300048929 | Ga0496126_0013579 | Ga0496126_0013579_7053_8162 | 361 |
| 261 | 3300050516 | nmdc:mga0sz30_43442_c2 | nmdc:mga0sz30_43442_c2_392_1501 | 361 |
| 262 | 3300053096 | Ga0500641_0020358 | Ga0500641_0020358_575_1681 | 361 |
| 263 | 3300053119 | Ga0500595_000932 | Ga0500595_000932_14745_15869 | 361 |
| 264 | 3300053177 | Ga0500636_0015101 | Ga0500636_0015101_3159_4283 | 361 |
| 265 | 3300053177 | Ga0500636_0019872 | Ga0500636_0019872_1154_2269 | 361 |
| 266 | 3300053731 | Ga0500609_008204 | Ga0500609_008204_285_1397 | 361 |
| 267 | iso_pu_bacteria | 2508501128 | 2509151471 | 361 |
| 268 | iso_pu_bacteria | 2511231028 | 2511398747 | 361 |
| 269 | iso_pu_bacteria | 2844315083 | 2844319430 | 361 |
| 270 | iso_pu_bacteria | 2876761206 | 2876764973 | 361 |
| 271 | iso_pu_bacteria | 2906602504 | 2906609164 | 361 |
| 272 | iso_pu_bacteria | 2935777560 | 2935778924 | 361 |
| 273 | iso_pu_bacteria | 8016530956 | 8016534425 | 361 |
| 274 | iso_pu_bacteria | 8016539877 | 8016547650 | 361 |
| 275 | iso_pu_bacteria | 8016548790 | 8016554490 | 361 |
| 276 | iso_pu_bacteria | 8016557553 | 8016562862 | 361 |
| 277 | iso_pu_bacteria | 8016595262 | 8016600637 | 361 |
| 278 | iso_pu_bacteria | 8016603502 | 8016610100 | 361 |
| 279 | iso_pu_bacteria | 8016613128 | 8016614838 | 361 |
| 280 | 3300005436 | Ga0070713_100075566 | Ga0070713_1000755663 | 362 |
| 281 | 3300005437 | Ga0070710_10008883 | Ga0070710_100088832 | 362 |
| 282 | 3300005439 | Ga0070711_100007383 | Ga0070711_1000073837 | 362 |
| 283 | 3300005457 | Ga0070662_100095066 | Ga0070662_1000950663 | 362 |
| 284 | 3300005471 | Ga0070698_100206373 | Ga0070698_1002063731 | 362 |
| 285 | 3300005535 | Ga0070684_100190645 | Ga0070684_1001906451 | 362 |
| 286 | 3300005563 | Ga0068855_100142736 | Ga0068855_1001427362 | 362 |
| 287 | 3300005564 | Ga0070664_100053036 | Ga0070664_1000530363 | 362 |
| 288 | 3300005578 | Ga0068854_100147310 | Ga0068854_1001473102 | 362 |
| 289 | 3300005614 | Ga0068856_100015688 | Ga0068856_1000156884 | 362 |
| 290 | 3300005616 | Ga0068852_100027093 | Ga0068852_1000270934 | 362 |
| 291 | 3300005616 | Ga0068852_100137450 | Ga0068852_1001374502 | 362 |
| 292 | 3300006173 | Ga0070716_100117402 | Ga0070716_1001174022 | 362 |
| 293 | 3300006175 | Ga0070712_100003177 | Ga0070712_1000031778 | 362 |
| 294 | 3300006175 | Ga0070712_100021375 | Ga0070712_1000213754 | 362 |
| 295 | 3300006175 | Ga0070712_100069240 | Ga0070712_1000692401 | 362 |
| 296 | 3300006844 | Ga0075428_100003918 | Ga0075428_1000039188 | 362 |
| 297 | 3300006846 | Ga0075430_100011920 | Ga0075430_1000119202 | 362 |
| 298 | 3300006847 | Ga0075431_100001468 | Ga0075431_10000146814 | 362 |
| 299 | 3300006880 | Ga0075429_100007126 | Ga0075429_1000071265 | 362 |
| 300 | 3300009093 | Ga0105240_10010915 | Ga0105240_100109153 | 362 |
| 301 | 3300009094 | Ga0111539_10003134 | Ga0111539_1000313413 | 362 |
| 302 | 3300009098 | Ga0105245_10049793 | Ga0105245_100497932 | 362 |
| 303 | 3300009147 | Ga0114129_10009260 | Ga0114129_1000926013 | 362 |
| 304 | 3300009174 | Ga0105241_10017590 | Ga0105241_100175905 | 362 |
| 305 | 3300010375 | Ga0105239_10091963 | Ga0105239_100919632 | 362 |
| 306 | 3300013104 | Ga0157370_10065826 | Ga0157370_100658263 | 362 |
| 307 | 3300014325 | Ga0163163_10000985 | Ga0163163_1000098517 | 362 |
| 308 | 3300021384 | Ga0213876_10004192 | Ga0213876_100041928 | 362 |
| 309 | 3300025906 | Ga0207699_10027898 | Ga0207699_100278982 | 362 |
| 310 | 3300025911 | Ga0207654_10052549 | Ga0207654_100525491 | 362 |
| 311 | 3300025911 | Ga0207654_10062518 | Ga0207654_100625182 | 362 |
| 312 | 3300025913 | Ga0207695_10000008 | Ga0207695_10000008182 | 362 |
| 313 | 3300025914 | Ga0207671_10008090 | Ga0207671_100080906 | 362 |
| 314 | 3300025914 | Ga0207671_10087332 | Ga0207671_100873322 | 362 |
| 315 | 3300025915 | Ga0207693_10001966 | Ga0207693_100019667 | 362 |
| 316 | 3300025933 | Ga0207706_10099788 | Ga0207706_100997882 | 362 |
| 317 | 3300025941 | Ga0207711_10209674 | Ga0207711_102096741 | 362 |
| 318 | 3300025942 | Ga0207689_10107194 | Ga0207689_101071941 | 362 |
| 319 | 3300025945 | Ga0207679_10019748 | Ga0207679_100197484 | 362 |
| 320 | 3300025949 | Ga0207667_10434751 | Ga0207667_104347512 | 362 |
| 321 | 3300026067 | Ga0207678_10015480 | Ga0207678_100154805 | 362 |
| 322 | 3300026118 | Ga0207675_100364668 | Ga0207675_1003646681 | 362 |
| 323 | 3300026142 | Ga0207698_10307556 | Ga0207698_103075562 | 362 |
| 324 | 3300027907 | Ga0207428_10004211 | Ga0207428_100042117 | 362 |
| 325 | 3300033180 | Ga0307510_10019107 | Ga0307510_100191075 | 362 |
| 326 | 3300033180 | Ga0307510_10087045 | Ga0307510_100870453 | 362 |
| 327 | 3300037418 | Ga0395900_0032586 | Ga0395900_0032586_2354_3457 | 362 |
| 328 | 3300037418 | Ga0395900_0064143 | Ga0395900_0064143_938_2041 | 362 |
| 329 | 3300037466 | Ga0395898_0073526 | Ga0395898_0073526_1903_3006 | 362 |
| 330 | 3300037853 | Ga0436364_1477382 | Ga0436364_1477382_440_1540 | 362 |
| 331 | 3300038443 | Ga0395901_0006650 | Ga0395901_0006650_9598_10701 | 362 |
| 332 | 3300038443 | Ga0395901_0291362 | Ga0395901_0291362_458_1549 | 362 |
| 333 | 3300044684 | Ga0466966_0000334 | Ga0466966_0000334_15144_16256 | 362 |
| 334 | 3300044693 | Ga0466961_0000509 | Ga0466961_0000509_8672_9784 | 362 |
| 335 | 3300045049 | Ga0466959_0113858 | Ga0466959_0113858_170_1282 | 362 |
| 336 | 3300046455 | Ga0495603_0004733 | Ga0495603_0004733_6120_7232 | 362 |
| 337 | 3300046462 | Ga0495651_0001733 | Ga0495651_0001733_4952_6064 | 362 |
| 338 | 3300046477 | Ga0495664_0001939 | Ga0495664_0001939_8524_9636 | 362 |
| 339 | 3300046511 | Ga0495608_0005911 | Ga0495608_0005911_2005_3117 | 362 |
| 340 | 3300046516 | Ga0495628_0028739 | Ga0495628_0028739_1725_2837 | 362 |
| 341 | 3300046517 | Ga0495630_0064928 | Ga0495630_0064928_537_1655 | 362 |
| 342 | 3300046517 | Ga0495630_0093563 | Ga0495630_0093563_487_1599 | 362 |
| 343 | 3300046529 | Ga0495652_0047738 | Ga0495652_0047738_1966_3078 | 362 |
| 344 | 3300046536 | Ga0495587_0008847 | Ga0495587_0008847_302_1414 | 362 |
| 345 | 3300046543 | Ga0495645_0034948 | Ga0495645_0034948_2050_3162 | 362 |
| 346 | 3300046559 | Ga0495667_0003089 | Ga0495667_0003089_5258_6370 | 362 |
| 347 | 3300046642 | Ga0495634_0043804 | Ga0495634_0043804_156_1268 | 362 |
| 348 | 3300046642 | Ga0495634_0126719 | Ga0495634_0126719_203_1321 | 362 |
| 349 | 3300046675 | Ga0495657_0007669 | Ga0495657_0007669_482_1594 | 362 |
| 350 | 3300046689 | Ga0495613_0115649 | Ga0495613_0115649_451_1563 | 362 |
| 351 | 3300046809 | Ga0495600_0008276 | Ga0495600_0008276_1691_2803 | 362 |
| 352 | 3300047317 | Ga0495604_0007727 | Ga0495604_0007727_4456_5568 | 362 |
| 353 | 3300047319 | Ga0495674_0006216 | Ga0495674_0006216_6368_7480 | 362 |
| 354 | 3300047444 | Ga0495675_0034458 | Ga0495675_0034458_632_1744 | 362 |
| 355 | 3300048907 | Ga0496104_0004574 | Ga0496104_0004574_5424_6539 | 362 |
| 356 | 3300048907 | Ga0496104_0061521 | Ga0496104_0061521_262_1371 | 362 |
| 357 | 3300048908 | Ga0496105_0052505 | Ga0496105_0052505_370_1479 | 362 |
| 358 | 3300048908 | Ga0496105_0061924 | Ga0496105_0061924_1016_2131 | 362 |
| 359 | 3300048909 | Ga0496106_0001378 | Ga0496106_0001378_13635_14744 | 362 |
| 360 | 3300048910 | Ga0496107_0033908 | Ga0496107_0033908_527_1636 | 362 |
| 361 | 3300048911 | Ga0496108_0000501 | Ga0496108_0000501_14078_15187 | 362 |
| 362 | 3300048912 | Ga0496109_0001015 | Ga0496109_0001015_3172_4281 | 362 |
| 363 | 3300048912 | Ga0496109_0039798 | Ga0496109_0039798_2984_4096 | 362 |
| 364 | 3300048914 | Ga0496111_0072818 | Ga0496111_0072818_1049_2158 | 362 |
| 365 | 3300048915 | Ga0496112_0010513 | Ga0496112_0010513_1691_2806 | 362 |
| 366 | 3300048916 | Ga0496113_0028731 | Ga0496113_0028731_731_1840 | 362 |
| 367 | 3300048924 | Ga0496121_0002279 | Ga0496121_0002279_20043_21170 | 362 |
| 368 | 3300049569 | Ga0501032_0012456 | Ga0501032_0012456_28_1152 | 362 |
| 369 | 3300049570 | Ga0501033_0000282 | Ga0501033_0000282_33564_34688 | 362 |
| 370 | 3300049573 | Ga0501037_0001227 | Ga0501037_0001227_10397_11521 | 362 |
| 371 | 3300049575 | Ga0501039_0003428 | Ga0501039_0003428_10310_11434 | 362 |
| 372 | 3300049579 | Ga0501043_0019319 | Ga0501043_0019319_893_2017 | 362 |
| 373 | 3300049584 | Ga0501068_0114452 | Ga0501068_0114452_288_1412 | 362 |
| 374 | 3300049822 | Ga0501035_0072843 | Ga0501035_0072843_318_1442 | 362 |
| 375 | 3300049823 | Ga0501044_0024267 | Ga0501044_0024267_4230_5354 | 362 |
| 376 | 3300050507 | nmdc:mga05p37_430_c1 | nmdc:mga05p37_430_c1_34950_36056 | 362 |
| 377 | 3300050508 | nmdc:mga09592_6098_c1 | nmdc:mga09592_6098_c1_2891_3997 | 362 |
| 378 | 3300050509 | nmdc:mga0qj67_83992_c1 | nmdc:mga0qj67_83992_c1_380_1486 | 362 |
| 379 | 3300050510 | nmdc:mga06r32_1291_c1 | nmdc:mga06r32_1291_c1_12523_13629 | 362 |
| 380 | 3300050511 | nmdc:mga08y16_1565_c1 | nmdc:mga08y16_1565_c1_11368_12474 | 362 |
| 381 | 3300053077 | Ga0495601_0135379 | Ga0495601_0135379_11_1147 | 362 |
| 382 | 3300053080 | Ga0500635_0003783 | Ga0500635_0003783_93_1205 | 362 |
| 383 | 3300053102 | Ga0500554_005155 | Ga0500554_005155_370_1482 | 362 |
| 384 | 3300053105 | Ga0500557_000052 | Ga0500557_000052_2050_3162 | 362 |
| 385 | 3300053119 | Ga0500595_017822 | Ga0500595_017822_135_1250 | 362 |
| 386 | 3300053130 | Ga0500642_0000274 | Ga0500642_0000274_12668_13780 | 362 |
| 387 | 3300053178 | Ga0500637_0003531 | Ga0500637_0003531_834_1946 | 362 |
| 388 | 3300053729 | Ga0500625_022632 | Ga0500625_022632_185_1297 | 362 |
| 389 | 3300060353 | Ga0501082_0265651 | Ga0501082_0265651_311_1408 | 362 |
| 390 | iso_pu_bacteria | 2513237095 | 2513645424 | 362 |
| 391 | iso_pu_bacteria | 2816332527 | 2818239661 | 362 |
| 392 | iso_pu_bacteria | 2888378607 | 2888384497 | 362 |
| 393 | 3300005328 | Ga0070676_10033115 | Ga0070676_100331153 | 363 |
| 394 | 3300005333 | Ga0070677_10016853 | Ga0070677_100168533 | 363 |
| 395 | 3300005353 | Ga0070669_100106151 | Ga0070669_1001061512 | 363 |
| 396 | 3300005354 | Ga0070675_100363510 | Ga0070675_1003635101 | 363 |
| 397 | 3300005356 | Ga0070674_100001777 | Ga0070674_10000177712 | 363 |
| 398 | 3300005436 | Ga0070713_100082398 | Ga0070713_1000823983 | 363 |
| 399 | 3300005456 | Ga0070678_100011686 | Ga0070678_1000116863 | 363 |
| 400 | 3300005539 | Ga0068853_100000785 | Ga0068853_1000007854 | 363 |
| 401 | 3300005563 | Ga0068855_100005618 | Ga0068855_10000561810 | 363 |
| 402 | 3300005577 | Ga0068857_100031091 | Ga0068857_1000310914 | 363 |
| 403 | 3300005614 | Ga0068856_100001874 | Ga0068856_1000018747 | 363 |
| 404 | 3300005616 | Ga0068852_100005253 | Ga0068852_1000052533 | 363 |
| 405 | 3300005718 | Ga0068866_10165602 | Ga0068866_101656021 | 363 |
| 406 | 3300005842 | Ga0068858_100275069 | Ga0068858_1002750691 | 363 |
| 407 | 3300006051 | Ga0075364_10126354 | Ga0075364_101263542 | 363 |
| 408 | 3300006177 | Ga0075362_10005001 | Ga0075362_100050013 | 363 |
| 409 | 3300006195 | Ga0075366_10004770 | Ga0075366_100047707 | 363 |
| 410 | 3300007788 | Ga0099795_10013458 | Ga0099795_100134581 | 363 |
| 411 | 3300009093 | Ga0105240_10020186 | Ga0105240_100201864 | 363 |
| 412 | 3300009147 | Ga0114129_10570665 | Ga0114129_105706652 | 363 |
| 413 | 3300009148 | Ga0105243_10268119 | Ga0105243_102681192 | 363 |
| 414 | 3300009551 | Ga0105238_10011980 | Ga0105238_100119804 | 363 |
| 415 | 3300009551 | Ga0105238_10018757 | Ga0105238_100187574 | 363 |
| 416 | 3300010159 | Ga0099796_10016410 | Ga0099796_100164103 | 363 |
| 417 | 3300010375 | Ga0105239_10014407 | Ga0105239_100144075 | 363 |
| 418 | 3300010375 | Ga0105239_10014647 | Ga0105239_100146474 | 363 |
| 419 | 3300013297 | Ga0157378_10212140 | Ga0157378_102121402 | 363 |
| 420 | 3300013306 | Ga0163162_10477391 | Ga0163162_104773911 | 363 |
| 421 | 3300021384 | Ga0213876_10013161 | Ga0213876_100131614 | 363 |
| 422 | 3300025297 | Ga0209758_1053463 | Ga0209758_10534632 | 363 |
| 423 | 3300025893 | Ga0207682_10000451 | Ga0207682_1000045110 | 363 |
| 424 | 3300025901 | Ga0207688_10017933 | Ga0207688_100179333 | 363 |
| 425 | 3300025907 | Ga0207645_10074418 | Ga0207645_100744182 | 363 |
| 426 | 3300025908 | Ga0207643_10053870 | Ga0207643_100538702 | 363 |
| 427 | 3300025911 | Ga0207654_10000232 | Ga0207654_100002324 | 363 |
| 428 | 3300025913 | Ga0207695_10001547 | Ga0207695_1000154719 | 363 |
| 429 | 3300025923 | Ga0207681_10163533 | Ga0207681_101635332 | 363 |
| 430 | 3300025924 | Ga0207694_10000050 | Ga0207694_1000005092 | 363 |
| 431 | 3300025924 | Ga0207694_10041876 | Ga0207694_100418762 | 363 |
| 432 | 3300025926 | Ga0207659_10239086 | Ga0207659_102390861 | 363 |
| 433 | 3300025940 | Ga0207691_10001066 | Ga0207691_1000106616 | 363 |
| 434 | 3300025940 | Ga0207691_10096903 | Ga0207691_100969032 | 363 |
| 435 | 3300025949 | Ga0207667_10032035 | Ga0207667_100320354 | 363 |
| 436 | 3300025960 | Ga0207651_10226622 | Ga0207651_102266222 | 363 |
| 437 | 3300025981 | Ga0207640_10055190 | Ga0207640_100551902 | 363 |
| 438 | 3300026035 | Ga0207703_10263121 | Ga0207703_102631211 | 363 |
| 439 | 3300026078 | Ga0207702_10000002 | Ga0207702_10000002202 | 363 |
| 440 | 3300026089 | Ga0207648_10023754 | Ga0207648_100237543 | 363 |
| 441 | 3300026121 | Ga0207683_10000733 | Ga0207683_100007332 | 363 |
| 442 | 3300035120 | Ga0373957_0009374 | Ga0373957_0009374_1450_2610 | 363 |
| 443 | 3300035724 | Ga0373933_0105181 | Ga0373933_0105181_260_1420 | 363 |
| 444 | 3300036401 | Ga0373937_0026472 | Ga0373937_0026472_3547_4707 | 363 |
| 445 | 3300037068 | Ga0373925_0044060 | Ga0373925_0044060_1690_2850 | 363 |
| 446 | 3300039437 | Ga0436365_0139392 | Ga0436365_0139392_2040_3137 | 363 |
| 447 | 3300039450 | Ga0436363_0602269 | Ga0436363_0602269_4005_5123 | 363 |
| 448 | 3300045976 | Ga0466967_0368085 | Ga0466967_0368085_96_1202 | 363 |
| 449 | 3300046474 | Ga0495605_0042617 | Ga0495605_0042617_549_1646 | 363 |
| 450 | 3300046529 | Ga0495652_0023334 | Ga0495652_0023334_1534_2694 | 363 |
| 451 | 3300046678 | Ga0495599_0006216 | Ga0495599_0006216_5346_6506 | 363 |
| 452 | 3300046679 | Ga0495623_0006875 | Ga0495623_0006875_3591_4751 | 363 |
| 453 | 3300046809 | Ga0495600_0007437 | Ga0495600_0007437_4460_5620 | 363 |
| 454 | 3300047444 | Ga0495675_0022639 | Ga0495675_0022639_2111_3271 | 363 |
| 455 | 3300048088 | Ga0495602_0009411 | Ga0495602_0009411_6459_7619 | 363 |
| 456 | 3300048907 | Ga0496104_0000575 | Ga0496104_0000575_25075_26178 | 363 |
| 457 | 3300048908 | Ga0496105_0005756 | Ga0496105_0005756_7713_8816 | 363 |
| 458 | 3300048917 | Ga0496114_0204106 | Ga0496114_0204106_392_1492 | 363 |
| 459 | 3300048918 | Ga0496115_0278383 | Ga0496115_0278383_101_1198 | 363 |
| 460 | 3300048923 | Ga0496120_0055950 | Ga0496120_0055950_966_2075 | 363 |
| 461 | 3300048927 | Ga0496124_0033059 | Ga0496124_0033059_3029_4135 | 363 |
| 462 | 3300048928 | Ga0496125_0091464 | Ga0496125_0091464_1114_2226 | 363 |
| 463 | 3300049568 | Ga0501031_0000268 | Ga0501031_0000268_2777_3892 | 363 |
| 464 | 3300049569 | Ga0501032_0000765 | Ga0501032_0000765_3624_4739 | 363 |
| 465 | 3300049569 | Ga0501032_0036807 | Ga0501032_0036807_2122_3252 | 363 |
| 466 | 3300049570 | Ga0501033_0000344 | Ga0501033_0000344_9053_10168 | 363 |
| 467 | 3300049570 | Ga0501033_0040568 | Ga0501033_0040568_1074_2231 | 363 |
| 468 | 3300049571 | Ga0501034_0000100 | Ga0501034_0000100_87027_88142 | 363 |
| 469 | 3300049572 | Ga0501036_0000228 | Ga0501036_0000228_35402_36517 | 363 |
| 470 | 3300049572 | Ga0501036_0123100 | Ga0501036_0123100_669_1799 | 363 |
| 471 | 3300049572 | Ga0501036_0184752 | Ga0501036_0184752_299_1429 | 363 |
| 472 | 3300049573 | Ga0501037_0000704 | Ga0501037_0000704_378_1493 | 363 |
| 473 | 3300049573 | Ga0501037_0041315 | Ga0501037_0041315_37_1167 | 363 |
| 474 | 3300049574 | Ga0501038_0000350 | Ga0501038_0000350_21353_22468 | 363 |
| 475 | 3300049574 | Ga0501038_0006039 | Ga0501038_0006039_7660_8790 | 363 |
| 476 | 3300049575 | Ga0501039_0112299 | Ga0501039_0112299_368_1525 | 363 |
| 477 | 3300049579 | Ga0501043_0000106 | Ga0501043_0000106_5014_6129 | 363 |
| 478 | 3300049579 | Ga0501043_0017698 | Ga0501043_0017698_102_1232 | 363 |
| 479 | 3300049579 | Ga0501043_0072182 | Ga0501043_0072182_617_1774 | 363 |
| 480 | 3300049580 | Ga0501046_0000426 | Ga0501046_0000426_35943_37058 | 363 |
| 481 | 3300049581 | Ga0501047_0000493 | Ga0501047_0000493_7770_8885 | 363 |
| 482 | 3300049581 | Ga0501047_0081958 | Ga0501047_0081958_1406_2536 | 363 |
| 483 | 3300049582 | Ga0501048_0000233 | Ga0501048_0000233_25608_26723 | 363 |
| 484 | 3300049583 | Ga0501067_0000384 | Ga0501067_0000384_89_1204 | 363 |
| 485 | 3300049583 | Ga0501067_0034761 | Ga0501067_0034761_1221_2378 | 363 |
| 486 | 3300049584 | Ga0501068_0005924 | Ga0501068_0005924_5537_6652 | 363 |
| 487 | 3300049585 | Ga0501069_0130537 | Ga0501069_0130537_74_1207 | 363 |
| 488 | 3300049586 | Ga0501070_0001419 | Ga0501070_0001419_7770_8885 | 363 |
| 489 | 3300049587 | Ga0501071_0083386 | Ga0501071_0083386_997_2124 | 363 |
| 490 | 3300049588 | Ga0501072_0004603 | Ga0501072_0004603_5346_6461 | 363 |
| 491 | 3300049589 | Ga0501073_0028392 | Ga0501073_0028392_2029_3144 | 363 |
| 492 | 3300049590 | Ga0501074_0000382 | Ga0501074_0000382_5221_6336 | 363 |
| 493 | 3300049590 | Ga0501074_0002758 | Ga0501074_0002758_6464_7621 | 363 |
| 494 | 3300049591 | Ga0501075_0114580 | Ga0501075_0114580_550_1707 | 363 |
| 495 | 3300049593 | Ga0501077_0055053 | Ga0501077_0055053_458_1591 | 363 |
| 496 | 3300049741 | Ga0501079_0002879 | Ga0501079_0002879_8746_9861 | 363 |
| 497 | 3300049742 | Ga0501080_0006214 | Ga0501080_0006214_7898_9013 | 363 |
| 498 | 3300049744 | Ga0501083_0000116 | Ga0501083_0000116_2798_3913 | 363 |
| 499 | 3300049822 | Ga0501035_0000496 | Ga0501035_0000496_14798_15913 | 363 |
| 500 | 3300049823 | Ga0501044_0000857 | Ga0501044_0000857_32462_33577 | 363 |
| 501 | 3300049823 | Ga0501044_0007497 | Ga0501044_0007497_4291_5421 | 363 |
| 502 | 3300049823 | Ga0501044_0141372 | Ga0501044_0141372_938_2095 | 363 |
| 503 | 3300050491 | nmdc:mga00v17_102158_c1 | nmdc:mga00v17_102158_c1_466_1572 | 363 |
| 504 | 3300050493 | nmdc:mga0k408_26711_c1 | nmdc:mga0k408_26711_c1_1920_3026 | 363 |
| 505 | 3300053077 | Ga0495601_0010913 | Ga0495601_0010913_1094_2254 | 363 |
| 506 | 3300053078 | Ga0495612_0022290 | Ga0495612_0022290_266_1426 | 363 |
| 507 | 3300053084 | Ga0495595_0007198 | Ga0495595_0007198_163_1323 | 363 |
| 508 | 3300053085 | Ga0495619_0003147 | Ga0495619_0003147_4323_5483 | 363 |
| 509 | 3300053111 | Ga0500572_000307 | Ga0500572_000307_14003_15130 | 363 |
| 510 | 3300053136 | Ga0500559_0000143 | Ga0500559_0000143_42217_43344 | 363 |
| 511 | 3300060353 | Ga0501082_0000452 | Ga0501082_0000452_12610_13725 | 363 |
| 512 | 3300060353 | Ga0501082_0002875 | Ga0501082_0002875_5786_6889 | 363 |
| 513 | 3300005937 | Ga0081455_10008702 | Ga0081455_100087029 | 364 |
| 514 | 3300006038 | Ga0075365_10075457 | Ga0075365_100754572 | 364 |
| 515 | 3300006051 | Ga0075364_10054123 | Ga0075364_100541233 | 364 |
| 516 | 3300006844 | Ga0075428_100050043 | Ga0075428_1000500434 | 364 |
| 517 | 3300006847 | Ga0075431_100012459 | Ga0075431_1000124594 | 364 |
| 518 | 3300006847 | Ga0075431_100083948 | Ga0075431_1000839483 | 364 |
| 519 | 3300009147 | Ga0114129_10011780 | Ga0114129_100117803 | 364 |
| 520 | 3300037466 | Ga0395898_0102868 | Ga0395898_0102868_1602_2699 | 364 |
| 521 | 3300038443 | Ga0395901_0167889 | Ga0395901_0167889_368_1465 | 364 |
| 522 | 3300049744 | Ga0501083_0023703 | Ga0501083_0023703_947_2050 | 364 |
| 523 | 3300050507 | nmdc:mga05p37_7402_c1 | nmdc:mga05p37_7402_c1_9671_10768 | 364 |
| 524 | 3300050510 | nmdc:mga06r32_197927_c1 | nmdc:mga06r32_197927_c1_532_1629 | 364 |
| 525 | 3300005435 | Ga0070714_100123026 | Ga0070714_1001230263 | 365 |
| 526 | 3300005436 | Ga0070713_100014010 | Ga0070713_1000140103 | 365 |
| 527 | 3300005518 | Ga0070699_100015158 | Ga0070699_1000151584 | 365 |
| 528 | 3300005937 | Ga0081455_10023171 | Ga0081455_100231713 | 365 |
| 529 | 3300005981 | Ga0081538_10037618 | Ga0081538_100376182 | 365 |
| 530 | 3300005983 | Ga0081540_1053208 | Ga0081540_10532082 | 365 |
| 531 | 3300006038 | Ga0075365_10037236 | Ga0075365_100372363 | 365 |
| 532 | 3300006048 | Ga0075363_100038357 | Ga0075363_1000383573 | 365 |
| 533 | 3300006175 | Ga0070712_100015060 | Ga0070712_1000150602 | 365 |
| 534 | 3300006177 | Ga0075362_10009446 | Ga0075362_100094463 | 365 |
| 535 | 3300006178 | Ga0075367_10005992 | Ga0075367_100059924 | 365 |
| 536 | 3300006195 | Ga0075366_10037649 | Ga0075366_100376493 | 365 |
| 537 | 3300006353 | Ga0075370_10009560 | Ga0075370_100095603 | 365 |
| 538 | 3300009147 | Ga0114129_10021519 | Ga0114129_1002151910 | 365 |
| 539 | 3300009147 | Ga0114129_10138611 | Ga0114129_101386113 | 365 |
| 540 | 3300021361 | Ga0213872_10052472 | Ga0213872_100524722 | 365 |
| 541 | 3300025885 | Ga0207653_10006516 | Ga0207653_100065164 | 365 |
| 542 | 3300025910 | Ga0207684_10028032 | Ga0207684_100280323 | 365 |
| 543 | 3300025915 | Ga0207693_10063793 | Ga0207693_100637933 | 365 |
| 544 | 3300035170 | Ga0373943_0078006 | Ga0373943_0078006_22_1233 | 365 |
| 545 | 3300035171 | Ga0373946_0016456 | Ga0373946_0016456_457_1566 | 365 |
| 546 | 3300035725 | Ga0373947_0079108 | Ga0373947_0079108_900_2009 | 365 |
| 547 | 3300046459 | Ga0495629_0149967 | Ga0495629_0149967_70_1179 | 365 |
| 548 | 3300046533 | Ga0495640_0098441 | Ga0495640_0098441_478_1587 | 365 |
| 549 | 3300046642 | Ga0495634_0195751 | Ga0495634_0195751_110_1219 | 365 |
| 550 | 3300048914 | Ga0496111_0293623 | Ga0496111_0293623_55_1155 | 365 |
| 551 | 3300050491 | nmdc:mga00v17_19178_c1 | nmdc:mga00v17_19178_c1_1888_2994 | 365 |
| 552 | 3300050492 | nmdc:mga0yw44_67662_c1 | nmdc:mga0yw44_67662_c1_1073_2179 | 365 |
| 553 | 3300050493 | nmdc:mga0k408_96542_c1 | nmdc:mga0k408_96542_c1_74_1180 | 365 |
| 554 | 3300053134 | Ga0500658_0056259 | Ga0500658_0056259_303_1409 | 365 |
| 555 | 3300001990 | JGI24737J22298_10034618 | JGI24737J22298_100346181 | 366 |
| 556 | 3300001991 | JGI24743J22301_10004622 | JGI24743J22301_100046222 | 366 |
| 557 | 3300002074 | JGI24748J21848_1007608 | JGI24748J21848_10076081 | 366 |
| 558 | 3300002244 | JGI24742J22300_10009931 | JGI24742J22300_100099312 | 366 |
| 559 | 3300005328 | Ga0070676_10107173 | Ga0070676_101071732 | 366 |
| 560 | 3300005334 | Ga0068869_100109077 | Ga0068869_1001090772 | 366 |
| 561 | 3300005337 | Ga0070682_100093095 | Ga0070682_1000930952 | 366 |
| 562 | 3300005338 | Ga0068868_100020698 | Ga0068868_1000206983 | 366 |
| 563 | 3300005343 | Ga0070687_100002547 | Ga0070687_1000025475 | 366 |
| 564 | 3300005347 | Ga0070668_100298091 | Ga0070668_1002980911 | 366 |
| 565 | 3300005354 | Ga0070675_100178375 | Ga0070675_1001783752 | 366 |
| 566 | 3300005355 | Ga0070671_100179998 | Ga0070671_1001799982 | 366 |
| 567 | 3300005367 | Ga0070667_100045667 | Ga0070667_1000456672 | 366 |
| 568 | 3300005438 | Ga0070701_10017803 | Ga0070701_100178032 | 366 |
| 569 | 3300005440 | Ga0070705_100013205 | Ga0070705_1000132054 | 366 |
| 570 | 3300005455 | Ga0070663_100310843 | Ga0070663_1003108431 | 366 |
| 571 | 3300005457 | Ga0070662_100021718 | Ga0070662_1000217181 | 366 |
| 572 | 3300005459 | Ga0068867_100017477 | Ga0068867_1000174772 | 366 |
| 573 | 3300005466 | Ga0070685_10115417 | Ga0070685_101154171 | 366 |
| 574 | 3300005535 | Ga0070684_100020410 | Ga0070684_1000204105 | 366 |
| 575 | 3300005543 | Ga0070672_100019246 | Ga0070672_1000192462 | 366 |
| 576 | 3300005549 | Ga0070704_100051208 | Ga0070704_1000512083 | 366 |
| 577 | 3300005564 | Ga0070664_100048685 | Ga0070664_1000486853 | 366 |
| 578 | 3300005615 | Ga0070702_100015321 | Ga0070702_1000153213 | 366 |
| 579 | 3300005718 | Ga0068866_10054684 | Ga0068866_100546841 | 366 |
| 580 | 3300005719 | Ga0068861_100053725 | Ga0068861_1000537253 | 366 |
| 581 | 3300005834 | Ga0068851_10049434 | Ga0068851_100494342 | 366 |
| 582 | 3300005841 | Ga0068863_100003267 | Ga0068863_1000032674 | 366 |
| 583 | 3300005843 | Ga0068860_100019769 | Ga0068860_1000197696 | 366 |
| 584 | 3300005844 | Ga0068862_100014292 | Ga0068862_1000142926 | 366 |
| 585 | 3300005937 | Ga0081455_10000807 | Ga0081455_100008074 | 366 |
| 586 | 3300005983 | Ga0081540_1001420 | Ga0081540_100142016 | 366 |
| 587 | 3300006175 | Ga0070712_100152838 | Ga0070712_1001528381 | 366 |
| 588 | 3300006237 | Ga0097621_100016628 | Ga0097621_1000166285 | 366 |
| 589 | 3300006871 | Ga0075434_100039954 | Ga0075434_1000399543 | 366 |
| 590 | 3300006871 | Ga0075434_100148985 | Ga0075434_1001489853 | 366 |
| 591 | 3300006881 | Ga0068865_100005250 | Ga0068865_1000052507 | 366 |
| 592 | 3300009098 | Ga0105245_10040069 | Ga0105245_100400692 | 366 |
| 593 | 3300009148 | Ga0105243_10118748 | Ga0105243_101187483 | 366 |
| 594 | 3300009177 | Ga0105248_10053872 | Ga0105248_100538722 | 366 |
| 595 | 3300013297 | Ga0157378_10222994 | Ga0157378_102229943 | 366 |
| 596 | 3300013306 | Ga0163162_10379892 | Ga0163162_103798922 | 366 |
| 597 | 3300014325 | Ga0163163_10258228 | Ga0163163_102582282 | 366 |
| 598 | 3300014968 | Ga0157379_10371411 | Ga0157379_103714111 | 366 |
| 599 | 3300017792 | Ga0163161_10156289 | Ga0163161_101562892 | 366 |
| 600 | 3300025321 | Ga0207656_10078409 | Ga0207656_100784092 | 366 |
| 601 | 3300025901 | Ga0207688_10000724 | Ga0207688_1000072410 | 366 |
| 602 | 3300025904 | Ga0207647_10046855 | Ga0207647_100468552 | 366 |
| 603 | 3300025907 | Ga0207645_10033024 | Ga0207645_100330243 | 366 |
| 604 | 3300025908 | Ga0207643_10002257 | Ga0207643_1000225710 | 366 |
| 605 | 3300025915 | Ga0207693_10109800 | Ga0207693_101098002 | 366 |
| 606 | 3300025917 | Ga0207660_10172850 | Ga0207660_101728501 | 366 |
| 607 | 3300025918 | Ga0207662_10003107 | Ga0207662_100031077 | 366 |
| 608 | 3300025919 | Ga0207657_10042779 | Ga0207657_100427793 | 366 |
| 609 | 3300025925 | Ga0207650_10084967 | Ga0207650_100849673 | 366 |
| 610 | 3300025931 | Ga0207644_10030185 | Ga0207644_100301852 | 366 |
| 611 | 3300025933 | Ga0207706_10002835 | Ga0207706_1000283510 | 366 |
| 612 | 3300025935 | Ga0207709_10233097 | Ga0207709_102330972 | 366 |
| 613 | 3300025937 | Ga0207669_10054654 | Ga0207669_100546543 | 366 |
| 614 | 3300025938 | Ga0207704_10020864 | Ga0207704_100208642 | 366 |
| 615 | 3300025942 | Ga0207689_10003705 | Ga0207689_1000370515 | 366 |
| 616 | 3300025949 | Ga0207667_10262833 | Ga0207667_102628331 | 366 |
| 617 | 3300025960 | Ga0207651_10055364 | Ga0207651_100553643 | 366 |
| 618 | 3300025972 | Ga0207668_10146522 | Ga0207668_101465222 | 366 |
| 619 | 3300025981 | Ga0207640_10255653 | Ga0207640_102556531 | 366 |
| 620 | 3300026023 | Ga0207677_10025117 | Ga0207677_100251173 | 366 |
| 621 | 3300026041 | Ga0207639_10063108 | Ga0207639_100631083 | 366 |
| 622 | 3300026067 | Ga0207678_10003070 | Ga0207678_100030703 | 366 |
| 623 | 3300026075 | Ga0207708_10000416 | Ga0207708_1000041613 | 366 |
| 624 | 3300026118 | Ga0207675_100001268 | Ga0207675_10000126813 | 366 |
| 625 | 3300035170 | Ga0373943_0083101 | Ga0373943_0083101_447_1559 | 366 |
| 626 | 3300035695 | Ga0373927_0056973 | Ga0373927_0056973_972_2084 | 366 |
| 627 | 3300046461 | Ga0495641_0041147 | Ga0495641_0041147_517_1629 | 366 |
| 628 | 3300046473 | Ga0495582_0020761 | Ga0495582_0020761_348_1460 | 366 |
| 629 | 3300046475 | Ga0495639_0029136 | Ga0495639_0029136_1161_2273 | 366 |
| 630 | 3300046492 | Ga0495585_0005858 | Ga0495585_0005858_5588_6700 | 366 |
| 631 | 3300046537 | Ga0495598_0006018 | Ga0495598_0006018_490_1602 | 366 |
| 632 | 3300046558 | Ga0495633_0085906 | Ga0495633_0085906_260_1372 | 366 |
| 633 | 3300046674 | Ga0495588_0031257 | Ga0495588_0031257_1215_2408 | 366 |
| 634 | 3300046683 | Ga0495658_0012702 | Ga0495658_0012702_1354_2466 | 366 |
| 635 | 3300046689 | Ga0495613_0042699 | Ga0495613_0042699_1182_2294 | 366 |
| 636 | 3300046691 | Ga0495670_0016822 | Ga0495670_0016822_1184_2296 | 366 |
| 637 | 3300047321 | Ga0495676_0069561 | Ga0495676_0069561_1341_2453 | 366 |
| 638 | 3300048904 | Ga0496101_0025063 | Ga0496101_0025063_1687_2787 | 366 |
| 639 | 3300048905 | Ga0496102_0267262 | Ga0496102_0267262_81_1181 | 366 |
| 640 | 3300048906 | Ga0496103_0002528 | Ga0496103_0002528_6436_7536 | 366 |
| 641 | 3300048907 | Ga0496104_0002098 | Ga0496104_0002098_7430_8542 | 366 |
| 642 | 3300048908 | Ga0496105_0014700 | Ga0496105_0014700_4700_5800 | 366 |
| 643 | 3300048908 | Ga0496105_0079136 | Ga0496105_0079136_76_1188 | 366 |
| 644 | 3300048909 | Ga0496106_0085154 | Ga0496106_0085154_326_1426 | 366 |
| 645 | 3300048909 | Ga0496106_0113498 | Ga0496106_0113498_187_1299 | 366 |
| 646 | 3300048910 | Ga0496107_0007064 | Ga0496107_0007064_1696_2796 | 366 |
| 647 | 3300048911 | Ga0496108_0006248 | Ga0496108_0006248_3609_4709 | 366 |
| 648 | 3300048912 | Ga0496109_0038535 | Ga0496109_0038535_634_1737 | 366 |
| 649 | 3300048913 | Ga0496110_0013491 | Ga0496110_0013491_1488_2588 | 366 |
| 650 | 3300048914 | Ga0496111_0023099 | Ga0496111_0023099_90_1190 | 366 |
| 651 | 3300048915 | Ga0496112_0028750 | Ga0496112_0028750_3232_4332 | 366 |
| 652 | 3300048916 | Ga0496113_0164925 | Ga0496113_0164925_98_1198 | 366 |
| 653 | 3300048917 | Ga0496114_0066028 | Ga0496114_0066028_971_2071 | 366 |
| 654 | 3300050492 | nmdc:mga0yw44_8401_c1 | nmdc:mga0yw44_8401_c1_4013_5113 | 366 |
| 655 | 3300050492 | nmdc:mga0yw44_8643_c1 | nmdc:mga0yw44_8643_c1_1979_3079 | 366 |
| 656 | 3300050511 | nmdc:mga08y16_66444_c1 | nmdc:mga08y16_66444_c1_791_1891 | 366 |
| 657 | 3300050512 | nmdc:mga0n895_53969_c1 | nmdc:mga0n895_53969_c1_2117_3226 | 366 |
| 658 | 3300053085 | Ga0495619_0178706 | Ga0495619_0178706_85_1185 | 366 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7oyt-assembly1.cif.gz_A | e.coli's putrescine receptor variant potf/d (4jdf) with mutations e39d f88l in complex with spermidine | 0.9804 | 26 | 365 |
| 7oyu-assembly1.cif.gz_A | e.coli's putrescine receptor variant potf/d (4jdf) with mutations e39d y87s f88y in complex with spermidine | 0.9785 | 26 | 365 |
| 7oys-assembly1.cif.gz_A | e.coli's putrescine receptor variant potf/d (4jdf) with mutations e39d y87s in complex with spermidine | 0.977 | 26 | 365 |
| 7oyz-assembly1.cif.gz_A | e.coli's putrescine receptor variant potf/d in complex with spermidine | 0.9763 | 26 | 365 |
| 7oyy-assembly1.cif.gz_A | e.coli's putrescine receptor variant potf/d (4jdf) with mutation s247d in complex with spermidine | 0.975 | 26 | 365 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P31133_32_136_3.40.190.10 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9876 | 29 | 132 | 3.40.190.10 |
| 3ttnB01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9805 | 29 | 332 | 3.40.190.10 |
| af_P31133_137_369_3.40.190.10 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9771 | 134 | 365 | 3.40.190.10 |
| 3ttnB01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9745 | 29 | 332 | 3.40.190.10 |
| af_P31133_32_136_3.40.190.10 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9692 | 29 | 132 | 3.40.190.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5R2MU04-F1-model_v4 | Spermidine/putrescine ABC transporter substrate-binding protein PotF | 0.9975 | 161 | 256 |
GO:0015846
GO:0019808 GO:0042597 |
| AF-A0A3B8TQX5-F1-model_v4 | deleted | 0.9962 | 157 | 268 |
|
| AF-A0A3M4DHW7-F1-model_v4 | deleted | 0.9903 | 71 | 366 |
|
| AF-A0A7Y2KZL3-F1-model_v4 | Extracellular solute-binding protein | 0.9889 | 176 | 366 |
GO:0015846
GO:0019808 GO:0042597 |
| AF-A0A4Q6C456-F1-model_v4 | Extracellular solute-binding protein | 0.9879 | 74 | 366 |
GO:0015846
GO:0019808 GO:0042597 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar