F473088

General Info

Members Datasets Scaffolds Average Seq Length
657 279 657 519

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10037248|Ga0111539_100372482
Length 576
Sequence LQQQALSNGTAFVPFRICRGETIMRRVFLIVLVAGVVTSSPLWAQNSSGQGQAQTQPPVETKAERMATATYWGDTGLWFVPTAEVVRPKGWSISAYRTEFDFRQGLTDVSDFPVTVAAGAGPRLEIFGALRVVTRIDRDTRPLFQATDTSEGGLTNDRPFVNSTWTGNQLGDLYLGAKGNLLSEGVQQPLALAVRGTVKLPTADKDKGAGTGEYDYFADVVLSKELARRVEITGFTGMAWRGDPDGVNLSDGWRWGFGAAFGARSNLRFTTEIFGEESFENDVIAQPGVVTGVDGSISPVISALDQGTTSVFGLTWQHSSGVSLGVAGSYQSGLDLPSGEGSRGWGMQFRMGFHRGVRVFVPPAPRFVGGLAPERGPSVKAQCDPCRVEVGKTSSITATSNDPDGDSVQYQWKTAAGTLADTRAASTVWTAETRPGTVALTVTADDGKGGLATDTVNIEVFRRALMFGEVHFDLDESVLRPEARTVLDQAARTLKENPDVHVQIEGHTSEEASAEYNQALGSRRAQAVREYLVKQGVEASRLDTISYGKTRPKYDNSKEETRRLNRRADLVVEDGK

Samples

Sample ID Description Type Environment
1 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
2 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
10 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
12 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
13 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
14 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
15 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
41 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
42 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
43 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
51 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
146 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
150 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
151 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
152 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
153 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
154 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
155 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
156 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
157 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
158 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
159 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
160 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
161 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
162 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
163 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
164 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
165 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
166 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
167 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
168 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
169 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
171 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
172 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
173 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
174 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
175 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
176 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
177 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
178 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
179 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
180 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
181 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
182 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
183 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
184 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
185 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
186 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
187 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
188 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
189 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
190 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
191 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
192 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
193 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
194 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
195 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
196 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
197 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
198 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
199 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
200 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
201 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
202 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
203 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
204 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
205 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
206 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
207 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
223 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
224 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
225 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
226 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
227 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
228 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
229 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
230 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
231 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
232 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
233 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
234 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
235 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
236 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
239 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
240 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
241 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
242 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
243 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
244 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
245 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
246 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
247 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
248 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
249 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
250 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
251 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
252 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
253 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
254 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
255 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
256 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
257 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
258 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
259 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
260 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
261 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
262 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
263 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
264 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
265 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
266 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
267 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
268 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
269 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
270 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
271 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
272 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
273 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
274 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
275 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
276 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
277 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
278 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
279 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.85
Metatranscriptomes 7.15
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.52
Nodule 0
Rhizoplane 2.89
Rhizosphere 94.82
Stem 0
Stem Tuber 0
Unclassified 0.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10009595 3300002459 Bacteria 1992
2 Ga0006778J45830_1035146 3300003162 Bacteria 2647
3 Ga0006759J45824_1031218 3300003163 Bacteria 2289
4 Ga0007417J51691_1028357 3300003544 Bacteria 2236
5 Ga0007410J51695_1016549 3300003574 Bacteria 2293
6 Ga0007409J51694_1020425 3300003575 Bacteria 2286
7 Ga0007416J51690_1013267 3300003577 Bacteria 2284
8 Ga0007416J51690_1013494 3300003577 Bacteria 2771
9 Ga0007416J51690_1020095 3300003577 Bacteria 2277
10 Ga0007416J51690_1031937 3300003577 Bacteria 2231
11 Ga0032354_1004787 3300003693 Bacteria 2343
12 Ga0032354_1006421 3300003693 Bacteria 2600
13 Ga0032354_1045718 3300003693 Bacteria 2219
14 Ga0058859_10104188 3300004798 Unclassified 1884
15 Ga0058863_10034124 3300004799 Bacteria 2805
16 Ga0058861_11984001 3300004800 Bacteria 2337
17 Ga0058860_10004412 3300004801 Bacteria 2344
18 Ga0058860_10047880 3300004801 Bacteria 2260
19 Ga0058860_10070698 3300004801 Bacteria 2279
20 Ga0058860_12181476 3300004801 Unclassified 2033
21 Ga0058862_12893455 3300004803 Bacteria 2453
22 Ga0065712_10067993 3300005290 Bacteria 17664
23 Ga0065715_10090070 3300005293 Bacteria 7744
24 Ga0065707_10083167 3300005295 Bacteria 10134
25 Ga0070658_10020720 3300005327 Bacteria 5267
26 Ga0070676_10022394 3300005328 Bacteria 3542
27 Ga0070683_100000059 3300005329 Bacteria 81605
28 Ga0070683_100003662 3300005329 Bacteria 12525
29 Ga0070670_100009033 3300005331 Bacteria 8515
30 Ga0070670_100022034 3300005331 Bacteria 5483
31 Ga0070670_100023242 3300005331 Bacteria 5336
32 Ga0070670_100066580 3300005331 Bacteria 3091
33 Ga0070666_10016095 3300005335 Bacteria 4779
34 Ga0070666_10047193 3300005335 Bacteria 2891
35 Ga0070680_100041770 3300005336 Bacteria 3719
36 Ga0070680_100143461 3300005336 Bacteria 2003
37 Ga0070660_100047168 3300005339 Bacteria 3305
38 Ga0070660_100066652 3300005339 Bacteria 2803
39 Ga0070689_100034367 3300005340 Bacteria 3867
40 Ga0070689_100076412 3300005340 Bacteria 2623
41 Ga0070691_10014987 3300005341 Bacteria 3560
42 Ga0070687_100006711 3300005343 Bacteria 4739
43 Ga0070661_100104122 3300005344 Bacteria 2114
44 Ga0070668_100066077 3300005347 Bacteria 2806
45 Ga0070669_100025468 3300005353 Bacteria 4249
46 Ga0070669_100070750 3300005353 Bacteria 2580
47 Ga0070675_100000033 3300005354 Bacteria 94281
48 Ga0070675_100001858 3300005354 Bacteria 15576
49 Ga0070675_100002124 3300005354 Bacteria 14642
50 Ga0070675_100028899 3300005354 Bacteria 4467
51 Ga0070675_100043940 3300005354 Bacteria 3654
52 Ga0070675_100178210 3300005354 Bacteria 1836
53 Ga0070671_100009207 3300005355 Bacteria 7931
54 Ga0070671_100015606 3300005355 Bacteria 6137
55 Ga0070671_100062713 3300005355 Bacteria 3095
56 Ga0070674_100010219 3300005356 Bacteria 5662
57 Ga0070673_100001301 3300005364 Bacteria 14537
58 Ga0070673_100013792 3300005364 Bacteria 5606
59 Ga0070673_100026380 3300005364 Bacteria 4290
60 Ga0070673_100036998 3300005364 Bacteria 3715
61 Ga0070673_100085693 3300005364 Bacteria 2565
62 Ga0070688_100020510 3300005365 Bacteria 3844
63 Ga0070659_100030340 3300005366 Bacteria 4184
64 Ga0070667_100015415 3300005367 Bacteria 6319
65 Ga0070667_100047841 3300005367 Bacteria 3599
66 Ga0070667_100076368 3300005367 Bacteria 2860
67 Ga0070667_100077401 3300005367 Bacteria 2840
68 Ga0070667_100162181 3300005367 Bacteria 1970
69 Ga0070709_10091572 3300005434 Unclassified 2007
70 Ga0070714_100013434 3300005435 Bacteria 6562
71 Ga0070713_100038745 3300005436 Unclassified 3865
72 Ga0070713_100061646 3300005436 Unclassified 3138
73 Ga0070701_10006600 3300005438 Bacteria 4894
74 Ga0070701_10015399 3300005438 Bacteria 3531
75 Ga0070711_100040437 3300005439 Unclassified 3145
76 Ga0070705_100014159 3300005440 Bacteria 4098
77 Ga0070700_100041058 3300005441 Unclassified 2835
78 Ga0070700_100050380 3300005441 Bacteria 2588
79 Ga0070663_100017284 3300005455 Bacteria 4704
80 Ga0070663_100038053 3300005455 Bacteria 3353
81 Ga0070678_100009865 3300005456 Bacteria 5805
82 Ga0070678_100046932 3300005456 Bacteria 3101
83 Ga0070678_100123059 3300005456 Bacteria 2049
84 Ga0070662_100122927 3300005457 Bacteria 1991
85 Ga0070681_10193788 3300005458 Unclassified 1951
86 Ga0068867_100039474 3300005459 Bacteria 3442
87 Ga0068867_100044322 3300005459 Bacteria 3259
88 Ga0070685_10045828 3300005466 Bacteria 2509
89 Ga0070685_10067350 3300005466 Bacteria 2112
90 Ga0070698_100049353 3300005471 Bacteria 4296
91 Ga0070698_100120713 3300005471 Bacteria 2582
92 Ga0070698_100192018 3300005471 Bacteria 1979
93 Ga0070699_100005625 3300005518 Bacteria 10990
94 Ga0070699_100024264 3300005518 Bacteria 5224
95 Ga0070699_100093606 3300005518 Bacteria 2629
96 Ga0070679_100138153 3300005530 Bacteria 2418
97 Ga0070679_100146066 3300005530 Bacteria 2343
98 Ga0070679_100164783 3300005530 Bacteria 2190
99 Ga0070686_100000149 3300005544 Bacteria 47841
100 Ga0070686_100024951 3300005544 Bacteria 3589
101 Ga0070686_100075395 3300005544 Bacteria 2219
102 Ga0070695_100078438 3300005545 Bacteria 2178
103 Ga0070696_100012815 3300005546 Bacteria 5628
104 Ga0070693_100013639 3300005547 Bacteria 4144
105 Ga0070693_100026698 3300005547 Bacteria 3120
106 Ga0070665_100113684 3300005548 Bacteria 2710
107 Ga0070704_100008604 3300005549 Bacteria 6131
108 Ga0070704_100038820 3300005549 Bacteria 3265
109 Ga0068855_100088768 3300005563 Bacteria 3571
110 Ga0070664_100205560 3300005564 Bacteria 1758
111 Ga0068857_100046481 3300005577 Bacteria 3852
112 Ga0068852_100074866 3300005616 Bacteria 2984
113 Ga0068859_100009968 3300005617 Bacteria 9585
114 Ga0068859_100067301 3300005617 Bacteria 3616
115 Ga0068859_100096400 3300005617 Unclassified 3011
116 Ga0068859_100098545 3300005617 Bacteria 2977
117 Ga0068864_100028057 3300005618 Bacteria 4757
118 Ga0068864_100084020 3300005618 Bacteria 2797
119 Ga0068863_100113371 3300005841 Bacteria 2582
120 Ga0068858_100002991 3300005842 Bacteria 16949
121 Ga0068858_100164348 3300005842 Bacteria 2091
122 Ga0068860_100070741 3300005843 Bacteria 3317
123 Ga0068862_100006534 3300005844 Bacteria 9675
124 Ga0068862_100009105 3300005844 Bacteria 8218
125 Ga0068862_100033033 3300005844 Bacteria 4371
126 Ga0081455_10075493 3300005937 Bacteria 2780
127 Ga0081539_10044591 3300005985 Bacteria 2558
128 Ga0070717_10174215 3300006028 Bacteria 1872
129 Ga0097621_100005522 3300006237 Bacteria 8906
130 Ga0097621_100011722 3300006237 Bacteria 6472
131 Ga0097621_100012231 3300006237 Bacteria 6352
132 Ga0097621_100095458 3300006237 Bacteria 2494
133 Ga0075370_10004647 3300006353 Bacteria 6694
134 Ga0068871_100004321 3300006358 Bacteria 9870
135 Ga0068871_100058588 3300006358 Unclassified 3136
136 Ga0068871_100094550 3300006358 Bacteria 2495
137 Ga0075428_100000007 3300006844 Bacteria 273226
138 Ga0075428_100003534 3300006844 Bacteria 17121
139 Ga0075428_100061501 3300006844 Bacteria 4113
140 Ga0075428_100095734 3300006844 Bacteria 3237
141 Ga0075428_100103065 3300006844 Bacteria 3112
142 Ga0075428_100138284 3300006844 Bacteria 2648
143 Ga0075428_100185395 3300006844 Bacteria 2252
144 Ga0075430_100003772 3300006846 Bacteria 12732
145 Ga0075430_100006037 3300006846 Bacteria 10215
146 Ga0075430_100040384 3300006846 Bacteria 3949
147 Ga0075431_100007345 3300006847 Bacteria 10976
148 Ga0075431_100114538 3300006847 Bacteria 2783
149 Ga0075431_100191097 3300006847 Bacteria 2098
150 Ga0075433_10022542 3300006852 Bacteria 5286
151 Ga0075433_10051074 3300006852 Bacteria 3600
152 Ga0075433_10057140 3300006852 Bacteria 3410
153 Ga0075433_10083731 3300006852 Bacteria 2815
154 Ga0075433_10090207 3300006852 Bacteria 2709
155 Ga0075434_100004677 3300006871 Bacteria 12369
156 Ga0075434_100028466 3300006871 Bacteria 5489
157 Ga0075434_100095782 3300006871 Bacteria 2973
158 Ga0075434_100145371 3300006871 Bacteria 2391
159 Ga0075434_100182991 3300006871 Bacteria 2116
160 Ga0075429_100002051 3300006880 Bacteria 16774
161 Ga0075429_100017665 3300006880 Bacteria 6169
162 Ga0075429_100018790 3300006880 Bacteria 5986
163 Ga0075429_100051087 3300006880 Unclassified 3597
164 Ga0068865_100016927 3300006881 Bacteria 4677
165 Ga0075436_100009468 3300006914 Bacteria 6660
166 Ga0097620_100009967 3300006931 Bacteria 9585
167 Ga0097620_100067301 3300006931 Bacteria 3616
168 Ga0097620_100096401 3300006931 Unclassified 3011
169 Ga0097620_100098537 3300006931 Bacteria 2977
170 Ga0075435_100000227 3300007076 Bacteria 34362
171 Ga0075435_100017470 3300007076 Bacteria 5432
172 Ga0075435_100024331 3300007076 Bacteria 4698
173 Ga0105240_10051258 3300009093 Bacteria 5196
174 Ga0105240_10096617 3300009093 Bacteria 3600
175 Ga0105240_10119947 3300009093 Bacteria 3168
176 Ga0111539_10000009 3300009094 Bacteria 375223
177 Ga0111539_10000763 3300009094 Bacteria 41920
178 Ga0111539_10001752 3300009094 Bacteria 28822
179 Ga0111539_10004701 3300009094 Bacteria 17852
180 Ga0111539_10008025 3300009094 Bacteria 13466
181 Ga0111539_10010653 3300009094 Bacteria 11579
182 Ga0111539_10019674 3300009094 Bacteria 8327
183 Ga0111539_10020021 3300009094 Bacteria 8243
184 Ga0111539_10037248 3300009094 Bacteria 5876
185 Ga0111539_10038002 3300009094 Bacteria 5807
186 Ga0111539_10134974 3300009094 Bacteria 2890
187 Ga0105245_10039025 3300009098 Bacteria 4227
188 Ga0114129_10001838 3300009147 Bacteria 28894
189 Ga0114129_10002040 3300009147 Bacteria 27709
190 Ga0114129_10002681 3300009147 Bacteria 24774
191 Ga0114129_10002887 3300009147 Bacteria 24054
192 Ga0114129_10005748 3300009147 Bacteria 17574
193 Ga0114129_10006089 3300009147 Bacteria 17102
194 Ga0114129_10006486 3300009147 Bacteria 16598
195 Ga0114129_10012628 3300009147 Bacteria 12025
196 Ga0114129_10013889 3300009147 Bacteria 11476
197 Ga0114129_10021939 3300009147 Bacteria 9061
198 Ga0114129_10034701 3300009147 Bacteria 7126
199 Ga0114129_10044664 3300009147 Bacteria 6233
200 Ga0114129_10058479 3300009147 Bacteria 5392
201 Ga0114129_10098361 3300009147 Archaea 4050
202 Ga0114129_10126228 3300009147 Bacteria 3517
203 Ga0114129_10255095 3300009147 Bacteria 2353
204 Ga0105243_10010061 3300009148 Bacteria 7192
205 Ga0105243_10014062 3300009148 Bacteria 6057
206 Ga0105242_10014843 3300009176 Bacteria 6034
207 Ga0105242_10018202 3300009176 Bacteria 5489
208 Ga0105242_10020330 3300009176 Bacteria 5206
209 Ga0105242_10023819 3300009176 Bacteria 4830
210 Ga0105242_10102061 3300009176 Unclassified 2432
211 Ga0105248_10003067 3300009177 Bacteria 18526
212 Ga0105248_10005629 3300009177 Bacteria 13754
213 Ga0105248_10022958 3300009177 Bacteria 6928
214 Ga0105248_10027631 3300009177 Bacteria 6319
215 Ga0105248_10033643 3300009177 Bacteria 5727
216 Ga0105248_10047058 3300009177 Bacteria 4837
217 Ga0105248_10067215 3300009177 Bacteria 4024
218 Ga0105248_10100656 3300009177 Bacteria 3257
219 Ga0105237_10186657 3300009545 Bacteria 2073
220 Ga0105238_10102382 3300009551 Bacteria 2845
221 Ga0105249_10043569 3300009553 Bacteria 4081
222 Ga0105249_10106280 3300009553 Bacteria 2648
223 Ga0105239_10206816 3300010375 Bacteria 2199
224 Ga0157374_10048760 3300013296 Bacteria 3931
225 Ga0157375_10123905 3300013308 Bacteria 2697
226 Ga0163163_10000013 3300014325 Bacteria 242522
227 Ga0163163_10021804 3300014325 Bacteria 6051
228 Ga0157380_10001836 3300014326 Bacteria 14034
229 Ga0157380_10002997 3300014326 Bacteria 11503
230 Ga0157380_10005365 3300014326 Bacteria 8955
231 Ga0157380_10007605 3300014326 Bacteria 7701
232 Ga0157380_10016008 3300014326 Bacteria 5522
233 Ga0157380_10046959 3300014326 Bacteria 3394
234 Ga0157379_10052075 3300014968 Bacteria 3656
235 Ga0157376_10014296 3300014969 Bacteria 5953
236 Ga0157376_10045942 3300014969 Bacteria 3598
237 Ga0206356_10089078 3300020070 Bacteria 2453
238 Ga0206356_10818170 3300020070 Bacteria 2551
239 Ga0206356_10872851 3300020070 Bacteria 2372
240 Ga0206350_10488288 3300020080 Bacteria 2482
241 Ga0206350_11054261 3300020080 Bacteria 2435
242 Ga0206354_10781424 3300020081 Bacteria 2718
243 Ga0224712_10014336 3300022467 Bacteria 2549
244 Ga0224712_10017077 3300022467 Bacteria 2399
245 Ga0207697_10010765 3300025315 Bacteria 3896
246 Ga0207645_10002364 3300025907 Bacteria 14882
247 Ga0207643_10043937 3300025908 Unclassified 2522
248 Ga0207705_10125308 3300025909 Bacteria 1909
249 Ga0207684_10132789 3300025910 Bacteria 2137
250 Ga0207695_10025538 3300025913 Bacteria 6611
251 Ga0207695_10137046 3300025913 Bacteria 2400
252 Ga0207671_10084770 3300025914 Bacteria 2380
253 Ga0207660_10051265 3300025917 Bacteria 2934
254 Ga0207660_10131672 3300025917 Bacteria 1904
255 Ga0207662_10002541 3300025918 Bacteria 9186
256 Ga0207662_10019813 3300025918 Bacteria 3834
257 Ga0207657_10053562 3300025919 Bacteria 3495
258 Ga0207649_10050275 3300025920 Bacteria 2578
259 Ga0207649_10093603 3300025920 Bacteria 1972
260 Ga0207652_10012813 3300025921 Bacteria 6780
261 Ga0207652_10164609 3300025921 Bacteria 1988
262 Ga0207646_10032768 3300025922 Bacteria 4701
263 Ga0207681_10007797 3300025923 Bacteria 6556
264 Ga0207650_10023408 3300025925 Bacteria 4380
265 Ga0207650_10083044 3300025925 Bacteria 2433
266 Ga0207659_10000196 3300025926 Bacteria 35986
267 Ga0207659_10000202 3300025926 Bacteria 35629
268 Ga0207659_10004899 3300025926 Bacteria 8108
269 Ga0207659_10030853 3300025926 Bacteria 3665
270 Ga0207659_10083354 3300025926 Bacteria 2370
271 Ga0207700_10006978 3300025928 Bacteria 6872
272 Ga0207644_10023604 3300025931 Bacteria 4215
273 Ga0207690_10039956 3300025932 Bacteria 3064
274 Ga0207690_10084519 3300025932 Bacteria 2225
275 Ga0207706_10082047 3300025933 Bacteria 2834
276 Ga0207706_10155877 3300025933 Bacteria 2008
277 Ga0207670_10005956 3300025936 Bacteria 6731
278 Ga0207669_10007991 3300025937 Bacteria 4939
279 Ga0207704_10003166 3300025938 Bacteria 7446
280 Ga0207691_10005565 3300025940 Bacteria 12171
281 Ga0207691_10014038 3300025940 Bacteria 7642
282 Ga0207691_10030433 3300025940 Bacteria 5044
283 Ga0207691_10038623 3300025940 Bacteria 4418
284 Ga0207691_10164204 3300025940 Bacteria 1947
285 Ga0207711_10007837 3300025941 Bacteria 8928
286 Ga0207711_10050134 3300025941 Bacteria 3574
287 Ga0207711_10051810 3300025941 Unclassified 3517
288 Ga0207711_10093023 3300025941 Bacteria 2655
289 Ga0207711_10111373 3300025941 Bacteria 2435
290 Ga0207661_10012004 3300025944 Bacteria 6294
291 Ga0207661_10141119 3300025944 Bacteria 2074
292 Ga0207679_10051639 3300025945 Bacteria 3010
293 Ga0207651_10001095 3300025960 Bacteria 12032
294 Ga0207651_10005371 3300025960 Bacteria 6572
295 Ga0207651_10050208 3300025960 Bacteria 2831
296 Ga0207658_10149259 3300025986 Bacteria 1902
297 Ga0207703_10004978 3300026035 Bacteria 10782
298 Ga0207703_10025184 3300026035 Bacteria 4680
299 Ga0207703_10068158 3300026035 Bacteria 2931
300 Ga0207639_10092276 3300026041 Bacteria 2427
301 Ga0207678_10018364 3300026067 Bacteria 6141
302 Ga0207678_10101618 3300026067 Bacteria 2455
303 Ga0207708_10002436 3300026075 Bacteria 13672
304 Ga0207708_10019848 3300026075 Bacteria 5067
305 Ga0207641_10002265 3300026088 Bacteria 17941
306 Ga0207648_10052603 3300026089 Bacteria 3561
307 Ga0207648_10055729 3300026089 Bacteria 3450
308 Ga0207676_10107685 3300026095 Bacteria 2325
309 Ga0207674_10034434 3300026116 Bacteria 5293
310 Ga0207674_10108335 3300026116 Unclassified 2755
311 Ga0207675_100023705 3300026118 Bacteria 5709
312 Ga0207675_100039295 3300026118 Bacteria 4417
313 Ga0207675_100085609 3300026118 Bacteria 2958
314 Ga0207683_10018931 3300026121 Bacteria 5874
315 Ga0207683_10036135 3300026121 Bacteria 4299
316 Ga0207683_10038678 3300026121 Bacteria 4160
317 Ga0207683_10060044 3300026121 Bacteria 3341
318 Ga0207428_10000022 3300027907 Bacteria 273333
319 Ga0207428_10000294 3300027907 Bacteria 66640
320 Ga0207428_10002348 3300027907 Bacteria 18901
321 Ga0207428_10002363 3300027907 Bacteria 18844
322 Ga0207428_10008328 3300027907 Bacteria 9369
323 Ga0207428_10008515 3300027907 Bacteria 9258
324 Ga0207428_10009454 3300027907 Bacteria 8734
325 Ga0207428_10021150 3300027907 Bacteria 5510
326 Ga0207428_10028461 3300027907 Bacteria 4643
327 Ga0207428_10042173 3300027907 Bacteria 3690
328 Ga0207428_10086058 3300027907 Bacteria 2447
329 Ga0268266_10017050 3300028379 Bacteria 6203
330 Ga0268266_10182583 3300028379 Unclassified 1911
331 Ga0268265_10013164 3300028380 Bacteria 5620
332 Ga0268265_10021852 3300028380 Bacteria 4489
333 Ga0268264_10048412 3300028381 Bacteria 3536
334 Ga0268264_10087530 3300028381 Bacteria 2678
335 Ga0307408_100009645 3300031548 Bacteria 6365
336 Ga0307408_100016732 3300031548 Bacteria 4901
337 Ga0307413_10052123 3300031824 Bacteria 2470
338 Ga0307409_100003509 3300031995 Bacteria 8542
339 Ga0307409_100054892 3300031995 Bacteria 3072
340 Ga0307409_100063883 3300031995 Bacteria 2889
341 Ga0307416_100019252 3300032002 Bacteria 4835
342 Ga0307416_100019338 3300032002 Bacteria 4826
343 Ga0307416_100038333 3300032002 Bacteria 3697
344 Ga0307416_100049923 3300032002 Unclassified 3330
345 Ga0307416_100064890 3300032002 Bacteria 2998
346 Ga0307416_100073635 3300032002 Bacteria 2849
347 Ga0307411_10017014 3300032005 Bacteria 4130
348 Ga0373959_0001827 3300034820 Bacteria 3393
349 Ga0373929_0000084 3300035085 Bacteria 15719
350 Ga0373934_0020319 3300035086 Bacteria 2551
351 Ga0373949_0000458 3300035090 Bacteria 14051
352 Ga0373951_0004686 3300035091 Bacteria 3232
353 Ga0373932_0003788 3300035112 Bacteria 3607
354 Ga0373941_0000491 3300035115 Bacteria 7918
355 Ga0373956_0016396 3300035119 Bacteria 3112
356 Ga0373960_0001976 3300035121 Bacteria 4594
357 Ga0373943_0012876 3300035170 Bacteria 3771
358 Ga0373943_0057749 3300035170 Bacteria 1929
359 Ga0373946_0057414 3300035171 Unclassified 1646
360 Ga0373955_0012621 3300035172 Bacteria 4064
361 Ga0373961_0005974 3300035241 Bacteria 2923
362 Ga0373931_0000748 3300035691 Bacteria 13548
363 Ga0373931_0084222 3300035691 Bacteria 1760
364 Ga0373935_0026577 3300035692 Unclassified 3574
365 Ga0373937_0000965 3300036401 Bacteria 24394
366 Ga0373937_0066997 3300036401 Bacteria 3308
367 Ga0373925_0003186 3300037068 Bacteria 12828
368 Ga0439461_0012781 3300041410 Bacteria 1576
369 Ga0439431_0004697 3300041997 Bacteria 3005
370 Ga0439449_0025026 3300042007 Bacteria 2231
371 Ga0439450_008299 3300042008 Bacteria 1935
372 Ga0450896_002431 3300042133 Bacteria 2401
373 Ga0439446_0001479 3300042156 Bacteria 5367
374 Ga0439446_0012122 3300042156 Bacteria 2351
375 Ga0439434_0012064 3300042435 Bacteria 2555
376 Ga0439435_0008790 3300042436 Bacteria 2353
377 Ga0439435_0012655 3300042436 Bacteria 2049
378 Ga0451577_0116561 3300042876 Bacteria 2392
379 Ga0453684_0298900 3300044712 Unclassified 1830
380 Ga0451576_0007358 3300045051 Bacteria 13194
381 Ga0451576_0121337 3300045051 Bacteria 2721
382 Ga0495638_0004431 3300046460 Bacteria 10632
383 Ga0495653_0005429 3300046463 Bacteria 10381
384 Ga0495608_0003942 3300046511 Bacteria 10667
385 Ga0495628_0021148 3300046516 Bacteria 5357
386 Ga0495587_0051732 3300046536 Bacteria 2427
387 Ga0495645_0010462 3300046543 Bacteria 6504
388 Ga0495667_0084520 3300046559 Bacteria 2060
389 Ga0495647_0011264 3300046681 Bacteria 3062
390 Ga0495658_0015421 3300046683 Unclassified 3920
391 Ga0495658_0060204 3300046683 Unclassified 2177
392 Ga0495658_0078170 3300046683 Bacteria 1936
393 Ga0495669_0007347 3300046684 Bacteria 4616
394 Ga0495613_0001676 3300046689 Bacteria 16870
395 Ga0495680_0142187 3300047322 Bacteria 1755
396 Ga0495684_0002679 3300047471 Bacteria 14108
397 Ga0495602_0086955 3300048088 Bacteria 2608
398 Ga0496101_0002334 3300048904 Bacteria 11628
399 Ga0496101_0055336 3300048904 Bacteria 2866
400 Ga0496102_0145594 3300048905 Bacteria 2224
401 Ga0496102_0238289 3300048905 Bacteria 1716
402 Ga0496104_0017896 3300048907 Bacteria 6461
403 Ga0496105_0017872 3300048908 Bacteria 5690
404 Ga0496106_0139339 3300048909 Bacteria 1907
405 Ga0496107_0038142 3300048910 Bacteria 3448
406 Ga0496108_0001529 3300048911 Bacteria 18316
407 Ga0496108_0007619 3300048911 Bacteria 8767
408 Ga0496109_0079309 3300048912 Bacteria 3025
409 Ga0496111_0010159 3300048914 Bacteria 6303
410 Ga0496112_0001657 3300048915 Bacteria 17310
411 Ga0496112_0018705 3300048915 Bacteria 6530
412 Ga0496112_0035087 3300048915 Bacteria 4882
413 Ga0496112_0077562 3300048915 Bacteria 3286
414 Ga0496112_0241470 3300048915 Bacteria 1759
415 Ga0496114_0000913 3300048917 Bacteria 22113
416 Ga0496114_0143698 3300048917 Bacteria 2067
417 Ga0501031_0001226 3300049568 Bacteria 15706
418 Ga0501031_0010460 3300049568 Bacteria 6043
419 Ga0501031_0012051 3300049568 Bacteria 5636
420 Ga0501031_0108255 3300049568 Bacteria 1814
421 Ga0501032_0024275 3300049569 Bacteria 4187
422 Ga0501032_0044638 3300049569 Bacteria 2999
423 Ga0501033_0003900 3300049570 Bacteria 12124
424 Ga0501033_0012408 3300049570 Bacteria 6503
425 Ga0501033_0035764 3300049570 Bacteria 3723
426 Ga0501034_0006507 3300049571 Bacteria 12562
427 Ga0501034_0010668 3300049571 Bacteria 9548
428 Ga0501034_0041541 3300049571 Bacteria 4653
429 Ga0501036_0004166 3300049572 Bacteria 11640
430 Ga0501036_0009652 3300049572 Bacteria 7940
431 Ga0501036_0042173 3300049572 Bacteria 3863
432 Ga0501036_0048668 3300049572 Unclassified 3589
433 Ga0501036_0076618 3300049572 Bacteria 2829
434 Ga0501036_0087865 3300049572 Bacteria 2627
435 Ga0501037_0012782 3300049573 Bacteria 6185
436 Ga0501037_0021613 3300049573 Bacteria 4757
437 Ga0501037_0055376 3300049573 Bacteria 2900
438 Ga0501037_0136856 3300049573 Bacteria 1754
439 Ga0501038_0003687 3300049574 Bacteria 14268
440 Ga0501038_0003987 3300049574 Bacteria 13704
441 Ga0501038_0005770 3300049574 Bacteria 11465
442 Ga0501038_0039366 3300049574 Bacteria 4134
443 Ga0501038_0075564 3300049574 Bacteria 2847
444 Ga0501039_0015015 3300049575 Bacteria 5925
445 Ga0501039_0035877 3300049575 Bacteria 3827
446 Ga0501039_0037349 3300049575 Bacteria 3748
447 Ga0501039_0060303 3300049575 Unclassified 2938
448 Ga0501040_0038476 3300049576 Unclassified 3252
449 Ga0501040_0044809 3300049576 Bacteria 3016
450 Ga0501040_0088365 3300049576 Bacteria 2152
451 Ga0501040_0092029 3300049576 Bacteria 2108
452 Ga0501040_0099139 3300049576 Bacteria 2031
453 Ga0501041_0012056 3300049577 Bacteria 5116
454 Ga0501041_0053020 3300049577 Bacteria 2473
455 Ga0501041_0072104 3300049577 Bacteria 2121
456 Ga0501042_0000551 3300049578 Bacteria 19742
457 Ga0501042_0002232 3300049578 Bacteria 11828
458 Ga0501043_0002195 3300049579 Bacteria 16639
459 Ga0501043_0096988 3300049579 Bacteria 2318
460 Ga0501043_0123373 3300049579 Bacteria 2031
461 Ga0501046_0023381 3300049580 Bacteria 5086
462 Ga0501046_0054796 3300049580 Bacteria 3135
463 Ga0501046_0078290 3300049580 Bacteria 2557
464 Ga0501046_0090356 3300049580 Bacteria 2356
465 Ga0501047_0002381 3300049581 Bacteria 17984
466 Ga0501047_0002980 3300049581 Bacteria 16060
467 Ga0501048_0010204 3300049582 Bacteria 7022
468 Ga0501048_0014220 3300049582 Bacteria 5895
469 Ga0501048_0028312 3300049582 Bacteria 4066
470 Ga0501048_0029438 3300049582 Unclassified 3983
471 Ga0501048_0077740 3300049582 Bacteria 2342
472 Ga0501067_0002412 3300049583 Bacteria 10335
473 Ga0501067_0004704 3300049583 Bacteria 7554
474 Ga0501067_0038604 3300049583 Bacteria 2651
475 Ga0501067_0054491 3300049583 Bacteria 2216
476 Ga0501068_0005054 3300049584 Bacteria 7187
477 Ga0501068_0023174 3300049584 Bacteria 3636
478 Ga0501068_0095723 3300049584 Bacteria 1836
479 Ga0501069_0012427 3300049585 Bacteria 4525
480 Ga0501069_0025233 3300049585 Bacteria 3247
481 Ga0501070_0022289 3300049586 Bacteria 5307
482 Ga0501071_0008094 3300049587 Bacteria 6932
483 Ga0501071_0008546 3300049587 Bacteria 6773
484 Ga0501071_0049453 3300049587 Bacteria 3027
485 Ga0501071_0075220 3300049587 Bacteria 2465
486 Ga0501071_0090619 3300049587 Bacteria 2245
487 Ga0501072_0016347 3300049588 Bacteria 5693
488 Ga0501072_0026113 3300049588 Bacteria 4551
489 Ga0501072_0027598 3300049588 Bacteria 4429
490 Ga0501072_0040448 3300049588 Bacteria 3661
491 Ga0501072_0047397 3300049588 Bacteria 3385
492 Ga0501072_0050134 3300049588 Bacteria 3287
493 Ga0501072_0155842 3300049588 Bacteria 1821
494 Ga0501073_0000524 3300049589 Bacteria 26883
495 Ga0501073_0058951 3300049589 Bacteria 2682
496 Ga0501073_0131029 3300049589 Bacteria 1738
497 Ga0501074_0009117 3300049590 Bacteria 7206
498 Ga0501074_0011828 3300049590 Bacteria 6344
499 Ga0501074_0012875 3300049590 Bacteria 6082
500 Ga0501074_0080579 3300049590 Bacteria 2335
501 Ga0501074_0086484 3300049590 Bacteria 2246
502 Ga0501074_0093862 3300049590 Bacteria 2149
503 Ga0501074_0117873 3300049590 Bacteria 1899
504 Ga0501074_0134007 3300049590 Bacteria 1772
505 Ga0501075_0027261 3300049591 Bacteria 4210
506 Ga0501075_0033760 3300049591 Bacteria 3807
507 Ga0501075_0043394 3300049591 Unclassified 3373
508 Ga0501075_0044534 3300049591 Bacteria 3329
509 Ga0501075_0045347 3300049591 Bacteria 3300
510 Ga0501075_0060873 3300049591 Bacteria 2844
511 Ga0501076_0006912 3300049592 Bacteria 8246
512 Ga0501076_0010111 3300049592 Bacteria 6988
513 Ga0501076_0019667 3300049592 Bacteria 5163
514 Ga0501076_0039086 3300049592 Bacteria 3725
515 Ga0501076_0044215 3300049592 Bacteria 3512
516 Ga0501076_0060228 3300049592 Bacteria 3020
517 Ga0501076_0102434 3300049592 Bacteria 2308
518 Ga0501076_0107417 3300049592 Bacteria 2254
519 Ga0501077_0033249 3300049593 Unclassified 3282
520 Ga0501077_0050316 3300049593 Bacteria 2649
521 Ga0501080_0007987 3300049742 Bacteria 9587
522 Ga0501080_0026783 3300049742 Bacteria 5358
523 Ga0501080_0041000 3300049742 Bacteria 4316
524 Ga0501080_0061341 3300049742 Bacteria 3501
525 Ga0501080_0104410 3300049742 Bacteria 2628
526 Ga0501080_0128071 3300049742 Bacteria 2350
527 Ga0501081_0070643 3300049743 Bacteria 2433
528 Ga0501081_0096010 3300049743 Bacteria 2090
529 Ga0501081_0126265 3300049743 Bacteria 1825
530 Ga0501083_0001145 3300049744 Bacteria 17826
531 Ga0501083_0006214 3300049744 Bacteria 8471
532 Ga0501083_0006371 3300049744 Bacteria 8363
533 Ga0501083_0020384 3300049744 Bacteria 4612
534 Ga0501083_0044145 3300049744 Bacteria 3018
535 Ga0501035_0003037 3300049822 Bacteria 16095
536 Ga0501035_0099193 3300049822 Bacteria 2557
537 Ga0501035_0106549 3300049822 Bacteria 2457
538 Ga0501035_0143659 3300049822 Bacteria 2073
539 Ga0501044_0006115 3300049823 Bacteria 13282
540 Ga0501044_0007614 3300049823 Bacteria 11907
541 Ga0501044_0057335 3300049823 Bacteria 3997
542 Ga0501045_0010474 3300049824 Bacteria 6494
543 Ga0501045_0013053 3300049824 Bacteria 5858
544 Ga0501045_0023082 3300049824 Bacteria 4457
545 Ga0501045_0061233 3300049824 Bacteria 2761
546 Ga0501045_0063695 3300049824 Bacteria 2706
547 Ga0501045_0153654 3300049824 Bacteria 1712
548 nmdc:mga0k408_1389_c1 3300050493 Bacteria 8568
549 nmdc:mga0k408_3514_c1 3300050493 Bacteria 8283
550 nmdc:mga04h51_6591_c1 3300050495 Bacteria 3019
551 nmdc:mga05p37_10205_c1 3300050507 Bacteria 11152
552 nmdc:mga05p37_11028_c1 3300050507 Bacteria 10736
553 nmdc:mga05p37_135344_c1 3300050507 Bacteria 3022
554 nmdc:mga05p37_1547_c1 3300050507 Bacteria 26735
555 nmdc:mga05p37_16419_c1 3300050507 Bacteria 8920
556 nmdc:mga05p37_170622_c1 3300050507 Bacteria 2653
557 nmdc:mga05p37_18588_c1 3300050507 Bacteria 8400
558 nmdc:mga05p37_20134_c1 3300050507 Bacteria 8074
559 nmdc:mga05p37_22643_c1 3300050507 Bacteria 7619
560 nmdc:mga05p37_28785_c1 3300050507 Bacteria 6778
561 nmdc:mga05p37_3800_c1 3300050507 Bacteria 17668
562 nmdc:mga05p37_4878_c1 3300050507 Bacteria 15701
563 nmdc:mga05p37_9438_c1 3300050507 Bacteria 11551
564 nmdc:mga09592_10903_c1 3300050508 Bacteria 7397
565 nmdc:mga09592_145535_c1 3300050508 Bacteria 2043
566 nmdc:mga09592_3603_c1 3300050508 Bacteria 12498
567 nmdc:mga0qj67_10127_c1 3300050509 Bacteria 7036
568 nmdc:mga0qj67_29562_c1 3300050509 Bacteria 4257
569 nmdc:mga0qj67_95222_c1 3300050509 Bacteria 2396
570 nmdc:mga06r32_1666_c1 3300050510 Bacteria 20041
571 nmdc:mga06r32_191551_c1 3300050510 Bacteria 2032
572 nmdc:mga06r32_299062_c1 3300050510 Bacteria 1596
573 nmdc:mga06r32_38432_c1 3300050510 Bacteria 4535
574 nmdc:mga06r32_50291_c2 3300050510 Bacteria 2236
575 nmdc:mga08y16_12383_c1 3300050511 Bacteria 8970
576 nmdc:mga08y16_1308_c1 3300050511 Bacteria 24769
577 nmdc:mga08y16_150_c1 3300050511 Bacteria 60170
578 nmdc:mga08y16_21_c1 3300050511 Bacteria 254790
579 nmdc:mga08y16_2234_c1 3300050511 Bacteria 19850
580 nmdc:mga08y16_30870_c1 3300050511 Bacteria 5635
581 nmdc:mga08y16_3307_c1 3300050511 Bacteria 16691
582 nmdc:mga08y16_47196_c1 3300050511 Bacteria 4508
583 nmdc:mga08y16_56912_c1 3300050511 Bacteria 4087
584 nmdc:mga08y16_8550_c1 3300050511 Bacteria 10725
585 nmdc:mga08y16_94317_c1 3300050511 Bacteria 3118
586 nmdc:mga0n895_11166_c1 3300050512 Bacteria 7995
587 nmdc:mga0n895_72715_c1 3300050512 Bacteria 3412
588 nmdc:mga0rr50_45_c1 3300050513 Bacteria 74544
589 nmdc:mga0rr50_61271_c1 3300050513 Bacteria 2834
590 nmdc:mga0rr50_910_c1 3300050513 Bacteria 16002
591 nmdc:mga0rr50_9579_c1 3300050513 Bacteria 6099
592 nmdc:mga08x19_101405_c1 3300050514 Bacteria 1911
593 nmdc:mga08x19_24553_c1 3300050514 Bacteria 3748
594 nmdc:mga08x19_33446_c1 3300050514 Bacteria 3245
595 nmdc:mga08x19_52680_c1 3300050514 Unclassified 2617
596 nmdc:mga08x19_8275_c1 3300050514 Bacteria 6186
597 nmdc:mga0a205_166094_c1 3300050515 Bacteria 2103
598 nmdc:mga0a205_21189_c1 3300050515 Bacteria 6147
599 nmdc:mga0a205_27842_c1 3300050515 Bacteria 5399
600 nmdc:mga0a205_29030_c1 3300050515 Bacteria 5292
601 nmdc:mga0a205_32367_c1 3300050515 Bacteria 5014
602 nmdc:mga0a205_45771_c1 3300050515 Bacteria 4220
603 nmdc:mga0a205_58922_c1 3300050515 Bacteria 3709
604 nmdc:mga0a205_7140_c1 3300050515 Bacteria 10099
605 nmdc:mga0a205_8923_c1 3300050515 Bacteria 9138
606 Ga0495601_0003730 3300053077 Bacteria 8770
607 Ga0495601_0024117 3300053077 Bacteria 3744
608 Ga0495595_0057838 3300053084 Bacteria 1809
609 Ga0495619_0006567 3300053085 Bacteria 7357
610 Ga0495619_0022749 3300053085 Bacteria 4014
611 Ga0500641_0003358 3300053096 Bacteria 5663
612 Ga0500555_000185 3300053103 Bacteria 28382
613 Ga0500556_0003578 3300053104 Bacteria 4536
614 Ga0500568_0004926 3300053139 Bacteria 7023
615 Ga0500616_0000173 3300053153 Bacteria 107646
616 Ga0500645_000077 3300053730 Bacteria 77326
617 Ga0501084_0001462 3300054114 Bacteria 18743
618 Ga0501084_0038278 3300054114 Bacteria 4009
619 Ga0501084_0038385 3300054114 Bacteria 4004
620 Ga0501084_0041468 3300054114 Bacteria 3851
621 Ga0501084_0055531 3300054114 Bacteria 3313
622 Ga0501084_0062047 3300054114 Bacteria 3129
623 Ga0501084_0067988 3300054114 Bacteria 2983
624 Ga0501084_0072166 3300054114 Bacteria 2891
625 Ga0501084_0097493 3300054114 Bacteria 2468
626 Ga0501084_0177669 3300054114 Bacteria 1797
627 Ga0590071_000346 3300059421 Bacteria 13658
628 Ga0590075_000232 3300059424 Bacteria 15676
629 Ga0590075_008027 3300059424 Bacteria 2512
630 Ga0590077_001575 3300059426 Bacteria 5248
631 Ga0587066_002459 3300059490 Bacteria 2049
632 Ga0587073_0000253 3300059492 Bacteria 4288
633 Ga0587073_0001165 3300059492 Bacteria 2932
634 Ga0587080_001503 3300059503 Bacteria 2547
635 Ga0587082_001100 3300059504 Bacteria 2654
636 Ga0587082_003187 3300059504 Bacteria 1945
637 Ga0587088_001055 3300059508 Unclassified 2702
638 Ga0587090_001296 3300059510 Bacteria 2500
639 Ga0587091_001116 3300059511 Unclassified 2766
640 Ga0587098_000822 3300059604 Bacteria 2124
641 Ga0587115_000622 3300059626 Bacteria 2756
642 Ga0587128_001549 3300059630 Bacteria 2197
643 Ga0587128_001906 3300059630 Bacteria 2077
644 Ga0587067_003121 3300059640 Bacteria 2044
645 Ga0587067_003581 3300059640 Bacteria 1955
646 Ga0587076_001717 3300059645 Bacteria 2304
647 Ga0587107_000873 3300059652 Bacteria 2229
648 Ga0587114_001461 3300059655 Bacteria 1986
649 Ga0587111_0003945 3300060346 Bacteria 2162
650 Ga0501082_0017507 3300060353 Bacteria 6175
651 Ga0501082_0029344 3300060353 Bacteria 4738
652 Ga0501082_0029654 3300060353 Bacteria 4713
653 Ga0501082_0050478 3300060353 Bacteria 3587
654 Ga0501082_0076488 3300060353 Bacteria 2885
655 Ga0530510_0028940 3300061734 Bacteria 3974
656 Ga0530510_0070912 3300061734 Bacteria 2529
657 Ga0530510_0101971 3300061734 Bacteria 2099

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041410 Ga0439461_0012781 Ga0439461_0012781_246_1556 394
2 3300049824 Ga0501045_0153654 Ga0501045_0153654_285_1688 398
3 3300050510 nmdc:mga06r32_191551_c1 nmdc:mga06r32_191551_c1_643_2019 409
4 3300046681 Ga0495647_0011264 Ga0495647_0011264_569_2107 412
5 3300003693 Ga0032354_1045718 Ga0032354_10457182 416
6 3300009177 Ga0105248_10067215 Ga0105248_100672152 420
7 3300053139 Ga0500568_0004926 Ga0500568_0004926_2796_4478 421
8 3300031995 Ga0307409_100003509 Ga0307409_1000035097 423
9 3300005354 Ga0070675_100043940 Ga0070675_1000439401 424
10 3300059645 Ga0587076_001717 Ga0587076_001717_519_2150 424
11 3300006847 Ga0075431_100114538 Ga0075431_1001145382 428
12 3300050507 nmdc:mga05p37_18588_c1 nmdc:mga05p37_18588_c1_3201_4739 429
13 3300053084 Ga0495595_0057838 Ga0495595_0057838_167_1687 429
14 3300060346 Ga0587111_0003945 Ga0587111_0003945_324_2057 430
15 3300048912 Ga0496109_0079309 Ga0496109_0079309_941_2479 431
16 3300006237 Ga0097621_100011722 Ga0097621_1000117225 432
17 3300004798 Ga0058859_10104188 Ga0058859_101041881 433
18 3300005354 Ga0070675_100028899 Ga0070675_1000288994 433
19 3300005364 Ga0070673_100085693 Ga0070673_1000856931 433
20 3300005456 Ga0070678_100009865 Ga0070678_1000098655 433
21 3300026121 Ga0207683_10018931 Ga0207683_100189315 433
22 3300009147 Ga0114129_10058479 Ga0114129_100584794 434
23 3300050507 nmdc:mga05p37_4878_c1 nmdc:mga05p37_4878_c1_13275_14960 434
24 3300053096 Ga0500641_0003358 Ga0500641_0003358_890_2518 434
25 3300005844 Ga0068862_100006534 Ga0068862_1000065344 435
26 3300028380 Ga0268265_10013164 Ga0268265_100131643 435
27 3300036401 Ga0373937_0066997 Ga0373937_0066997_634_2187 435
28 3300009147 Ga0114129_10006486 Ga0114129_100064864 436
29 3300048904 Ga0496101_0002334 Ga0496101_0002334_9951_11507 436
30 3300048907 Ga0496104_0017896 Ga0496104_0017896_409_1965 436
31 3300048910 Ga0496107_0038142 Ga0496107_0038142_788_2344 436
32 3300048917 Ga0496114_0000913 Ga0496114_0000913_12825_14381 436
33 3300003544 Ga0007417J51691_1028357 Ga0007417J51691_10283572 437
34 3300003577 Ga0007416J51690_1031937 Ga0007416J51690_10319372 437
35 3300009147 Ga0114129_10255095 Ga0114129_102550952 437
36 3300005471 Ga0070698_100192018 Ga0070698_1001920181 439
37 3300042436 Ga0439435_0008790 Ga0439435_0008790_250_1824 440
38 3300045051 Ga0451576_0121337 Ga0451576_0121337_406_2001 440
39 3300049744 Ga0501083_0044145 Ga0501083_0044145_522_2219 440
40 3300049579 Ga0501043_0096988 Ga0501043_0096988_50_1624 441
41 3300049591 Ga0501075_0045347 Ga0501075_0045347_1429_3003 441
42 3300049592 Ga0501076_0044215 Ga0501076_0044215_1039_2613 441
43 3300049743 Ga0501081_0070643 Ga0501081_0070643_471_2045 441
44 3300049573 Ga0501037_0136856 Ga0501037_0136856_30_1631 442
45 3300054114 Ga0501084_0062047 Ga0501084_0062047_1489_3090 442
46 3300005618 Ga0068864_100028057 Ga0068864_1000280572 443
47 3300006852 Ga0075433_10090207 Ga0075433_100902072 443
48 3300009177 Ga0105248_10047058 Ga0105248_100470584 443
49 3300013296 Ga0157374_10048760 Ga0157374_100487603 443
50 3300046460 Ga0495638_0004431 Ga0495638_0004431_7916_9583 443
51 3300050515 nmdc:mga0a205_27842_c1 nmdc:mga0a205_27842_c1_1320_2999 443
52 3300054114 Ga0501084_0177669 Ga0501084_0177669_16_1653 444
53 3300005354 Ga0070675_100002124 Ga0070675_1000021241 445
54 3300005355 Ga0070671_100009207 Ga0070671_1000092075 445
55 3300005364 Ga0070673_100036998 Ga0070673_1000369983 445
56 3300005367 Ga0070667_100015415 Ga0070667_1000154155 445
57 3300009177 Ga0105248_10005629 Ga0105248_100056298 445
58 3300026088 Ga0207641_10002265 Ga0207641_100022654 445
59 3300049586 Ga0501070_0022289 Ga0501070_0022289_3387_5144 445
60 3300049587 Ga0501071_0049453 Ga0501071_0049453_1314_2831 445
61 3300049591 Ga0501075_0060873 Ga0501075_0060873_64_1581 445
62 3300005336 Ga0070680_100041770 Ga0070680_1000417703 446
63 3300009094 Ga0111539_10020021 Ga0111539_100200214 446
64 3300009147 Ga0114129_10002040 Ga0114129_1000204013 446
65 3300014326 Ga0157380_10016008 Ga0157380_100160085 446
66 3300025917 Ga0207660_10051265 Ga0207660_100512653 446
67 3300046684 Ga0495669_0007347 Ga0495669_0007347_691_2400 446
68 3300049588 Ga0501072_0155842 Ga0501072_0155842_35_1792 446
69 3300049590 Ga0501074_0093862 Ga0501074_0093862_136_1824 446
70 3300050507 nmdc:mga05p37_10205_c1 nmdc:mga05p37_10205_c1_7173_8879 446
71 3300050511 nmdc:mga08y16_94317_c1 nmdc:mga08y16_94317_c1_783_2456 446
72 3300005367 Ga0070667_100162181 Ga0070667_1001621811 447
73 3300025986 Ga0207658_10149259 Ga0207658_101492591 447
74 3300026121 Ga0207683_10038678 Ga0207683_100386783 447
75 3300035086 Ga0373934_0020319 Ga0373934_0020319_38_1597 447
76 3300035119 Ga0373956_0016396 Ga0373956_0016396_657_2216 447
77 3300035172 Ga0373955_0012621 Ga0373955_0012621_36_1595 447
78 3300036401 Ga0373937_0000965 Ga0373937_0000965_22662_24221 447
79 3300005544 Ga0070686_100024951 Ga0070686_1000249514 448
80 3300009147 Ga0114129_10002887 Ga0114129_1000288715 448
81 3300009147 Ga0114129_10044664 Ga0114129_100446643 448
82 3300009176 Ga0105242_10014843 Ga0105242_100148431 448
83 3300026089 Ga0207648_10052603 Ga0207648_100526031 448
84 3300028379 Ga0268266_10017050 Ga0268266_100170505 448
85 3300046511 Ga0495608_0003942 Ga0495608_0003942_8290_9990 448
86 3300046516 Ga0495628_0021148 Ga0495628_0021148_3415_5115 448
87 3300046536 Ga0495587_0051732 Ga0495587_0051732_33_1751 448
88 3300046543 Ga0495645_0010462 Ga0495645_0010462_541_2241 448
89 3300046559 Ga0495667_0084520 Ga0495667_0084520_347_2047 448
90 3300046689 Ga0495613_0001676 Ga0495613_0001676_6433_8133 448
91 3300047471 Ga0495684_0002679 Ga0495684_0002679_10360_12060 448
92 3300048915 Ga0496112_0035087 Ga0496112_0035087_2818_4524 448
93 3300049576 Ga0501040_0092029 Ga0501040_0092029_326_1975 448
94 3300049578 Ga0501042_0000551 Ga0501042_0000551_15848_17497 448
95 3300049588 Ga0501072_0027598 Ga0501072_0027598_2766_4415 448
96 3300049590 Ga0501074_0080579 Ga0501074_0080579_577_2226 448
97 3300049593 Ga0501077_0033249 Ga0501077_0033249_1034_2683 448
98 3300050510 nmdc:mga06r32_299062_c1 nmdc:mga06r32_299062_c1_10_1527 448
99 3300050513 nmdc:mga0rr50_45_c1 nmdc:mga0rr50_45_c1_34419_36116 448
100 3300050514 nmdc:mga08x19_33446_c1 nmdc:mga08x19_33446_c1_139_1836 448
101 3300053077 Ga0495601_0003730 Ga0495601_0003730_5791_7491 448
102 3300053085 Ga0495619_0006567 Ga0495619_0006567_4326_6026 448
103 3300048088 Ga0495602_0086955 Ga0495602_0086955_610_2328 449
104 3300049568 Ga0501031_0108255 Ga0501031_0108255_17_1678 449
105 3300049570 Ga0501033_0035764 Ga0501033_0035764_688_2349 449
106 3300049572 Ga0501036_0048668 Ga0501036_0048668_1447_3108 449
107 3300049574 Ga0501038_0075564 Ga0501038_0075564_1150_2811 449
108 3300049575 Ga0501039_0060303 Ga0501039_0060303_969_2630 449
109 3300049577 Ga0501041_0012056 Ga0501041_0012056_291_1952 449
110 3300049579 Ga0501043_0123373 Ga0501043_0123373_357_2018 449
111 3300049580 Ga0501046_0078290 Ga0501046_0078290_753_2399 449
112 3300049582 Ga0501048_0029438 Ga0501048_0029438_1341_3002 449
113 3300049584 Ga0501068_0023174 Ga0501068_0023174_704_2365 449
114 3300049587 Ga0501071_0075220 Ga0501071_0075220_451_2127 449
115 3300049589 Ga0501073_0000524 Ga0501073_0000524_5873_7486 449
116 3300049590 Ga0501074_0086484 Ga0501074_0086484_283_1896 449
117 3300049592 Ga0501076_0107417 Ga0501076_0107417_326_2002 449
118 3300049822 Ga0501035_0143659 Ga0501035_0143659_286_1947 449
119 3300003693 Ga0032354_1004787 Ga0032354_10047873 450
120 3300005545 Ga0070695_100078438 Ga0070695_1000784382 450
121 3300006237 Ga0097621_100012231 Ga0097621_1000122313 450
122 3300006358 Ga0068871_100004321 Ga0068871_1000043215 450
123 3300014325 Ga0163163_10000013 Ga0163163_10000013120 450
124 3300014969 Ga0157376_10045942 Ga0157376_100459424 450
125 3300042436 Ga0439435_0012655 Ga0439435_0012655_41_1696 450
126 3300048905 Ga0496102_0145594 Ga0496102_0145594_706_2205 450
127 3300049590 Ga0501074_0134007 Ga0501074_0134007_44_1714 450
128 3300049824 Ga0501045_0063695 Ga0501045_0063695_755_2437 450
129 3300053104 Ga0500556_0003578 Ga0500556_0003578_961_2592 450
130 3300005842 Ga0068858_100002991 Ga0068858_1000029918 451
131 3300009094 Ga0111539_10001752 Ga0111539_100017525 451
132 3300027907 Ga0207428_10000294 Ga0207428_1000029438 451
133 3300050511 nmdc:mga08y16_2234_c1 nmdc:mga08y16_2234_c1_5156_6748 451
134 3300050511 nmdc:mga08y16_47196_c1 nmdc:mga08y16_47196_c1_912_2474 451
135 3300004801 Ga0058860_10047880 Ga0058860_100478801 452
136 3300005617 Ga0068859_100098545 Ga0068859_1000985451 452
137 3300006931 Ga0097620_100098537 Ga0097620_1000985371 452
138 3300009093 Ga0105240_10051258 Ga0105240_100512583 452
139 3300009094 Ga0111539_10000763 Ga0111539_1000076310 452
140 3300009177 Ga0105248_10003067 Ga0105248_1000306711 452
141 3300025913 Ga0207695_10025538 Ga0207695_100255384 452
142 3300026035 Ga0207703_10004978 Ga0207703_100049784 452
143 3300027907 Ga0207428_10002348 Ga0207428_1000234810 452
144 3300046683 Ga0495658_0015421 Ga0495658_0015421_1255_2781 452
145 3300048911 Ga0496108_0007619 Ga0496108_0007619_173_1873 452
146 3300050511 nmdc:mga08y16_150_c1 nmdc:mga08y16_150_c1_32239_33984 452
147 3300005518 Ga0070699_100024264 Ga0070699_1000242642 453
148 3300025920 Ga0207649_10050275 Ga0207649_100502751 453
149 3300026121 Ga0207683_10036135 Ga0207683_100361352 453
150 3300031548 Ga0307408_100009645 Ga0307408_1000096454 453
151 3300031995 Ga0307409_100063883 Ga0307409_1000638831 453
152 3300049592 Ga0501076_0010111 Ga0501076_0010111_336_1958 453
153 3300049742 Ga0501080_0104410 Ga0501080_0104410_1017_2615 453
154 3300050509 nmdc:mga0qj67_95222_c1 nmdc:mga0qj67_95222_c1_14_1525 453
155 3300005290 Ga0065712_10067993 Ga0065712_1006799310 454
156 3300005438 Ga0070701_10015399 Ga0070701_100153992 454
157 3300006871 Ga0075434_100004677 Ga0075434_10000467712 454
158 3300014326 Ga0157380_10005365 Ga0157380_100053657 454
159 3300025908 Ga0207643_10043937 Ga0207643_100439372 454
160 3300027907 Ga0207428_10086058 Ga0207428_100860582 454
161 3300031995 Ga0307409_100054892 Ga0307409_1000548923 454
162 3300009094 Ga0111539_10134974 Ga0111539_101349742 455
163 3300014326 Ga0157380_10001836 Ga0157380_1000183612 455
164 3300025917 Ga0207660_10131672 Ga0207660_101316722 455
165 3300005340 Ga0070689_100034367 Ga0070689_1000343674 456
166 3300005365 Ga0070688_100020510 Ga0070688_1000205105 456
167 3300025926 Ga0207659_10000196 Ga0207659_100001961 456
168 3300025936 Ga0207670_10005956 Ga0207670_100059564 456
169 3300049823 Ga0501044_0006115 Ga0501044_0006115_11364_13079 456
170 3300050515 nmdc:mga0a205_166094_c1 nmdc:mga0a205_166094_c1_494_2041 456
171 3300005335 Ga0070666_10047193 Ga0070666_100471932 457
172 3300005459 Ga0068867_100039474 Ga0068867_1000394742 457
173 3300006237 Ga0097621_100005522 Ga0097621_1000055223 457
174 3300006844 Ga0075428_100185395 Ga0075428_1001853952 457
175 3300006846 Ga0075430_100040384 Ga0075430_1000403842 457
176 3300006881 Ga0068865_100016927 Ga0068865_1000169274 457
177 3300009093 Ga0105240_10119947 Ga0105240_101199472 457
178 3300009176 Ga0105242_10018202 Ga0105242_100182023 457
179 3300014969 Ga0157376_10014296 Ga0157376_100142963 457
180 3300022467 Ga0224712_10014336 Ga0224712_100143362 457
181 3300025938 Ga0207704_10003166 Ga0207704_100031663 457
182 3300025941 Ga0207711_10093023 Ga0207711_100930232 457
183 3300026089 Ga0207648_10055729 Ga0207648_100557293 457
184 3300048915 Ga0496112_0018705 Ga0496112_0018705_3260_4870 457
185 3300049569 Ga0501032_0024275 Ga0501032_0024275_1642_3342 457
186 3300049572 Ga0501036_0009652 Ga0501036_0009652_3256_4956 457
187 3300049572 Ga0501036_0087865 Ga0501036_0087865_283_1992 457
188 3300049576 Ga0501040_0044809 Ga0501040_0044809_446_2155 457
189 3300049580 Ga0501046_0090356 Ga0501046_0090356_646_2346 457
190 3300049582 Ga0501048_0014220 Ga0501048_0014220_2013_3722 457
191 3300049588 Ga0501072_0016347 Ga0501072_0016347_1509_3218 457
192 3300049590 Ga0501074_0009117 Ga0501074_0009117_4320_6020 457
193 3300049591 Ga0501075_0033760 Ga0501075_0033760_552_2261 457
194 3300049592 Ga0501076_0006912 Ga0501076_0006912_5685_7394 457
195 3300049592 Ga0501076_0039086 Ga0501076_0039086_1482_3182 457
196 3300049742 Ga0501080_0061341 Ga0501080_0061341_1664_3373 457
197 3300049744 Ga0501083_0006371 Ga0501083_0006371_2525_4225 457
198 3300049822 Ga0501035_0003037 Ga0501035_0003037_3289_4989 457
199 3300050514 nmdc:mga08x19_24553_c1 nmdc:mga08x19_24553_c1_1292_2839 457
200 3300054114 Ga0501084_0001462 Ga0501084_0001462_13095_14795 457
201 3300059424 Ga0590075_008027 Ga0590075_008027_67_1719 457
202 3300059492 Ga0587073_0000253 Ga0587073_0000253_2049_3764 457
203 3300059503 Ga0587080_001503 Ga0587080_001503_313_2028 457
204 3300059508 Ga0587088_001055 Ga0587088_001055_525_2240 457
205 3300059510 Ga0587090_001296 Ga0587090_001296_500_2215 457
206 3300059511 Ga0587091_001116 Ga0587091_001116_537_2252 457
207 3300059630 Ga0587128_001549 Ga0587128_001549_446_2161 457
208 3300060353 Ga0501082_0029344 Ga0501082_0029344_1125_2825 457
209 3300061734 Ga0530510_0101971 Ga0530510_0101971_270_1844 457
210 3300004799 Ga0058863_10034124 Ga0058863_100341243 458
211 3300005336 Ga0070680_100143461 Ga0070680_1001434611 458
212 3300005339 Ga0070660_100047168 Ga0070660_1000471682 458
213 3300005563 Ga0068855_100088768 Ga0068855_1000887682 458
214 3300005937 Ga0081455_10075493 Ga0081455_100754932 458
215 3300006358 Ga0068871_100058588 Ga0068871_1000585883 458
216 3300009094 Ga0111539_10008025 Ga0111539_100080255 458
217 3300009147 Ga0114129_10002681 Ga0114129_100026816 458
218 3300009551 Ga0105238_10102382 Ga0105238_101023822 458
219 3300020070 Ga0206356_10872851 Ga0206356_108728512 458
220 3300020081 Ga0206354_10781424 Ga0206354_107814242 458
221 3300022467 Ga0224712_10017077 Ga0224712_100170773 458
222 3300025919 Ga0207657_10053562 Ga0207657_100535623 458
223 3300049588 Ga0501072_0040448 Ga0501072_0040448_2046_3566 458
224 3300049588 Ga0501072_0050134 Ga0501072_0050134_1589_3133 458
225 3300050511 nmdc:mga08y16_1308_c1 nmdc:mga08y16_1308_c1_16145_17911 458
226 3300054114 Ga0501084_0067988 Ga0501084_0067988_1385_2929 458
227 3300006880 Ga0075429_100002051 Ga0075429_1000020517 459
228 3300009094 Ga0111539_10004701 Ga0111539_1000470110 459
229 3300009094 Ga0111539_10038002 Ga0111539_100380022 459
230 3300027907 Ga0207428_10009454 Ga0207428_100094544 459
231 3300050508 nmdc:mga09592_10903_c1 nmdc:mga09592_10903_c1_1686_3383 459
232 3300050509 nmdc:mga0qj67_10127_c1 nmdc:mga0qj67_10127_c1_2895_4592 459
233 3300050511 nmdc:mga08y16_3307_c1 nmdc:mga08y16_3307_c1_14103_15758 459
234 3300050511 nmdc:mga08y16_56912_c1 nmdc:mga08y16_56912_c1_1635_3311 459
235 3300005354 Ga0070675_100001858 Ga0070675_10000185810 460
236 3300005364 Ga0070673_100001301 Ga0070673_1000013018 460
237 3300005434 Ga0070709_10091572 Ga0070709_100915721 460
238 3300005466 Ga0070685_10067350 Ga0070685_100673501 460
239 3300005549 Ga0070704_100038820 Ga0070704_1000388201 460
240 3300006880 Ga0075429_100018790 Ga0075429_1000187902 460
241 3300007076 Ga0075435_100024331 Ga0075435_1000243313 460
242 3300014326 Ga0157380_10002997 Ga0157380_100029973 460
243 3300025926 Ga0207659_10004899 Ga0207659_100048992 460
244 3300027907 Ga0207428_10021150 Ga0207428_100211502 460
245 3300035691 Ga0373931_0084222 Ga0373931_0084222_88_1644 460
246 3300049576 Ga0501040_0038476 Ga0501040_0038476_69_1811 460
247 3300004800 Ga0058861_11984001 Ga0058861_119840011 461
248 3300004803 Ga0058862_12893455 Ga0058862_128934551 461
249 3300005367 Ga0070667_100047841 Ga0070667_1000478413 461
250 3300005530 Ga0070679_100146066 Ga0070679_1001460661 461
251 3300005547 Ga0070693_100013639 Ga0070693_1000136392 461
252 3300005843 Ga0068860_100070741 Ga0068860_1000707412 461
253 3300005985 Ga0081539_10044591 Ga0081539_100445911 461
254 3300009094 Ga0111539_10037248 Ga0111539_100372482 461
255 3300009147 Ga0114129_10098361 Ga0114129_100983612 461
256 3300025921 Ga0207652_10164609 Ga0207652_101646091 461
257 3300026041 Ga0207639_10092276 Ga0207639_100922762 461
258 3300028381 Ga0268264_10087530 Ga0268264_100875302 461
259 3300032002 Ga0307416_100049923 Ga0307416_1000499232 461
260 3300042133 Ga0450896_002431 Ga0450896_002431_604_2265 461
261 3300049569 Ga0501032_0044638 Ga0501032_0044638_862_2673 461
262 3300049572 Ga0501036_0042173 Ga0501036_0042173_1946_3757 461
263 3300049574 Ga0501038_0003987 Ga0501038_0003987_4521_6332 461
264 3300049575 Ga0501039_0015015 Ga0501039_0015015_3557_5368 461
265 3300049577 Ga0501041_0053020 Ga0501041_0053020_526_2418 461
266 3300049580 Ga0501046_0054796 Ga0501046_0054796_857_2668 461
267 3300049589 Ga0501073_0058951 Ga0501073_0058951_52_1863 461
268 3300049822 Ga0501035_0099193 Ga0501035_0099193_734_2545 461
269 3300049823 Ga0501044_0007614 Ga0501044_0007614_4581_6392 461
270 3300050493 nmdc:mga0k408_1389_c1 nmdc:mga0k408_1389_c1_6383_8089 461
271 3300050507 nmdc:mga05p37_170622_c1 nmdc:mga05p37_170622_c1_38_1834 461
272 3300050511 nmdc:mga08y16_8550_c1 nmdc:mga08y16_8550_c1_2555_4351 461
273 3300060353 Ga0501082_0050478 Ga0501082_0050478_1329_3221 461
274 3300005344 Ga0070661_100104122 Ga0070661_1001041221 462
275 3300005354 Ga0070675_100178210 Ga0070675_1001782101 462
276 3300005364 Ga0070673_100013792 Ga0070673_1000137924 462
277 3300005455 Ga0070663_100038053 Ga0070663_1000380533 462
278 3300005564 Ga0070664_100205560 Ga0070664_1002055601 462
279 3300009177 Ga0105248_10033643 Ga0105248_100336433 462
280 3300025931 Ga0207644_10023604 Ga0207644_100236041 462
281 3300025940 Ga0207691_10005565 Ga0207691_100055655 462
282 3300025944 Ga0207661_10141119 Ga0207661_101411192 462
283 3300025945 Ga0207679_10051639 Ga0207679_100516392 462
284 3300025960 Ga0207651_10005371 Ga0207651_100053714 462
285 3300026067 Ga0207678_10018364 Ga0207678_100183644 462
286 3300048915 Ga0496112_0241470 Ga0496112_0241470_205_1740 462
287 3300050493 nmdc:mga0k408_3514_c1 nmdc:mga0k408_3514_c1_3755_5425 462
288 3300059504 Ga0587082_003187 Ga0587082_003187_120_1865 462
289 3300059640 Ga0587067_003581 Ga0587067_003581_90_1835 462
290 3300009098 Ga0105245_10039025 Ga0105245_100390252 463
291 3300014326 Ga0157380_10046959 Ga0157380_100469592 463
292 3300049568 Ga0501031_0001226 Ga0501031_0001226_9665_11386 463
293 3300049571 Ga0501034_0041541 Ga0501034_0041541_21_1742 463
294 3300049573 Ga0501037_0012782 Ga0501037_0012782_4223_5944 463
295 3300049574 Ga0501038_0003687 Ga0501038_0003687_1411_3132 463
296 3300049575 Ga0501039_0037349 Ga0501039_0037349_534_2255 463
297 3300049576 Ga0501040_0088365 Ga0501040_0088365_80_1762 463
298 3300049578 Ga0501042_0002232 Ga0501042_0002232_188_1909 463
299 3300049583 Ga0501067_0002412 Ga0501067_0002412_4103_5824 463
300 3300049585 Ga0501069_0012427 Ga0501069_0012427_2784_4505 463
301 3300049587 Ga0501071_0008094 Ga0501071_0008094_268_1989 463
302 3300049588 Ga0501072_0026113 Ga0501072_0026113_1618_3300 463
303 3300049590 Ga0501074_0011828 Ga0501074_0011828_184_1905 463
304 3300049591 Ga0501075_0044534 Ga0501075_0044534_1465_3147 463
305 3300049592 Ga0501076_0102434 Ga0501076_0102434_602_2284 463
306 3300049742 Ga0501080_0026783 Ga0501080_0026783_2099_3820 463
307 3300049744 Ga0501083_0001145 Ga0501083_0001145_10356_12200 463
308 3300049824 Ga0501045_0010474 Ga0501045_0010474_4241_5923 463
309 3300054114 Ga0501084_0055531 Ga0501084_0055531_501_2345 463
310 3300054114 Ga0501084_0097493 Ga0501084_0097493_256_1977 463
311 3300059490 Ga0587066_002459 Ga0587066_002459_203_1951 463
312 3300060353 Ga0501082_0029654 Ga0501082_0029654_2658_4379 463
313 3300060353 Ga0501082_0076488 Ga0501082_0076488_686_2530 463
314 3300005456 Ga0070678_100123059 Ga0070678_1001230591 464
315 3300005457 Ga0070662_100122927 Ga0070662_1001229272 464
316 3300009147 Ga0114129_10021939 Ga0114129_100219391 464
317 3300009177 Ga0105248_10022958 Ga0105248_100229583 464
318 3300009553 Ga0105249_10106280 Ga0105249_101062802 464
319 3300025933 Ga0207706_10082047 Ga0207706_100820471 464
320 3300025941 Ga0207711_10111373 Ga0207711_101113731 464
321 3300026067 Ga0207678_10101618 Ga0207678_101016181 464
322 3300027907 Ga0207428_10002363 Ga0207428_100023639 464
323 3300032005 Ga0307411_10017014 Ga0307411_100170142 464
324 3300035171 Ga0373946_0057414 Ga0373946_0057414_49_1617 464
325 3300049568 Ga0501031_0012051 Ga0501031_0012051_3213_4994 464
326 3300049570 Ga0501033_0003900 Ga0501033_0003900_7644_9425 464
327 3300049572 Ga0501036_0004166 Ga0501036_0004166_4787_6568 464
328 3300049573 Ga0501037_0021613 Ga0501037_0021613_611_2392 464
329 3300049574 Ga0501038_0005770 Ga0501038_0005770_3320_5101 464
330 3300049575 Ga0501039_0035877 Ga0501039_0035877_500_2197 464
331 3300049580 Ga0501046_0023381 Ga0501046_0023381_116_1897 464
332 3300049581 Ga0501047_0002381 Ga0501047_0002381_6916_8604 464
333 3300049582 Ga0501048_0010204 Ga0501048_0010204_3738_5519 464
334 3300049583 Ga0501067_0004704 Ga0501067_0004704_3093_4874 464
335 3300049584 Ga0501068_0005054 Ga0501068_0005054_4164_5945 464
336 3300049590 Ga0501074_0012875 Ga0501074_0012875_1816_3597 464
337 3300049742 Ga0501080_0007987 Ga0501080_0007987_269_2050 464
338 3300049744 Ga0501083_0020384 Ga0501083_0020384_1656_3437 464
339 3300049823 Ga0501044_0057335 Ga0501044_0057335_2182_3870 464
340 3300049824 Ga0501045_0023082 Ga0501045_0023082_217_1998 464
341 3300050508 nmdc:mga09592_145535_c1 nmdc:mga09592_145535_c1_280_1956 464
342 3300050515 nmdc:mga0a205_7140_c1 nmdc:mga0a205_7140_c1_4023_5579 464
343 3300054114 Ga0501084_0038385 Ga0501084_0038385_613_2394 464
344 3300054114 Ga0501084_0072166 Ga0501084_0072166_256_1953 464
345 3300003163 Ga0006759J45824_1031218 Ga0006759J45824_10312182 465
346 3300003574 Ga0007410J51695_1016549 Ga0007410J51695_10165492 465
347 3300003575 Ga0007409J51694_1020425 Ga0007409J51694_10204252 465
348 3300003577 Ga0007416J51690_1013267 Ga0007416J51690_10132672 465
349 3300006852 Ga0075433_10057140 Ga0075433_100571403 465
350 3300049588 Ga0501072_0047397 Ga0501072_0047397_784_2475 465
351 3300050507 nmdc:mga05p37_22643_c1 nmdc:mga05p37_22643_c1_5752_7314 465
352 3300050509 nmdc:mga0qj67_29562_c1 nmdc:mga0qj67_29562_c1_2019_3581 465
353 3300050510 nmdc:mga06r32_38432_c1 nmdc:mga06r32_38432_c1_2479_4041 465
354 3300006237 Ga0097621_100095458 Ga0097621_1000954582 466
355 3300006358 Ga0068871_100094550 Ga0068871_1000945501 466
356 3300006844 Ga0075428_100061501 Ga0075428_1000615012 466
357 3300006852 Ga0075433_10051074 Ga0075433_100510743 466
358 3300020070 Ga0206356_10818170 Ga0206356_108181702 466
359 3300020080 Ga0206350_10488288 Ga0206350_104882882 466
360 3300025941 Ga0207711_10050134 Ga0207711_100501342 466
361 3300035170 Ga0373943_0057749 Ga0373943_0057749_10_1575 466
362 3300049579 Ga0501043_0002195 Ga0501043_0002195_4495_6342 466
363 3300049581 Ga0501047_0002980 Ga0501047_0002980_3059_4906 466
364 3300049591 Ga0501075_0043394 Ga0501075_0043394_986_2545 466
365 3300049744 Ga0501083_0006214 Ga0501083_0006214_4657_6504 466
366 3300050512 nmdc:mga0n895_11166_c1 nmdc:mga0n895_11166_c1_5389_7110 466
367 3300050515 nmdc:mga0a205_29030_c1 nmdc:mga0a205_29030_c1_3136_4857 466
368 3300053103 Ga0500555_000185 Ga0500555_000185_19418_21118 466
369 3300053153 Ga0500616_0000173 Ga0500616_0000173_66130_67827 466
370 3300053730 Ga0500645_000077 Ga0500645_000077_29546_31246 466
371 3300054114 Ga0501084_0038278 Ga0501084_0038278_2037_3884 466
372 3300059492 Ga0587073_0001165 Ga0587073_0001165_371_2131 466
373 3300059504 Ga0587082_001100 Ga0587082_001100_369_2129 466
374 3300059604 Ga0587098_000822 Ga0587098_000822_215_1975 466
375 3300059626 Ga0587115_000622 Ga0587115_000622_391_2151 466
376 3300059630 Ga0587128_001906 Ga0587128_001906_250_2010 466
377 3300059640 Ga0587067_003121 Ga0587067_003121_210_1970 466
378 3300059652 Ga0587107_000873 Ga0587107_000873_61_1821 466
379 3300059655 Ga0587114_001461 Ga0587114_001461_29_1777 466
380 3300005518 Ga0070699_100093606 Ga0070699_1000936062 467
381 3300006871 Ga0075434_100028466 Ga0075434_1000284661 467
382 3300006914 Ga0075436_100009468 Ga0075436_1000094686 467
383 3300031548 Ga0307408_100016732 Ga0307408_1000167325 467
384 3300032002 Ga0307416_100019338 Ga0307416_1000193382 467
385 3300049583 Ga0501067_0054491 Ga0501067_0054491_67_1893 467
386 3300049585 Ga0501069_0025233 Ga0501069_0025233_1040_2866 467
387 3300050514 nmdc:mga08x19_8275_c1 nmdc:mga08x19_8275_c1_4010_5596 467
388 3300059421 Ga0590071_000346 Ga0590071_000346_11645_13327 467
389 3300059424 Ga0590075_000232 Ga0590075_000232_12413_14095 467
390 3300059426 Ga0590077_001575 Ga0590077_001575_1518_3200 467
391 3300005329 Ga0070683_100003662 Ga0070683_1000036625 468
392 3300020070 Ga0206356_10089078 Ga0206356_100890782 468
393 3300032002 Ga0307416_100064890 Ga0307416_1000648904 468
394 3300042435 Ga0439434_0012064 Ga0439434_0012064_919_2451 468
395 3300047322 Ga0495680_0142187 Ga0495680_0142187_54_1745 468
396 3300048905 Ga0496102_0238289 Ga0496102_0238289_120_1682 468
397 3300048908 Ga0496105_0017872 Ga0496105_0017872_4048_5610 468
398 3300048909 Ga0496106_0139339 Ga0496106_0139339_244_1806 468
399 3300048911 Ga0496108_0001529 Ga0496108_0001529_6221_7783 468
400 3300048914 Ga0496111_0010159 Ga0496111_0010159_4085_5647 468
401 3300049576 Ga0501040_0099139 Ga0501040_0099139_321_2006 468
402 3300049587 Ga0501071_0090619 Ga0501071_0090619_450_2135 468
403 3300049591 Ga0501075_0027261 Ga0501075_0027261_1865_3517 468
404 3300050495 nmdc:mga04h51_6591_c1 nmdc:mga04h51_6591_c1_712_2457 468
405 3300050515 nmdc:mga0a205_58922_c1 nmdc:mga0a205_58922_c1_792_2351 468
406 3300004801 Ga0058860_10070698 Ga0058860_100706982 469
407 3300005331 Ga0070670_100022034 Ga0070670_1000220345 469
408 3300005435 Ga0070714_100013434 Ga0070714_1000134346 469
409 3300005466 Ga0070685_10045828 Ga0070685_100458282 469
410 3300005548 Ga0070665_100113684 Ga0070665_1001136844 469
411 3300005844 Ga0068862_100033033 Ga0068862_1000330334 469
412 3300006852 Ga0075433_10083731 Ga0075433_100837312 469
413 3300009094 Ga0111539_10019674 Ga0111539_100196743 469
414 3300009147 Ga0114129_10006089 Ga0114129_100060899 469
415 3300014325 Ga0163163_10021804 Ga0163163_100218043 469
416 3300025914 Ga0207671_10084770 Ga0207671_100847702 469
417 3300025925 Ga0207650_10083044 Ga0207650_100830442 469
418 3300027907 Ga0207428_10028461 Ga0207428_100284612 469
419 3300028379 Ga0268266_10182583 Ga0268266_101825831 469
420 3300028380 Ga0268265_10021852 Ga0268265_100218522 469
421 3300037068 Ga0373925_0003186 Ga0373925_0003186_11222_12787 469
422 3300050507 nmdc:mga05p37_28785_c1 nmdc:mga05p37_28785_c1_2095_3819 469
423 3300050511 nmdc:mga08y16_30870_c1 nmdc:mga08y16_30870_c1_3015_4739 469
424 3300050514 nmdc:mga08x19_52680_c1 nmdc:mga08x19_52680_c1_282_1847 469
425 3300050515 nmdc:mga0a205_45771_c1 nmdc:mga0a205_45771_c1_1725_3449 469
426 3300005354 Ga0070675_100000033 Ga0070675_10000003352 470
427 3300005471 Ga0070698_100049353 Ga0070698_1000493532 470
428 3300009147 Ga0114129_10013889 Ga0114129_100138895 470
429 3300009177 Ga0105248_10027631 Ga0105248_100276314 470
430 3300025926 Ga0207659_10000202 Ga0207659_1000020211 470
431 3300035692 Ga0373935_0026577 Ga0373935_0026577_431_2206 470
432 3300042876 Ga0451577_0116561 Ga0451577_0116561_306_1850 470
433 3300044712 Ga0453684_0298900 Ga0453684_0298900_189_1733 470
434 3300049743 Ga0501081_0126265 Ga0501081_0126265_86_1798 470
435 3300050507 nmdc:mga05p37_9438_c1 nmdc:mga05p37_9438_c1_4169_5887 470
436 3300003577 Ga0007416J51690_1020095 Ga0007416J51690_10200953 471
437 3300005295 Ga0065707_10083167 Ga0065707_100831673 471
438 3300005530 Ga0070679_100164783 Ga0070679_1001647832 471
439 3300006844 Ga0075428_100003534 Ga0075428_1000035348 471
440 3300006846 Ga0075430_100006037 Ga0075430_1000060374 471
441 3300006880 Ga0075429_100017665 Ga0075429_1000176653 471
442 3300007076 Ga0075435_100000227 Ga0075435_10000022720 471
443 3300009094 Ga0111539_10010653 Ga0111539_100106534 471
444 3300009147 Ga0114129_10001838 Ga0114129_1000183813 471
445 3300009147 Ga0114129_10012628 Ga0114129_100126285 471
446 3300014968 Ga0157379_10052075 Ga0157379_100520753 471
447 3300027907 Ga0207428_10008328 Ga0207428_100083286 471
448 3300042008 Ga0439450_008299 Ga0439450_008299_134_1729 471
449 3300046683 Ga0495658_0078170 Ga0495658_0078170_124_1839 471
450 3300049570 Ga0501033_0012408 Ga0501033_0012408_4359_6194 471
451 3300049571 Ga0501034_0010668 Ga0501034_0010668_562_2271 471
452 3300049573 Ga0501037_0055376 Ga0501037_0055376_179_2014 471
453 3300049574 Ga0501038_0039366 Ga0501038_0039366_2269_4104 471
454 3300049582 Ga0501048_0028312 Ga0501048_0028312_1815_3650 471
455 3300049583 Ga0501067_0038604 Ga0501067_0038604_367_2103 471
456 3300049590 Ga0501074_0117873 Ga0501074_0117873_47_1882 471
457 3300049742 Ga0501080_0128071 Ga0501080_0128071_214_2049 471
458 3300049822 Ga0501035_0106549 Ga0501035_0106549_73_1908 471
459 3300050507 nmdc:mga05p37_11028_c1 nmdc:mga05p37_11028_c1_1590_3320 471
460 3300050507 nmdc:mga05p37_3800_c1 nmdc:mga05p37_3800_c1_542_2140 471
461 3300050508 nmdc:mga09592_3603_c1 nmdc:mga09592_3603_c1_242_1840 471
462 3300050511 nmdc:mga08y16_12383_c1 nmdc:mga08y16_12383_c1_4135_5733 471
463 3300050512 nmdc:mga0n895_72715_c1 nmdc:mga0n895_72715_c1_1109_2671 471
464 3300050513 nmdc:mga0rr50_910_c1 nmdc:mga0rr50_910_c1_11489_13225 471
465 3300004801 Ga0058860_10004412 Ga0058860_100044122 472
466 3300005331 Ga0070670_100066580 Ga0070670_1000665802 472
467 3300005355 Ga0070671_100062713 Ga0070671_1000627133 472
468 3300005471 Ga0070698_100120713 Ga0070698_1001207132 472
469 3300005549 Ga0070704_100008604 Ga0070704_1000086044 472
470 3300005617 Ga0068859_100009968 Ga0068859_1000099689 472
471 3300006931 Ga0097620_100009967 Ga0097620_1000099674 472
472 3300025922 Ga0207646_10032768 Ga0207646_100327683 472
473 3300026118 Ga0207675_100023705 Ga0207675_1000237054 472
474 3300049577 Ga0501041_0072104 Ga0501041_0072104_302_2023 472
475 3300049584 Ga0501068_0095723 Ga0501068_0095723_74_1783 472
476 3300049587 Ga0501071_0008546 Ga0501071_0008546_3627_5315 472
477 3300049589 Ga0501073_0131029 Ga0501073_0131029_26_1714 472
478 3300049592 Ga0501076_0019667 Ga0501076_0019667_562_2283 472
479 3300049593 Ga0501077_0050316 Ga0501077_0050316_248_1936 472
480 3300049743 Ga0501081_0096010 Ga0501081_0096010_60_1748 472
481 3300049824 Ga0501045_0013053 Ga0501045_0013053_3631_5319 472
482 3300050507 nmdc:mga05p37_16419_c1 nmdc:mga05p37_16419_c1_4076_5812 472
483 3300050510 nmdc:mga06r32_1666_c1 nmdc:mga06r32_1666_c1_7343_8935 472
484 3300050515 nmdc:mga0a205_8923_c1 nmdc:mga0a205_8923_c1_2772_4364 472
485 3300061734 Ga0530510_0028940 Ga0530510_0028940_1498_3186 472
486 3300061734 Ga0530510_0070912 Ga0530510_0070912_20_1822 472
487 3300005327 Ga0070658_10020720 Ga0070658_100207204 473
488 3300005331 Ga0070670_100009033 Ga0070670_1000090334 473
489 3300005335 Ga0070666_10016095 Ga0070666_100160954 473
490 3300005340 Ga0070689_100076412 Ga0070689_1000764122 473
491 3300005364 Ga0070673_100026380 Ga0070673_1000263803 473
492 3300005436 Ga0070713_100038745 Ga0070713_1000387452 473
493 3300005518 Ga0070699_100005625 Ga0070699_1000056254 473
494 3300005616 Ga0068852_100074866 Ga0068852_1000748662 473
495 3300005618 Ga0068864_100084020 Ga0068864_1000840202 473
496 3300005842 Ga0068858_100164348 Ga0068858_1001643482 473
497 3300007076 Ga0075435_100017470 Ga0075435_1000174704 473
498 3300009093 Ga0105240_10096617 Ga0105240_100966172 473
499 3300009147 Ga0114129_10034701 Ga0114129_100347015 473
500 3300025315 Ga0207697_10010765 Ga0207697_100107653 473
501 3300025910 Ga0207684_10132789 Ga0207684_101327892 473
502 3300025913 Ga0207695_10137046 Ga0207695_101370462 473
503 3300025928 Ga0207700_10006978 Ga0207700_100069783 473
504 3300025940 Ga0207691_10038623 Ga0207691_100386234 473
505 3300025960 Ga0207651_10050208 Ga0207651_100502081 473
506 3300026035 Ga0207703_10025184 Ga0207703_100251842 473
507 3300026095 Ga0207676_10107685 Ga0207676_101076851 473
508 3300032002 Ga0307416_100019252 Ga0307416_1000192525 473
509 3300034820 Ga0373959_0001827 Ga0373959_0001827_44_1780 473
510 3300035085 Ga0373929_0000084 Ga0373929_0000084_9743_11479 473
511 3300035090 Ga0373949_0000458 Ga0373949_0000458_1464_3200 473
512 3300035091 Ga0373951_0004686 Ga0373951_0004686_1139_2875 473
513 3300035112 Ga0373932_0003788 Ga0373932_0003788_1291_3027 473
514 3300035115 Ga0373941_0000491 Ga0373941_0000491_5358_7094 473
515 3300035121 Ga0373960_0001976 Ga0373960_0001976_20_1756 473
516 3300035241 Ga0373961_0005974 Ga0373961_0005974_643_2379 473
517 3300035691 Ga0373931_0000748 Ga0373931_0000748_11720_13456 473
518 3300045051 Ga0451576_0007358 Ga0451576_0007358_7235_8971 473
519 3300048904 Ga0496101_0055336 Ga0496101_0055336_587_2314 473
520 3300048915 Ga0496112_0001657 Ga0496112_0001657_8012_9739 473
521 3300048917 Ga0496114_0143698 Ga0496114_0143698_262_1989 473
522 3300050513 nmdc:mga0rr50_61271_c1 nmdc:mga0rr50_61271_c1_614_2347 473
523 3300005347 Ga0070668_100066077 Ga0070668_1000660774 474
524 3300005356 Ga0070674_100010219 Ga0070674_1000102196 474
525 3300005440 Ga0070705_100014159 Ga0070705_1000141592 474
526 3300005458 Ga0070681_10193788 Ga0070681_101937881 474
527 3300005546 Ga0070696_100012815 Ga0070696_1000128154 474
528 3300006844 Ga0075428_100000007 Ga0075428_100000007229 474
529 3300009094 Ga0111539_10000009 Ga0111539_10000009162 474
530 3300009148 Ga0105243_10010061 Ga0105243_100100614 474
531 3300009176 Ga0105242_10020330 Ga0105242_100203304 474
532 3300009176 Ga0105242_10102061 Ga0105242_101020611 474
533 3300014326 Ga0157380_10007605 Ga0157380_100076054 474
534 3300025921 Ga0207652_10012813 Ga0207652_100128135 474
535 3300025941 Ga0207711_10051810 Ga0207711_100518103 474
536 3300026118 Ga0207675_100039295 Ga0207675_1000392952 474
537 3300027907 Ga0207428_10000022 Ga0207428_10000022229 474
538 3300032002 Ga0307416_100038333 Ga0307416_1000383334 474
539 3300032002 Ga0307416_100073635 Ga0307416_1000736354 474
540 3300041997 Ga0439431_0004697 Ga0439431_0004697_812_2554 474
541 3300042156 Ga0439446_0001479 Ga0439446_0001479_2410_4152 474
542 3300049572 Ga0501036_0076618 Ga0501036_0076618_623_2323 474
543 3300049582 Ga0501048_0077740 Ga0501048_0077740_551_2251 474
544 3300049592 Ga0501076_0060228 Ga0501076_0060228_526_2226 474
545 3300049824 Ga0501045_0061233 Ga0501045_0061233_608_2308 474
546 3300050511 nmdc:mga08y16_21_c1 nmdc:mga08y16_21_c1_16067_17767 474
547 3300050514 nmdc:mga08x19_101405_c1 nmdc:mga08x19_101405_c1_160_1896 474
548 3300054114 Ga0501084_0041468 Ga0501084_0041468_1670_3370 474
549 3300005343 Ga0070687_100006711 Ga0070687_1000067113 475
550 3300005366 Ga0070659_100030340 Ga0070659_1000303402 475
551 3300005436 Ga0070713_100061646 Ga0070713_1000616463 475
552 3300005544 Ga0070686_100000149 Ga0070686_10000014934 475
553 3300006028 Ga0070717_10174215 Ga0070717_101742151 475
554 3300006353 Ga0075370_10004647 Ga0075370_100046474 475
555 3300025909 Ga0207705_10125308 Ga0207705_101253081 475
556 3300025918 Ga0207662_10019813 Ga0207662_100198133 475
557 3300025932 Ga0207690_10084519 Ga0207690_100845192 475
558 3300046463 Ga0495653_0005429 Ga0495653_0005429_61_1833 475
559 3300049568 Ga0501031_0010460 Ga0501031_0010460_3956_5671 475
560 3300053077 Ga0495601_0024117 Ga0495601_0024117_1088_2869 475
561 3300060353 Ga0501082_0017507 Ga0501082_0017507_268_1983 475
562 3300005331 Ga0070670_100023242 Ga0070670_1000232424 476
563 3300005339 Ga0070660_100066652 Ga0070660_1000666522 476
564 3300006844 Ga0075428_100138284 Ga0075428_1001382841 476
565 3300006846 Ga0075430_100003772 Ga0075430_1000037723 476
566 3300006847 Ga0075431_100007345 Ga0075431_1000073453 476
567 3300006871 Ga0075434_100095782 Ga0075434_1000957821 476
568 3300009147 Ga0114129_10005748 Ga0114129_100057484 476
569 3300025925 Ga0207650_10023408 Ga0207650_100234084 476
570 3300049571 Ga0501034_0006507 Ga0501034_0006507_5316_7103 476
571 3300049742 Ga0501080_0041000 Ga0501080_0041000_2165_3916 476
572 3300050507 nmdc:mga05p37_1547_c1 nmdc:mga05p37_1547_c1_16859_18589 476
573 3300050515 nmdc:mga0a205_21189_c1 nmdc:mga0a205_21189_c1_2312_4042 476
574 3300042007 Ga0439449_0025026 Ga0439449_0025026_189_1943 477
575 3300042156 Ga0439446_0012122 Ga0439446_0012122_464_2218 477
576 3300048915 Ga0496112_0077562 Ga0496112_0077562_10_1761 477
577 3300003162 Ga0006778J45830_1035146 Ga0006778J45830_10351462 478
578 3300003577 Ga0007416J51690_1013494 Ga0007416J51690_10134942 478
579 3300003693 Ga0032354_1006421 Ga0032354_10064212 478
580 3300004801 Ga0058860_12181476 Ga0058860_121814762 478
581 3300050513 nmdc:mga0rr50_9579_c1 nmdc:mga0rr50_9579_c1_1033_2652 478
582 3300050515 nmdc:mga0a205_32367_c1 nmdc:mga0a205_32367_c1_2324_3943 478
583 3300053085 Ga0495619_0022749 Ga0495619_0022749_1681_3432 478
584 3300005328 Ga0070676_10022394 Ga0070676_100223943 479
585 3300005341 Ga0070691_10014987 Ga0070691_100149872 479
586 3300005353 Ga0070669_100025468 Ga0070669_1000254683 479
587 3300005355 Ga0070671_100015606 Ga0070671_1000156065 479
588 3300005367 Ga0070667_100076368 Ga0070667_1000763682 479
589 3300005438 Ga0070701_10006600 Ga0070701_100066004 479
590 3300005441 Ga0070700_100050380 Ga0070700_1000503802 479
591 3300005456 Ga0070678_100046932 Ga0070678_1000469322 479
592 3300005530 Ga0070679_100138153 Ga0070679_1001381531 479
593 3300005617 Ga0068859_100067301 Ga0068859_1000673014 479
594 3300006847 Ga0075431_100191097 Ga0075431_1001910972 479
595 3300006931 Ga0097620_100067301 Ga0097620_1000673013 479
596 3300009147 Ga0114129_10126228 Ga0114129_101262282 479
597 3300009148 Ga0105243_10014062 Ga0105243_100140624 479
598 3300009176 Ga0105242_10023819 Ga0105242_100238194 479
599 3300009177 Ga0105248_10100656 Ga0105248_101006563 479
600 3300009553 Ga0105249_10043569 Ga0105249_100435693 479
601 3300020080 Ga0206350_11054261 Ga0206350_110542612 479
602 3300025907 Ga0207645_10002364 Ga0207645_100023645 479
603 3300025918 Ga0207662_10002541 Ga0207662_100025416 479
604 3300025926 Ga0207659_10083354 Ga0207659_100833542 479
605 3300025932 Ga0207690_10039956 Ga0207690_100399562 479
606 3300025937 Ga0207669_10007991 Ga0207669_100079912 479
607 3300025940 Ga0207691_10014038 Ga0207691_100140384 479
608 3300025941 Ga0207711_10007837 Ga0207711_100078375 479
609 3300025960 Ga0207651_10001095 Ga0207651_100010954 479
610 3300026035 Ga0207703_10068158 Ga0207703_100681582 479
611 3300026075 Ga0207708_10002436 Ga0207708_100024363 479
612 3300026118 Ga0207675_100085609 Ga0207675_1000856093 479
613 3300026121 Ga0207683_10060044 Ga0207683_100600442 479
614 3300028381 Ga0268264_10048412 Ga0268264_100484124 479
615 3300031824 Ga0307413_10052123 Ga0307413_100521232 479
616 3300050507 nmdc:mga05p37_135344_c1 nmdc:mga05p37_135344_c1_910_2640 479
617 3300050510 nmdc:mga06r32_50291_c2 nmdc:mga06r32_50291_c2_388_2118 479
618 3300035170 Ga0373943_0012876 Ga0373943_0012876_1898_3679 480
619 3300046683 Ga0495658_0060204 Ga0495658_0060204_219_2000 480
620 3300005293 Ga0065715_10090070 Ga0065715_100900705 482
621 3300005459 Ga0068867_100044322 Ga0068867_1000443222 482
622 3300005547 Ga0070693_100026698 Ga0070693_1000266981 482
623 3300005617 Ga0068859_100096400 Ga0068859_1000964002 482
624 3300005844 Ga0068862_100009105 Ga0068862_1000091054 482
625 3300006844 Ga0075428_100095734 Ga0075428_1000957343 482
626 3300006871 Ga0075434_100145371 Ga0075434_1001453711 482
627 3300006871 Ga0075434_100182991 Ga0075434_1001829912 482
628 3300006880 Ga0075429_100051087 Ga0075429_1000510871 482
629 3300006931 Ga0097620_100096401 Ga0097620_1000964012 482
630 3300025940 Ga0207691_10030433 Ga0207691_100304334 482
631 3300027907 Ga0207428_10008515 Ga0207428_100085153 482
632 3300027907 Ga0207428_10042173 Ga0207428_100421733 482
633 3300050507 nmdc:mga05p37_20134_c1 nmdc:mga05p37_20134_c1_1396_3180 482
634 3300005329 Ga0070683_100000059 Ga0070683_1000000598 483
635 3300005367 Ga0070667_100077401 Ga0070667_1000774012 483
636 3300005455 Ga0070663_100017284 Ga0070663_1000172843 483
637 3300005544 Ga0070686_100075395 Ga0070686_1000753952 483
638 3300009545 Ga0105237_10186657 Ga0105237_101866572 483
639 3300010375 Ga0105239_10206816 Ga0105239_102068162 483
640 3300013308 Ga0157375_10123905 Ga0157375_101239052 483
641 3300025920 Ga0207649_10093603 Ga0207649_100936031 483
642 3300025944 Ga0207661_10012004 Ga0207661_100120041 483
643 3300005439 Ga0070711_100040437 Ga0070711_1000404371 484
644 3300005841 Ga0068863_100113371 Ga0068863_1001133711 484
645 3300005441 Ga0070700_100041058 Ga0070700_1000410582 485
646 3300006844 Ga0075428_100103065 Ga0075428_1001030652 485
647 3300006852 Ga0075433_10022542 Ga0075433_100225424 485
648 3300025923 Ga0207681_10007797 Ga0207681_100077975 485
649 3300026075 Ga0207708_10019848 Ga0207708_100198483 485
650 3300026116 Ga0207674_10108335 Ga0207674_101083352 485
651 3300002459 JGI24751J29686_10009595 JGI24751J29686_100095952 486
652 3300005353 Ga0070669_100070750 Ga0070669_1000707502 486
653 3300005577 Ga0068857_100046481 Ga0068857_1000464812 486
654 3300025926 Ga0207659_10030853 Ga0207659_100308532 486
655 3300025933 Ga0207706_10155877 Ga0207706_101558771 486
656 3300025940 Ga0207691_10164204 Ga0207691_101642042 486
657 3300026116 Ga0207674_10034434 Ga0207674_100344343 486

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00691

OmpA

OmpA family

471

566

0.95

PF17963

Big_9

Bacterial Ig domain

376

459

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
4pr7-assembly1.cif.gz_A kdgm porin in complex with disordered oligogalacturonate 0.8095 31 300
4pr7-assembly1.cif.gz_A kdgm porin in complex with disordered oligogalacturonate 0.792 31 300
4fqe-assembly1.cif.gz_A kdgm porin 0.789 31 300
2hqs-assembly1.cif.gz_H crystal structure of tolb/pal complex 0.7822 380 482
4pwt-assembly3.cif.gz_C crystal structure of peptidoglycan-associated outer membrane lipoprotein from yersinia pestis co92 0.7724 380 486
ID Description Score Start End Superfamily
4fqeA00 Mainly Beta;Beta Barrel;Porin;monomeric porin ompg 0.789 31 300 2.40.160.40
4fqeA00 Mainly Beta;Beta Barrel;Porin;monomeric porin ompg 0.7721 31 300 2.40.160.40
4pwtC00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;OmpA-like domain 0.7667 380 486 3.30.1330.60
2w8bC00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;OmpA-like domain 0.7661 380 482 3.30.1330.60
af_P0A910_199_343_3.30.1330.60 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;OmpA-like domain 0.7602 371 486 3.30.1330.60
ID Description Score Start End GO Terms
AF-A0A7W0LC21-F1-model_v4 Uncharacterized protein 0.9953 6 243
AF-A0A3R5YUZ6-F1-model_v4 OmpA-like domain-containing protein 0.8573 374 485 GO:0009279
AF-A0A6N8WW03-F1-model_v4 Transporter 0.8382 19 299
AF-A0A7Y1XZE7-F1-model_v4 OmpA family protein 0.8271 370 486 GO:0016020
AF-A0A5C6U808-F1-model_v4 OmpA family protein 0.826 370 486 GO:0016020

Feature Viewer

pLDDT pTM Quality
83.74 0.66 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map