F473088
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 657 | 279 | 657 | 519 |
Family's Representative Sequence
| Representative Sequence | 3300009094|Ga0111539_10037248|Ga0111539_100372482 |
| Length | 576 |
| Sequence | LQQQALSNGTAFVPFRICRGETIMRRVFLIVLVAGVVTSSPLWAQNSSGQGQAQTQPPVETKAERMATATYWGDTGLWFVPTAEVVRPKGWSISAYRTEFDFRQGLTDVSDFPVTVAAGAGPRLEIFGALRVVTRIDRDTRPLFQATDTSEGGLTNDRPFVNSTWTGNQLGDLYLGAKGNLLSEGVQQPLALAVRGTVKLPTADKDKGAGTGEYDYFADVVLSKELARRVEITGFTGMAWRGDPDGVNLSDGWRWGFGAAFGARSNLRFTTEIFGEESFENDVIAQPGVVTGVDGSISPVISALDQGTTSVFGLTWQHSSGVSLGVAGSYQSGLDLPSGEGSRGWGMQFRMGFHRGVRVFVPPAPRFVGGLAPERGPSVKAQCDPCRVEVGKTSSITATSNDPDGDSVQYQWKTAAGTLADTRAASTVWTAETRPGTVALTVTADDGKGGLATDTVNIEVFRRALMFGEVHFDLDESVLRPEARTVLDQAARTLKENPDVHVQIEGHTSEEASAEYNQALGSRRAQAVREYLVKQGVEASRLDTISYGKTRPKYDNSKEETRRLNRRADLVVEDGK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 2 | 3300003162 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 3 | 3300003163 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 4 | 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 5 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 6 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 7 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 8 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 9 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 10 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 11 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 12 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 13 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 14 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 15 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 49 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 60 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 62 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 63 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 64 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 65 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 66 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 67 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 68 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 69 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 70 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 71 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 74 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 75 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 76 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 77 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 78 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 79 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 80 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 81 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 82 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 83 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 85 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 103 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 104 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 105 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 106 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 146 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 150 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 151 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 152 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 153 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 154 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 155 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 156 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 157 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 158 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 159 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 160 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 161 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 162 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 163 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 164 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 165 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 166 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 167 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 168 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 169 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 170 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 171 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 172 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 173 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 174 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 175 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 176 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 177 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 178 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 179 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 180 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 181 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 182 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 197 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 198 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 199 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 200 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 201 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 202 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 203 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 204 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 205 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 206 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 207 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 208 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 209 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 210 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 211 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 212 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 213 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 214 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 215 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 216 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 217 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 218 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 219 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 220 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 221 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 222 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 225 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 226 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 227 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 228 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 231 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 232 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 233 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 235 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 237 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 239 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 240 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 241 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 242 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 243 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 244 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 245 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 246 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 247 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 248 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 249 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 250 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 254 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 255 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 256 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 257 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 258 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 259 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 261 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 262 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 263 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 264 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 265 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 266 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 267 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 268 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 269 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 270 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 271 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 272 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 273 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 274 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 275 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 276 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 277 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 278 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.85 |
| Metatranscriptomes | 7.15 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.52 |
| Nodule | 0 |
| Rhizoplane | 2.89 |
| Rhizosphere | 94.82 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.76 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24751J29686_10009595 | 3300002459 | Bacteria | 1992 |
| 2 | Ga0006778J45830_1035146 | 3300003162 | Bacteria | 2647 |
| 3 | Ga0006759J45824_1031218 | 3300003163 | Bacteria | 2289 |
| 4 | Ga0007417J51691_1028357 | 3300003544 | Bacteria | 2236 |
| 5 | Ga0007410J51695_1016549 | 3300003574 | Bacteria | 2293 |
| 6 | Ga0007409J51694_1020425 | 3300003575 | Bacteria | 2286 |
| 7 | Ga0007416J51690_1013267 | 3300003577 | Bacteria | 2284 |
| 8 | Ga0007416J51690_1013494 | 3300003577 | Bacteria | 2771 |
| 9 | Ga0007416J51690_1020095 | 3300003577 | Bacteria | 2277 |
| 10 | Ga0007416J51690_1031937 | 3300003577 | Bacteria | 2231 |
| 11 | Ga0032354_1004787 | 3300003693 | Bacteria | 2343 |
| 12 | Ga0032354_1006421 | 3300003693 | Bacteria | 2600 |
| 13 | Ga0032354_1045718 | 3300003693 | Bacteria | 2219 |
| 14 | Ga0058859_10104188 | 3300004798 | Unclassified | 1884 |
| 15 | Ga0058863_10034124 | 3300004799 | Bacteria | 2805 |
| 16 | Ga0058861_11984001 | 3300004800 | Bacteria | 2337 |
| 17 | Ga0058860_10004412 | 3300004801 | Bacteria | 2344 |
| 18 | Ga0058860_10047880 | 3300004801 | Bacteria | 2260 |
| 19 | Ga0058860_10070698 | 3300004801 | Bacteria | 2279 |
| 20 | Ga0058860_12181476 | 3300004801 | Unclassified | 2033 |
| 21 | Ga0058862_12893455 | 3300004803 | Bacteria | 2453 |
| 22 | Ga0065712_10067993 | 3300005290 | Bacteria | 17664 |
| 23 | Ga0065715_10090070 | 3300005293 | Bacteria | 7744 |
| 24 | Ga0065707_10083167 | 3300005295 | Bacteria | 10134 |
| 25 | Ga0070658_10020720 | 3300005327 | Bacteria | 5267 |
| 26 | Ga0070676_10022394 | 3300005328 | Bacteria | 3542 |
| 27 | Ga0070683_100000059 | 3300005329 | Bacteria | 81605 |
| 28 | Ga0070683_100003662 | 3300005329 | Bacteria | 12525 |
| 29 | Ga0070670_100009033 | 3300005331 | Bacteria | 8515 |
| 30 | Ga0070670_100022034 | 3300005331 | Bacteria | 5483 |
| 31 | Ga0070670_100023242 | 3300005331 | Bacteria | 5336 |
| 32 | Ga0070670_100066580 | 3300005331 | Bacteria | 3091 |
| 33 | Ga0070666_10016095 | 3300005335 | Bacteria | 4779 |
| 34 | Ga0070666_10047193 | 3300005335 | Bacteria | 2891 |
| 35 | Ga0070680_100041770 | 3300005336 | Bacteria | 3719 |
| 36 | Ga0070680_100143461 | 3300005336 | Bacteria | 2003 |
| 37 | Ga0070660_100047168 | 3300005339 | Bacteria | 3305 |
| 38 | Ga0070660_100066652 | 3300005339 | Bacteria | 2803 |
| 39 | Ga0070689_100034367 | 3300005340 | Bacteria | 3867 |
| 40 | Ga0070689_100076412 | 3300005340 | Bacteria | 2623 |
| 41 | Ga0070691_10014987 | 3300005341 | Bacteria | 3560 |
| 42 | Ga0070687_100006711 | 3300005343 | Bacteria | 4739 |
| 43 | Ga0070661_100104122 | 3300005344 | Bacteria | 2114 |
| 44 | Ga0070668_100066077 | 3300005347 | Bacteria | 2806 |
| 45 | Ga0070669_100025468 | 3300005353 | Bacteria | 4249 |
| 46 | Ga0070669_100070750 | 3300005353 | Bacteria | 2580 |
| 47 | Ga0070675_100000033 | 3300005354 | Bacteria | 94281 |
| 48 | Ga0070675_100001858 | 3300005354 | Bacteria | 15576 |
| 49 | Ga0070675_100002124 | 3300005354 | Bacteria | 14642 |
| 50 | Ga0070675_100028899 | 3300005354 | Bacteria | 4467 |
| 51 | Ga0070675_100043940 | 3300005354 | Bacteria | 3654 |
| 52 | Ga0070675_100178210 | 3300005354 | Bacteria | 1836 |
| 53 | Ga0070671_100009207 | 3300005355 | Bacteria | 7931 |
| 54 | Ga0070671_100015606 | 3300005355 | Bacteria | 6137 |
| 55 | Ga0070671_100062713 | 3300005355 | Bacteria | 3095 |
| 56 | Ga0070674_100010219 | 3300005356 | Bacteria | 5662 |
| 57 | Ga0070673_100001301 | 3300005364 | Bacteria | 14537 |
| 58 | Ga0070673_100013792 | 3300005364 | Bacteria | 5606 |
| 59 | Ga0070673_100026380 | 3300005364 | Bacteria | 4290 |
| 60 | Ga0070673_100036998 | 3300005364 | Bacteria | 3715 |
| 61 | Ga0070673_100085693 | 3300005364 | Bacteria | 2565 |
| 62 | Ga0070688_100020510 | 3300005365 | Bacteria | 3844 |
| 63 | Ga0070659_100030340 | 3300005366 | Bacteria | 4184 |
| 64 | Ga0070667_100015415 | 3300005367 | Bacteria | 6319 |
| 65 | Ga0070667_100047841 | 3300005367 | Bacteria | 3599 |
| 66 | Ga0070667_100076368 | 3300005367 | Bacteria | 2860 |
| 67 | Ga0070667_100077401 | 3300005367 | Bacteria | 2840 |
| 68 | Ga0070667_100162181 | 3300005367 | Bacteria | 1970 |
| 69 | Ga0070709_10091572 | 3300005434 | Unclassified | 2007 |
| 70 | Ga0070714_100013434 | 3300005435 | Bacteria | 6562 |
| 71 | Ga0070713_100038745 | 3300005436 | Unclassified | 3865 |
| 72 | Ga0070713_100061646 | 3300005436 | Unclassified | 3138 |
| 73 | Ga0070701_10006600 | 3300005438 | Bacteria | 4894 |
| 74 | Ga0070701_10015399 | 3300005438 | Bacteria | 3531 |
| 75 | Ga0070711_100040437 | 3300005439 | Unclassified | 3145 |
| 76 | Ga0070705_100014159 | 3300005440 | Bacteria | 4098 |
| 77 | Ga0070700_100041058 | 3300005441 | Unclassified | 2835 |
| 78 | Ga0070700_100050380 | 3300005441 | Bacteria | 2588 |
| 79 | Ga0070663_100017284 | 3300005455 | Bacteria | 4704 |
| 80 | Ga0070663_100038053 | 3300005455 | Bacteria | 3353 |
| 81 | Ga0070678_100009865 | 3300005456 | Bacteria | 5805 |
| 82 | Ga0070678_100046932 | 3300005456 | Bacteria | 3101 |
| 83 | Ga0070678_100123059 | 3300005456 | Bacteria | 2049 |
| 84 | Ga0070662_100122927 | 3300005457 | Bacteria | 1991 |
| 85 | Ga0070681_10193788 | 3300005458 | Unclassified | 1951 |
| 86 | Ga0068867_100039474 | 3300005459 | Bacteria | 3442 |
| 87 | Ga0068867_100044322 | 3300005459 | Bacteria | 3259 |
| 88 | Ga0070685_10045828 | 3300005466 | Bacteria | 2509 |
| 89 | Ga0070685_10067350 | 3300005466 | Bacteria | 2112 |
| 90 | Ga0070698_100049353 | 3300005471 | Bacteria | 4296 |
| 91 | Ga0070698_100120713 | 3300005471 | Bacteria | 2582 |
| 92 | Ga0070698_100192018 | 3300005471 | Bacteria | 1979 |
| 93 | Ga0070699_100005625 | 3300005518 | Bacteria | 10990 |
| 94 | Ga0070699_100024264 | 3300005518 | Bacteria | 5224 |
| 95 | Ga0070699_100093606 | 3300005518 | Bacteria | 2629 |
| 96 | Ga0070679_100138153 | 3300005530 | Bacteria | 2418 |
| 97 | Ga0070679_100146066 | 3300005530 | Bacteria | 2343 |
| 98 | Ga0070679_100164783 | 3300005530 | Bacteria | 2190 |
| 99 | Ga0070686_100000149 | 3300005544 | Bacteria | 47841 |
| 100 | Ga0070686_100024951 | 3300005544 | Bacteria | 3589 |
| 101 | Ga0070686_100075395 | 3300005544 | Bacteria | 2219 |
| 102 | Ga0070695_100078438 | 3300005545 | Bacteria | 2178 |
| 103 | Ga0070696_100012815 | 3300005546 | Bacteria | 5628 |
| 104 | Ga0070693_100013639 | 3300005547 | Bacteria | 4144 |
| 105 | Ga0070693_100026698 | 3300005547 | Bacteria | 3120 |
| 106 | Ga0070665_100113684 | 3300005548 | Bacteria | 2710 |
| 107 | Ga0070704_100008604 | 3300005549 | Bacteria | 6131 |
| 108 | Ga0070704_100038820 | 3300005549 | Bacteria | 3265 |
| 109 | Ga0068855_100088768 | 3300005563 | Bacteria | 3571 |
| 110 | Ga0070664_100205560 | 3300005564 | Bacteria | 1758 |
| 111 | Ga0068857_100046481 | 3300005577 | Bacteria | 3852 |
| 112 | Ga0068852_100074866 | 3300005616 | Bacteria | 2984 |
| 113 | Ga0068859_100009968 | 3300005617 | Bacteria | 9585 |
| 114 | Ga0068859_100067301 | 3300005617 | Bacteria | 3616 |
| 115 | Ga0068859_100096400 | 3300005617 | Unclassified | 3011 |
| 116 | Ga0068859_100098545 | 3300005617 | Bacteria | 2977 |
| 117 | Ga0068864_100028057 | 3300005618 | Bacteria | 4757 |
| 118 | Ga0068864_100084020 | 3300005618 | Bacteria | 2797 |
| 119 | Ga0068863_100113371 | 3300005841 | Bacteria | 2582 |
| 120 | Ga0068858_100002991 | 3300005842 | Bacteria | 16949 |
| 121 | Ga0068858_100164348 | 3300005842 | Bacteria | 2091 |
| 122 | Ga0068860_100070741 | 3300005843 | Bacteria | 3317 |
| 123 | Ga0068862_100006534 | 3300005844 | Bacteria | 9675 |
| 124 | Ga0068862_100009105 | 3300005844 | Bacteria | 8218 |
| 125 | Ga0068862_100033033 | 3300005844 | Bacteria | 4371 |
| 126 | Ga0081455_10075493 | 3300005937 | Bacteria | 2780 |
| 127 | Ga0081539_10044591 | 3300005985 | Bacteria | 2558 |
| 128 | Ga0070717_10174215 | 3300006028 | Bacteria | 1872 |
| 129 | Ga0097621_100005522 | 3300006237 | Bacteria | 8906 |
| 130 | Ga0097621_100011722 | 3300006237 | Bacteria | 6472 |
| 131 | Ga0097621_100012231 | 3300006237 | Bacteria | 6352 |
| 132 | Ga0097621_100095458 | 3300006237 | Bacteria | 2494 |
| 133 | Ga0075370_10004647 | 3300006353 | Bacteria | 6694 |
| 134 | Ga0068871_100004321 | 3300006358 | Bacteria | 9870 |
| 135 | Ga0068871_100058588 | 3300006358 | Unclassified | 3136 |
| 136 | Ga0068871_100094550 | 3300006358 | Bacteria | 2495 |
| 137 | Ga0075428_100000007 | 3300006844 | Bacteria | 273226 |
| 138 | Ga0075428_100003534 | 3300006844 | Bacteria | 17121 |
| 139 | Ga0075428_100061501 | 3300006844 | Bacteria | 4113 |
| 140 | Ga0075428_100095734 | 3300006844 | Bacteria | 3237 |
| 141 | Ga0075428_100103065 | 3300006844 | Bacteria | 3112 |
| 142 | Ga0075428_100138284 | 3300006844 | Bacteria | 2648 |
| 143 | Ga0075428_100185395 | 3300006844 | Bacteria | 2252 |
| 144 | Ga0075430_100003772 | 3300006846 | Bacteria | 12732 |
| 145 | Ga0075430_100006037 | 3300006846 | Bacteria | 10215 |
| 146 | Ga0075430_100040384 | 3300006846 | Bacteria | 3949 |
| 147 | Ga0075431_100007345 | 3300006847 | Bacteria | 10976 |
| 148 | Ga0075431_100114538 | 3300006847 | Bacteria | 2783 |
| 149 | Ga0075431_100191097 | 3300006847 | Bacteria | 2098 |
| 150 | Ga0075433_10022542 | 3300006852 | Bacteria | 5286 |
| 151 | Ga0075433_10051074 | 3300006852 | Bacteria | 3600 |
| 152 | Ga0075433_10057140 | 3300006852 | Bacteria | 3410 |
| 153 | Ga0075433_10083731 | 3300006852 | Bacteria | 2815 |
| 154 | Ga0075433_10090207 | 3300006852 | Bacteria | 2709 |
| 155 | Ga0075434_100004677 | 3300006871 | Bacteria | 12369 |
| 156 | Ga0075434_100028466 | 3300006871 | Bacteria | 5489 |
| 157 | Ga0075434_100095782 | 3300006871 | Bacteria | 2973 |
| 158 | Ga0075434_100145371 | 3300006871 | Bacteria | 2391 |
| 159 | Ga0075434_100182991 | 3300006871 | Bacteria | 2116 |
| 160 | Ga0075429_100002051 | 3300006880 | Bacteria | 16774 |
| 161 | Ga0075429_100017665 | 3300006880 | Bacteria | 6169 |
| 162 | Ga0075429_100018790 | 3300006880 | Bacteria | 5986 |
| 163 | Ga0075429_100051087 | 3300006880 | Unclassified | 3597 |
| 164 | Ga0068865_100016927 | 3300006881 | Bacteria | 4677 |
| 165 | Ga0075436_100009468 | 3300006914 | Bacteria | 6660 |
| 166 | Ga0097620_100009967 | 3300006931 | Bacteria | 9585 |
| 167 | Ga0097620_100067301 | 3300006931 | Bacteria | 3616 |
| 168 | Ga0097620_100096401 | 3300006931 | Unclassified | 3011 |
| 169 | Ga0097620_100098537 | 3300006931 | Bacteria | 2977 |
| 170 | Ga0075435_100000227 | 3300007076 | Bacteria | 34362 |
| 171 | Ga0075435_100017470 | 3300007076 | Bacteria | 5432 |
| 172 | Ga0075435_100024331 | 3300007076 | Bacteria | 4698 |
| 173 | Ga0105240_10051258 | 3300009093 | Bacteria | 5196 |
| 174 | Ga0105240_10096617 | 3300009093 | Bacteria | 3600 |
| 175 | Ga0105240_10119947 | 3300009093 | Bacteria | 3168 |
| 176 | Ga0111539_10000009 | 3300009094 | Bacteria | 375223 |
| 177 | Ga0111539_10000763 | 3300009094 | Bacteria | 41920 |
| 178 | Ga0111539_10001752 | 3300009094 | Bacteria | 28822 |
| 179 | Ga0111539_10004701 | 3300009094 | Bacteria | 17852 |
| 180 | Ga0111539_10008025 | 3300009094 | Bacteria | 13466 |
| 181 | Ga0111539_10010653 | 3300009094 | Bacteria | 11579 |
| 182 | Ga0111539_10019674 | 3300009094 | Bacteria | 8327 |
| 183 | Ga0111539_10020021 | 3300009094 | Bacteria | 8243 |
| 184 | Ga0111539_10037248 | 3300009094 | Bacteria | 5876 |
| 185 | Ga0111539_10038002 | 3300009094 | Bacteria | 5807 |
| 186 | Ga0111539_10134974 | 3300009094 | Bacteria | 2890 |
| 187 | Ga0105245_10039025 | 3300009098 | Bacteria | 4227 |
| 188 | Ga0114129_10001838 | 3300009147 | Bacteria | 28894 |
| 189 | Ga0114129_10002040 | 3300009147 | Bacteria | 27709 |
| 190 | Ga0114129_10002681 | 3300009147 | Bacteria | 24774 |
| 191 | Ga0114129_10002887 | 3300009147 | Bacteria | 24054 |
| 192 | Ga0114129_10005748 | 3300009147 | Bacteria | 17574 |
| 193 | Ga0114129_10006089 | 3300009147 | Bacteria | 17102 |
| 194 | Ga0114129_10006486 | 3300009147 | Bacteria | 16598 |
| 195 | Ga0114129_10012628 | 3300009147 | Bacteria | 12025 |
| 196 | Ga0114129_10013889 | 3300009147 | Bacteria | 11476 |
| 197 | Ga0114129_10021939 | 3300009147 | Bacteria | 9061 |
| 198 | Ga0114129_10034701 | 3300009147 | Bacteria | 7126 |
| 199 | Ga0114129_10044664 | 3300009147 | Bacteria | 6233 |
| 200 | Ga0114129_10058479 | 3300009147 | Bacteria | 5392 |
| 201 | Ga0114129_10098361 | 3300009147 | Archaea | 4050 |
| 202 | Ga0114129_10126228 | 3300009147 | Bacteria | 3517 |
| 203 | Ga0114129_10255095 | 3300009147 | Bacteria | 2353 |
| 204 | Ga0105243_10010061 | 3300009148 | Bacteria | 7192 |
| 205 | Ga0105243_10014062 | 3300009148 | Bacteria | 6057 |
| 206 | Ga0105242_10014843 | 3300009176 | Bacteria | 6034 |
| 207 | Ga0105242_10018202 | 3300009176 | Bacteria | 5489 |
| 208 | Ga0105242_10020330 | 3300009176 | Bacteria | 5206 |
| 209 | Ga0105242_10023819 | 3300009176 | Bacteria | 4830 |
| 210 | Ga0105242_10102061 | 3300009176 | Unclassified | 2432 |
| 211 | Ga0105248_10003067 | 3300009177 | Bacteria | 18526 |
| 212 | Ga0105248_10005629 | 3300009177 | Bacteria | 13754 |
| 213 | Ga0105248_10022958 | 3300009177 | Bacteria | 6928 |
| 214 | Ga0105248_10027631 | 3300009177 | Bacteria | 6319 |
| 215 | Ga0105248_10033643 | 3300009177 | Bacteria | 5727 |
| 216 | Ga0105248_10047058 | 3300009177 | Bacteria | 4837 |
| 217 | Ga0105248_10067215 | 3300009177 | Bacteria | 4024 |
| 218 | Ga0105248_10100656 | 3300009177 | Bacteria | 3257 |
| 219 | Ga0105237_10186657 | 3300009545 | Bacteria | 2073 |
| 220 | Ga0105238_10102382 | 3300009551 | Bacteria | 2845 |
| 221 | Ga0105249_10043569 | 3300009553 | Bacteria | 4081 |
| 222 | Ga0105249_10106280 | 3300009553 | Bacteria | 2648 |
| 223 | Ga0105239_10206816 | 3300010375 | Bacteria | 2199 |
| 224 | Ga0157374_10048760 | 3300013296 | Bacteria | 3931 |
| 225 | Ga0157375_10123905 | 3300013308 | Bacteria | 2697 |
| 226 | Ga0163163_10000013 | 3300014325 | Bacteria | 242522 |
| 227 | Ga0163163_10021804 | 3300014325 | Bacteria | 6051 |
| 228 | Ga0157380_10001836 | 3300014326 | Bacteria | 14034 |
| 229 | Ga0157380_10002997 | 3300014326 | Bacteria | 11503 |
| 230 | Ga0157380_10005365 | 3300014326 | Bacteria | 8955 |
| 231 | Ga0157380_10007605 | 3300014326 | Bacteria | 7701 |
| 232 | Ga0157380_10016008 | 3300014326 | Bacteria | 5522 |
| 233 | Ga0157380_10046959 | 3300014326 | Bacteria | 3394 |
| 234 | Ga0157379_10052075 | 3300014968 | Bacteria | 3656 |
| 235 | Ga0157376_10014296 | 3300014969 | Bacteria | 5953 |
| 236 | Ga0157376_10045942 | 3300014969 | Bacteria | 3598 |
| 237 | Ga0206356_10089078 | 3300020070 | Bacteria | 2453 |
| 238 | Ga0206356_10818170 | 3300020070 | Bacteria | 2551 |
| 239 | Ga0206356_10872851 | 3300020070 | Bacteria | 2372 |
| 240 | Ga0206350_10488288 | 3300020080 | Bacteria | 2482 |
| 241 | Ga0206350_11054261 | 3300020080 | Bacteria | 2435 |
| 242 | Ga0206354_10781424 | 3300020081 | Bacteria | 2718 |
| 243 | Ga0224712_10014336 | 3300022467 | Bacteria | 2549 |
| 244 | Ga0224712_10017077 | 3300022467 | Bacteria | 2399 |
| 245 | Ga0207697_10010765 | 3300025315 | Bacteria | 3896 |
| 246 | Ga0207645_10002364 | 3300025907 | Bacteria | 14882 |
| 247 | Ga0207643_10043937 | 3300025908 | Unclassified | 2522 |
| 248 | Ga0207705_10125308 | 3300025909 | Bacteria | 1909 |
| 249 | Ga0207684_10132789 | 3300025910 | Bacteria | 2137 |
| 250 | Ga0207695_10025538 | 3300025913 | Bacteria | 6611 |
| 251 | Ga0207695_10137046 | 3300025913 | Bacteria | 2400 |
| 252 | Ga0207671_10084770 | 3300025914 | Bacteria | 2380 |
| 253 | Ga0207660_10051265 | 3300025917 | Bacteria | 2934 |
| 254 | Ga0207660_10131672 | 3300025917 | Bacteria | 1904 |
| 255 | Ga0207662_10002541 | 3300025918 | Bacteria | 9186 |
| 256 | Ga0207662_10019813 | 3300025918 | Bacteria | 3834 |
| 257 | Ga0207657_10053562 | 3300025919 | Bacteria | 3495 |
| 258 | Ga0207649_10050275 | 3300025920 | Bacteria | 2578 |
| 259 | Ga0207649_10093603 | 3300025920 | Bacteria | 1972 |
| 260 | Ga0207652_10012813 | 3300025921 | Bacteria | 6780 |
| 261 | Ga0207652_10164609 | 3300025921 | Bacteria | 1988 |
| 262 | Ga0207646_10032768 | 3300025922 | Bacteria | 4701 |
| 263 | Ga0207681_10007797 | 3300025923 | Bacteria | 6556 |
| 264 | Ga0207650_10023408 | 3300025925 | Bacteria | 4380 |
| 265 | Ga0207650_10083044 | 3300025925 | Bacteria | 2433 |
| 266 | Ga0207659_10000196 | 3300025926 | Bacteria | 35986 |
| 267 | Ga0207659_10000202 | 3300025926 | Bacteria | 35629 |
| 268 | Ga0207659_10004899 | 3300025926 | Bacteria | 8108 |
| 269 | Ga0207659_10030853 | 3300025926 | Bacteria | 3665 |
| 270 | Ga0207659_10083354 | 3300025926 | Bacteria | 2370 |
| 271 | Ga0207700_10006978 | 3300025928 | Bacteria | 6872 |
| 272 | Ga0207644_10023604 | 3300025931 | Bacteria | 4215 |
| 273 | Ga0207690_10039956 | 3300025932 | Bacteria | 3064 |
| 274 | Ga0207690_10084519 | 3300025932 | Bacteria | 2225 |
| 275 | Ga0207706_10082047 | 3300025933 | Bacteria | 2834 |
| 276 | Ga0207706_10155877 | 3300025933 | Bacteria | 2008 |
| 277 | Ga0207670_10005956 | 3300025936 | Bacteria | 6731 |
| 278 | Ga0207669_10007991 | 3300025937 | Bacteria | 4939 |
| 279 | Ga0207704_10003166 | 3300025938 | Bacteria | 7446 |
| 280 | Ga0207691_10005565 | 3300025940 | Bacteria | 12171 |
| 281 | Ga0207691_10014038 | 3300025940 | Bacteria | 7642 |
| 282 | Ga0207691_10030433 | 3300025940 | Bacteria | 5044 |
| 283 | Ga0207691_10038623 | 3300025940 | Bacteria | 4418 |
| 284 | Ga0207691_10164204 | 3300025940 | Bacteria | 1947 |
| 285 | Ga0207711_10007837 | 3300025941 | Bacteria | 8928 |
| 286 | Ga0207711_10050134 | 3300025941 | Bacteria | 3574 |
| 287 | Ga0207711_10051810 | 3300025941 | Unclassified | 3517 |
| 288 | Ga0207711_10093023 | 3300025941 | Bacteria | 2655 |
| 289 | Ga0207711_10111373 | 3300025941 | Bacteria | 2435 |
| 290 | Ga0207661_10012004 | 3300025944 | Bacteria | 6294 |
| 291 | Ga0207661_10141119 | 3300025944 | Bacteria | 2074 |
| 292 | Ga0207679_10051639 | 3300025945 | Bacteria | 3010 |
| 293 | Ga0207651_10001095 | 3300025960 | Bacteria | 12032 |
| 294 | Ga0207651_10005371 | 3300025960 | Bacteria | 6572 |
| 295 | Ga0207651_10050208 | 3300025960 | Bacteria | 2831 |
| 296 | Ga0207658_10149259 | 3300025986 | Bacteria | 1902 |
| 297 | Ga0207703_10004978 | 3300026035 | Bacteria | 10782 |
| 298 | Ga0207703_10025184 | 3300026035 | Bacteria | 4680 |
| 299 | Ga0207703_10068158 | 3300026035 | Bacteria | 2931 |
| 300 | Ga0207639_10092276 | 3300026041 | Bacteria | 2427 |
| 301 | Ga0207678_10018364 | 3300026067 | Bacteria | 6141 |
| 302 | Ga0207678_10101618 | 3300026067 | Bacteria | 2455 |
| 303 | Ga0207708_10002436 | 3300026075 | Bacteria | 13672 |
| 304 | Ga0207708_10019848 | 3300026075 | Bacteria | 5067 |
| 305 | Ga0207641_10002265 | 3300026088 | Bacteria | 17941 |
| 306 | Ga0207648_10052603 | 3300026089 | Bacteria | 3561 |
| 307 | Ga0207648_10055729 | 3300026089 | Bacteria | 3450 |
| 308 | Ga0207676_10107685 | 3300026095 | Bacteria | 2325 |
| 309 | Ga0207674_10034434 | 3300026116 | Bacteria | 5293 |
| 310 | Ga0207674_10108335 | 3300026116 | Unclassified | 2755 |
| 311 | Ga0207675_100023705 | 3300026118 | Bacteria | 5709 |
| 312 | Ga0207675_100039295 | 3300026118 | Bacteria | 4417 |
| 313 | Ga0207675_100085609 | 3300026118 | Bacteria | 2958 |
| 314 | Ga0207683_10018931 | 3300026121 | Bacteria | 5874 |
| 315 | Ga0207683_10036135 | 3300026121 | Bacteria | 4299 |
| 316 | Ga0207683_10038678 | 3300026121 | Bacteria | 4160 |
| 317 | Ga0207683_10060044 | 3300026121 | Bacteria | 3341 |
| 318 | Ga0207428_10000022 | 3300027907 | Bacteria | 273333 |
| 319 | Ga0207428_10000294 | 3300027907 | Bacteria | 66640 |
| 320 | Ga0207428_10002348 | 3300027907 | Bacteria | 18901 |
| 321 | Ga0207428_10002363 | 3300027907 | Bacteria | 18844 |
| 322 | Ga0207428_10008328 | 3300027907 | Bacteria | 9369 |
| 323 | Ga0207428_10008515 | 3300027907 | Bacteria | 9258 |
| 324 | Ga0207428_10009454 | 3300027907 | Bacteria | 8734 |
| 325 | Ga0207428_10021150 | 3300027907 | Bacteria | 5510 |
| 326 | Ga0207428_10028461 | 3300027907 | Bacteria | 4643 |
| 327 | Ga0207428_10042173 | 3300027907 | Bacteria | 3690 |
| 328 | Ga0207428_10086058 | 3300027907 | Bacteria | 2447 |
| 329 | Ga0268266_10017050 | 3300028379 | Bacteria | 6203 |
| 330 | Ga0268266_10182583 | 3300028379 | Unclassified | 1911 |
| 331 | Ga0268265_10013164 | 3300028380 | Bacteria | 5620 |
| 332 | Ga0268265_10021852 | 3300028380 | Bacteria | 4489 |
| 333 | Ga0268264_10048412 | 3300028381 | Bacteria | 3536 |
| 334 | Ga0268264_10087530 | 3300028381 | Bacteria | 2678 |
| 335 | Ga0307408_100009645 | 3300031548 | Bacteria | 6365 |
| 336 | Ga0307408_100016732 | 3300031548 | Bacteria | 4901 |
| 337 | Ga0307413_10052123 | 3300031824 | Bacteria | 2470 |
| 338 | Ga0307409_100003509 | 3300031995 | Bacteria | 8542 |
| 339 | Ga0307409_100054892 | 3300031995 | Bacteria | 3072 |
| 340 | Ga0307409_100063883 | 3300031995 | Bacteria | 2889 |
| 341 | Ga0307416_100019252 | 3300032002 | Bacteria | 4835 |
| 342 | Ga0307416_100019338 | 3300032002 | Bacteria | 4826 |
| 343 | Ga0307416_100038333 | 3300032002 | Bacteria | 3697 |
| 344 | Ga0307416_100049923 | 3300032002 | Unclassified | 3330 |
| 345 | Ga0307416_100064890 | 3300032002 | Bacteria | 2998 |
| 346 | Ga0307416_100073635 | 3300032002 | Bacteria | 2849 |
| 347 | Ga0307411_10017014 | 3300032005 | Bacteria | 4130 |
| 348 | Ga0373959_0001827 | 3300034820 | Bacteria | 3393 |
| 349 | Ga0373929_0000084 | 3300035085 | Bacteria | 15719 |
| 350 | Ga0373934_0020319 | 3300035086 | Bacteria | 2551 |
| 351 | Ga0373949_0000458 | 3300035090 | Bacteria | 14051 |
| 352 | Ga0373951_0004686 | 3300035091 | Bacteria | 3232 |
| 353 | Ga0373932_0003788 | 3300035112 | Bacteria | 3607 |
| 354 | Ga0373941_0000491 | 3300035115 | Bacteria | 7918 |
| 355 | Ga0373956_0016396 | 3300035119 | Bacteria | 3112 |
| 356 | Ga0373960_0001976 | 3300035121 | Bacteria | 4594 |
| 357 | Ga0373943_0012876 | 3300035170 | Bacteria | 3771 |
| 358 | Ga0373943_0057749 | 3300035170 | Bacteria | 1929 |
| 359 | Ga0373946_0057414 | 3300035171 | Unclassified | 1646 |
| 360 | Ga0373955_0012621 | 3300035172 | Bacteria | 4064 |
| 361 | Ga0373961_0005974 | 3300035241 | Bacteria | 2923 |
| 362 | Ga0373931_0000748 | 3300035691 | Bacteria | 13548 |
| 363 | Ga0373931_0084222 | 3300035691 | Bacteria | 1760 |
| 364 | Ga0373935_0026577 | 3300035692 | Unclassified | 3574 |
| 365 | Ga0373937_0000965 | 3300036401 | Bacteria | 24394 |
| 366 | Ga0373937_0066997 | 3300036401 | Bacteria | 3308 |
| 367 | Ga0373925_0003186 | 3300037068 | Bacteria | 12828 |
| 368 | Ga0439461_0012781 | 3300041410 | Bacteria | 1576 |
| 369 | Ga0439431_0004697 | 3300041997 | Bacteria | 3005 |
| 370 | Ga0439449_0025026 | 3300042007 | Bacteria | 2231 |
| 371 | Ga0439450_008299 | 3300042008 | Bacteria | 1935 |
| 372 | Ga0450896_002431 | 3300042133 | Bacteria | 2401 |
| 373 | Ga0439446_0001479 | 3300042156 | Bacteria | 5367 |
| 374 | Ga0439446_0012122 | 3300042156 | Bacteria | 2351 |
| 375 | Ga0439434_0012064 | 3300042435 | Bacteria | 2555 |
| 376 | Ga0439435_0008790 | 3300042436 | Bacteria | 2353 |
| 377 | Ga0439435_0012655 | 3300042436 | Bacteria | 2049 |
| 378 | Ga0451577_0116561 | 3300042876 | Bacteria | 2392 |
| 379 | Ga0453684_0298900 | 3300044712 | Unclassified | 1830 |
| 380 | Ga0451576_0007358 | 3300045051 | Bacteria | 13194 |
| 381 | Ga0451576_0121337 | 3300045051 | Bacteria | 2721 |
| 382 | Ga0495638_0004431 | 3300046460 | Bacteria | 10632 |
| 383 | Ga0495653_0005429 | 3300046463 | Bacteria | 10381 |
| 384 | Ga0495608_0003942 | 3300046511 | Bacteria | 10667 |
| 385 | Ga0495628_0021148 | 3300046516 | Bacteria | 5357 |
| 386 | Ga0495587_0051732 | 3300046536 | Bacteria | 2427 |
| 387 | Ga0495645_0010462 | 3300046543 | Bacteria | 6504 |
| 388 | Ga0495667_0084520 | 3300046559 | Bacteria | 2060 |
| 389 | Ga0495647_0011264 | 3300046681 | Bacteria | 3062 |
| 390 | Ga0495658_0015421 | 3300046683 | Unclassified | 3920 |
| 391 | Ga0495658_0060204 | 3300046683 | Unclassified | 2177 |
| 392 | Ga0495658_0078170 | 3300046683 | Bacteria | 1936 |
| 393 | Ga0495669_0007347 | 3300046684 | Bacteria | 4616 |
| 394 | Ga0495613_0001676 | 3300046689 | Bacteria | 16870 |
| 395 | Ga0495680_0142187 | 3300047322 | Bacteria | 1755 |
| 396 | Ga0495684_0002679 | 3300047471 | Bacteria | 14108 |
| 397 | Ga0495602_0086955 | 3300048088 | Bacteria | 2608 |
| 398 | Ga0496101_0002334 | 3300048904 | Bacteria | 11628 |
| 399 | Ga0496101_0055336 | 3300048904 | Bacteria | 2866 |
| 400 | Ga0496102_0145594 | 3300048905 | Bacteria | 2224 |
| 401 | Ga0496102_0238289 | 3300048905 | Bacteria | 1716 |
| 402 | Ga0496104_0017896 | 3300048907 | Bacteria | 6461 |
| 403 | Ga0496105_0017872 | 3300048908 | Bacteria | 5690 |
| 404 | Ga0496106_0139339 | 3300048909 | Bacteria | 1907 |
| 405 | Ga0496107_0038142 | 3300048910 | Bacteria | 3448 |
| 406 | Ga0496108_0001529 | 3300048911 | Bacteria | 18316 |
| 407 | Ga0496108_0007619 | 3300048911 | Bacteria | 8767 |
| 408 | Ga0496109_0079309 | 3300048912 | Bacteria | 3025 |
| 409 | Ga0496111_0010159 | 3300048914 | Bacteria | 6303 |
| 410 | Ga0496112_0001657 | 3300048915 | Bacteria | 17310 |
| 411 | Ga0496112_0018705 | 3300048915 | Bacteria | 6530 |
| 412 | Ga0496112_0035087 | 3300048915 | Bacteria | 4882 |
| 413 | Ga0496112_0077562 | 3300048915 | Bacteria | 3286 |
| 414 | Ga0496112_0241470 | 3300048915 | Bacteria | 1759 |
| 415 | Ga0496114_0000913 | 3300048917 | Bacteria | 22113 |
| 416 | Ga0496114_0143698 | 3300048917 | Bacteria | 2067 |
| 417 | Ga0501031_0001226 | 3300049568 | Bacteria | 15706 |
| 418 | Ga0501031_0010460 | 3300049568 | Bacteria | 6043 |
| 419 | Ga0501031_0012051 | 3300049568 | Bacteria | 5636 |
| 420 | Ga0501031_0108255 | 3300049568 | Bacteria | 1814 |
| 421 | Ga0501032_0024275 | 3300049569 | Bacteria | 4187 |
| 422 | Ga0501032_0044638 | 3300049569 | Bacteria | 2999 |
| 423 | Ga0501033_0003900 | 3300049570 | Bacteria | 12124 |
| 424 | Ga0501033_0012408 | 3300049570 | Bacteria | 6503 |
| 425 | Ga0501033_0035764 | 3300049570 | Bacteria | 3723 |
| 426 | Ga0501034_0006507 | 3300049571 | Bacteria | 12562 |
| 427 | Ga0501034_0010668 | 3300049571 | Bacteria | 9548 |
| 428 | Ga0501034_0041541 | 3300049571 | Bacteria | 4653 |
| 429 | Ga0501036_0004166 | 3300049572 | Bacteria | 11640 |
| 430 | Ga0501036_0009652 | 3300049572 | Bacteria | 7940 |
| 431 | Ga0501036_0042173 | 3300049572 | Bacteria | 3863 |
| 432 | Ga0501036_0048668 | 3300049572 | Unclassified | 3589 |
| 433 | Ga0501036_0076618 | 3300049572 | Bacteria | 2829 |
| 434 | Ga0501036_0087865 | 3300049572 | Bacteria | 2627 |
| 435 | Ga0501037_0012782 | 3300049573 | Bacteria | 6185 |
| 436 | Ga0501037_0021613 | 3300049573 | Bacteria | 4757 |
| 437 | Ga0501037_0055376 | 3300049573 | Bacteria | 2900 |
| 438 | Ga0501037_0136856 | 3300049573 | Bacteria | 1754 |
| 439 | Ga0501038_0003687 | 3300049574 | Bacteria | 14268 |
| 440 | Ga0501038_0003987 | 3300049574 | Bacteria | 13704 |
| 441 | Ga0501038_0005770 | 3300049574 | Bacteria | 11465 |
| 442 | Ga0501038_0039366 | 3300049574 | Bacteria | 4134 |
| 443 | Ga0501038_0075564 | 3300049574 | Bacteria | 2847 |
| 444 | Ga0501039_0015015 | 3300049575 | Bacteria | 5925 |
| 445 | Ga0501039_0035877 | 3300049575 | Bacteria | 3827 |
| 446 | Ga0501039_0037349 | 3300049575 | Bacteria | 3748 |
| 447 | Ga0501039_0060303 | 3300049575 | Unclassified | 2938 |
| 448 | Ga0501040_0038476 | 3300049576 | Unclassified | 3252 |
| 449 | Ga0501040_0044809 | 3300049576 | Bacteria | 3016 |
| 450 | Ga0501040_0088365 | 3300049576 | Bacteria | 2152 |
| 451 | Ga0501040_0092029 | 3300049576 | Bacteria | 2108 |
| 452 | Ga0501040_0099139 | 3300049576 | Bacteria | 2031 |
| 453 | Ga0501041_0012056 | 3300049577 | Bacteria | 5116 |
| 454 | Ga0501041_0053020 | 3300049577 | Bacteria | 2473 |
| 455 | Ga0501041_0072104 | 3300049577 | Bacteria | 2121 |
| 456 | Ga0501042_0000551 | 3300049578 | Bacteria | 19742 |
| 457 | Ga0501042_0002232 | 3300049578 | Bacteria | 11828 |
| 458 | Ga0501043_0002195 | 3300049579 | Bacteria | 16639 |
| 459 | Ga0501043_0096988 | 3300049579 | Bacteria | 2318 |
| 460 | Ga0501043_0123373 | 3300049579 | Bacteria | 2031 |
| 461 | Ga0501046_0023381 | 3300049580 | Bacteria | 5086 |
| 462 | Ga0501046_0054796 | 3300049580 | Bacteria | 3135 |
| 463 | Ga0501046_0078290 | 3300049580 | Bacteria | 2557 |
| 464 | Ga0501046_0090356 | 3300049580 | Bacteria | 2356 |
| 465 | Ga0501047_0002381 | 3300049581 | Bacteria | 17984 |
| 466 | Ga0501047_0002980 | 3300049581 | Bacteria | 16060 |
| 467 | Ga0501048_0010204 | 3300049582 | Bacteria | 7022 |
| 468 | Ga0501048_0014220 | 3300049582 | Bacteria | 5895 |
| 469 | Ga0501048_0028312 | 3300049582 | Bacteria | 4066 |
| 470 | Ga0501048_0029438 | 3300049582 | Unclassified | 3983 |
| 471 | Ga0501048_0077740 | 3300049582 | Bacteria | 2342 |
| 472 | Ga0501067_0002412 | 3300049583 | Bacteria | 10335 |
| 473 | Ga0501067_0004704 | 3300049583 | Bacteria | 7554 |
| 474 | Ga0501067_0038604 | 3300049583 | Bacteria | 2651 |
| 475 | Ga0501067_0054491 | 3300049583 | Bacteria | 2216 |
| 476 | Ga0501068_0005054 | 3300049584 | Bacteria | 7187 |
| 477 | Ga0501068_0023174 | 3300049584 | Bacteria | 3636 |
| 478 | Ga0501068_0095723 | 3300049584 | Bacteria | 1836 |
| 479 | Ga0501069_0012427 | 3300049585 | Bacteria | 4525 |
| 480 | Ga0501069_0025233 | 3300049585 | Bacteria | 3247 |
| 481 | Ga0501070_0022289 | 3300049586 | Bacteria | 5307 |
| 482 | Ga0501071_0008094 | 3300049587 | Bacteria | 6932 |
| 483 | Ga0501071_0008546 | 3300049587 | Bacteria | 6773 |
| 484 | Ga0501071_0049453 | 3300049587 | Bacteria | 3027 |
| 485 | Ga0501071_0075220 | 3300049587 | Bacteria | 2465 |
| 486 | Ga0501071_0090619 | 3300049587 | Bacteria | 2245 |
| 487 | Ga0501072_0016347 | 3300049588 | Bacteria | 5693 |
| 488 | Ga0501072_0026113 | 3300049588 | Bacteria | 4551 |
| 489 | Ga0501072_0027598 | 3300049588 | Bacteria | 4429 |
| 490 | Ga0501072_0040448 | 3300049588 | Bacteria | 3661 |
| 491 | Ga0501072_0047397 | 3300049588 | Bacteria | 3385 |
| 492 | Ga0501072_0050134 | 3300049588 | Bacteria | 3287 |
| 493 | Ga0501072_0155842 | 3300049588 | Bacteria | 1821 |
| 494 | Ga0501073_0000524 | 3300049589 | Bacteria | 26883 |
| 495 | Ga0501073_0058951 | 3300049589 | Bacteria | 2682 |
| 496 | Ga0501073_0131029 | 3300049589 | Bacteria | 1738 |
| 497 | Ga0501074_0009117 | 3300049590 | Bacteria | 7206 |
| 498 | Ga0501074_0011828 | 3300049590 | Bacteria | 6344 |
| 499 | Ga0501074_0012875 | 3300049590 | Bacteria | 6082 |
| 500 | Ga0501074_0080579 | 3300049590 | Bacteria | 2335 |
| 501 | Ga0501074_0086484 | 3300049590 | Bacteria | 2246 |
| 502 | Ga0501074_0093862 | 3300049590 | Bacteria | 2149 |
| 503 | Ga0501074_0117873 | 3300049590 | Bacteria | 1899 |
| 504 | Ga0501074_0134007 | 3300049590 | Bacteria | 1772 |
| 505 | Ga0501075_0027261 | 3300049591 | Bacteria | 4210 |
| 506 | Ga0501075_0033760 | 3300049591 | Bacteria | 3807 |
| 507 | Ga0501075_0043394 | 3300049591 | Unclassified | 3373 |
| 508 | Ga0501075_0044534 | 3300049591 | Bacteria | 3329 |
| 509 | Ga0501075_0045347 | 3300049591 | Bacteria | 3300 |
| 510 | Ga0501075_0060873 | 3300049591 | Bacteria | 2844 |
| 511 | Ga0501076_0006912 | 3300049592 | Bacteria | 8246 |
| 512 | Ga0501076_0010111 | 3300049592 | Bacteria | 6988 |
| 513 | Ga0501076_0019667 | 3300049592 | Bacteria | 5163 |
| 514 | Ga0501076_0039086 | 3300049592 | Bacteria | 3725 |
| 515 | Ga0501076_0044215 | 3300049592 | Bacteria | 3512 |
| 516 | Ga0501076_0060228 | 3300049592 | Bacteria | 3020 |
| 517 | Ga0501076_0102434 | 3300049592 | Bacteria | 2308 |
| 518 | Ga0501076_0107417 | 3300049592 | Bacteria | 2254 |
| 519 | Ga0501077_0033249 | 3300049593 | Unclassified | 3282 |
| 520 | Ga0501077_0050316 | 3300049593 | Bacteria | 2649 |
| 521 | Ga0501080_0007987 | 3300049742 | Bacteria | 9587 |
| 522 | Ga0501080_0026783 | 3300049742 | Bacteria | 5358 |
| 523 | Ga0501080_0041000 | 3300049742 | Bacteria | 4316 |
| 524 | Ga0501080_0061341 | 3300049742 | Bacteria | 3501 |
| 525 | Ga0501080_0104410 | 3300049742 | Bacteria | 2628 |
| 526 | Ga0501080_0128071 | 3300049742 | Bacteria | 2350 |
| 527 | Ga0501081_0070643 | 3300049743 | Bacteria | 2433 |
| 528 | Ga0501081_0096010 | 3300049743 | Bacteria | 2090 |
| 529 | Ga0501081_0126265 | 3300049743 | Bacteria | 1825 |
| 530 | Ga0501083_0001145 | 3300049744 | Bacteria | 17826 |
| 531 | Ga0501083_0006214 | 3300049744 | Bacteria | 8471 |
| 532 | Ga0501083_0006371 | 3300049744 | Bacteria | 8363 |
| 533 | Ga0501083_0020384 | 3300049744 | Bacteria | 4612 |
| 534 | Ga0501083_0044145 | 3300049744 | Bacteria | 3018 |
| 535 | Ga0501035_0003037 | 3300049822 | Bacteria | 16095 |
| 536 | Ga0501035_0099193 | 3300049822 | Bacteria | 2557 |
| 537 | Ga0501035_0106549 | 3300049822 | Bacteria | 2457 |
| 538 | Ga0501035_0143659 | 3300049822 | Bacteria | 2073 |
| 539 | Ga0501044_0006115 | 3300049823 | Bacteria | 13282 |
| 540 | Ga0501044_0007614 | 3300049823 | Bacteria | 11907 |
| 541 | Ga0501044_0057335 | 3300049823 | Bacteria | 3997 |
| 542 | Ga0501045_0010474 | 3300049824 | Bacteria | 6494 |
| 543 | Ga0501045_0013053 | 3300049824 | Bacteria | 5858 |
| 544 | Ga0501045_0023082 | 3300049824 | Bacteria | 4457 |
| 545 | Ga0501045_0061233 | 3300049824 | Bacteria | 2761 |
| 546 | Ga0501045_0063695 | 3300049824 | Bacteria | 2706 |
| 547 | Ga0501045_0153654 | 3300049824 | Bacteria | 1712 |
| 548 | nmdc:mga0k408_1389_c1 | 3300050493 | Bacteria | 8568 |
| 549 | nmdc:mga0k408_3514_c1 | 3300050493 | Bacteria | 8283 |
| 550 | nmdc:mga04h51_6591_c1 | 3300050495 | Bacteria | 3019 |
| 551 | nmdc:mga05p37_10205_c1 | 3300050507 | Bacteria | 11152 |
| 552 | nmdc:mga05p37_11028_c1 | 3300050507 | Bacteria | 10736 |
| 553 | nmdc:mga05p37_135344_c1 | 3300050507 | Bacteria | 3022 |
| 554 | nmdc:mga05p37_1547_c1 | 3300050507 | Bacteria | 26735 |
| 555 | nmdc:mga05p37_16419_c1 | 3300050507 | Bacteria | 8920 |
| 556 | nmdc:mga05p37_170622_c1 | 3300050507 | Bacteria | 2653 |
| 557 | nmdc:mga05p37_18588_c1 | 3300050507 | Bacteria | 8400 |
| 558 | nmdc:mga05p37_20134_c1 | 3300050507 | Bacteria | 8074 |
| 559 | nmdc:mga05p37_22643_c1 | 3300050507 | Bacteria | 7619 |
| 560 | nmdc:mga05p37_28785_c1 | 3300050507 | Bacteria | 6778 |
| 561 | nmdc:mga05p37_3800_c1 | 3300050507 | Bacteria | 17668 |
| 562 | nmdc:mga05p37_4878_c1 | 3300050507 | Bacteria | 15701 |
| 563 | nmdc:mga05p37_9438_c1 | 3300050507 | Bacteria | 11551 |
| 564 | nmdc:mga09592_10903_c1 | 3300050508 | Bacteria | 7397 |
| 565 | nmdc:mga09592_145535_c1 | 3300050508 | Bacteria | 2043 |
| 566 | nmdc:mga09592_3603_c1 | 3300050508 | Bacteria | 12498 |
| 567 | nmdc:mga0qj67_10127_c1 | 3300050509 | Bacteria | 7036 |
| 568 | nmdc:mga0qj67_29562_c1 | 3300050509 | Bacteria | 4257 |
| 569 | nmdc:mga0qj67_95222_c1 | 3300050509 | Bacteria | 2396 |
| 570 | nmdc:mga06r32_1666_c1 | 3300050510 | Bacteria | 20041 |
| 571 | nmdc:mga06r32_191551_c1 | 3300050510 | Bacteria | 2032 |
| 572 | nmdc:mga06r32_299062_c1 | 3300050510 | Bacteria | 1596 |
| 573 | nmdc:mga06r32_38432_c1 | 3300050510 | Bacteria | 4535 |
| 574 | nmdc:mga06r32_50291_c2 | 3300050510 | Bacteria | 2236 |
| 575 | nmdc:mga08y16_12383_c1 | 3300050511 | Bacteria | 8970 |
| 576 | nmdc:mga08y16_1308_c1 | 3300050511 | Bacteria | 24769 |
| 577 | nmdc:mga08y16_150_c1 | 3300050511 | Bacteria | 60170 |
| 578 | nmdc:mga08y16_21_c1 | 3300050511 | Bacteria | 254790 |
| 579 | nmdc:mga08y16_2234_c1 | 3300050511 | Bacteria | 19850 |
| 580 | nmdc:mga08y16_30870_c1 | 3300050511 | Bacteria | 5635 |
| 581 | nmdc:mga08y16_3307_c1 | 3300050511 | Bacteria | 16691 |
| 582 | nmdc:mga08y16_47196_c1 | 3300050511 | Bacteria | 4508 |
| 583 | nmdc:mga08y16_56912_c1 | 3300050511 | Bacteria | 4087 |
| 584 | nmdc:mga08y16_8550_c1 | 3300050511 | Bacteria | 10725 |
| 585 | nmdc:mga08y16_94317_c1 | 3300050511 | Bacteria | 3118 |
| 586 | nmdc:mga0n895_11166_c1 | 3300050512 | Bacteria | 7995 |
| 587 | nmdc:mga0n895_72715_c1 | 3300050512 | Bacteria | 3412 |
| 588 | nmdc:mga0rr50_45_c1 | 3300050513 | Bacteria | 74544 |
| 589 | nmdc:mga0rr50_61271_c1 | 3300050513 | Bacteria | 2834 |
| 590 | nmdc:mga0rr50_910_c1 | 3300050513 | Bacteria | 16002 |
| 591 | nmdc:mga0rr50_9579_c1 | 3300050513 | Bacteria | 6099 |
| 592 | nmdc:mga08x19_101405_c1 | 3300050514 | Bacteria | 1911 |
| 593 | nmdc:mga08x19_24553_c1 | 3300050514 | Bacteria | 3748 |
| 594 | nmdc:mga08x19_33446_c1 | 3300050514 | Bacteria | 3245 |
| 595 | nmdc:mga08x19_52680_c1 | 3300050514 | Unclassified | 2617 |
| 596 | nmdc:mga08x19_8275_c1 | 3300050514 | Bacteria | 6186 |
| 597 | nmdc:mga0a205_166094_c1 | 3300050515 | Bacteria | 2103 |
| 598 | nmdc:mga0a205_21189_c1 | 3300050515 | Bacteria | 6147 |
| 599 | nmdc:mga0a205_27842_c1 | 3300050515 | Bacteria | 5399 |
| 600 | nmdc:mga0a205_29030_c1 | 3300050515 | Bacteria | 5292 |
| 601 | nmdc:mga0a205_32367_c1 | 3300050515 | Bacteria | 5014 |
| 602 | nmdc:mga0a205_45771_c1 | 3300050515 | Bacteria | 4220 |
| 603 | nmdc:mga0a205_58922_c1 | 3300050515 | Bacteria | 3709 |
| 604 | nmdc:mga0a205_7140_c1 | 3300050515 | Bacteria | 10099 |
| 605 | nmdc:mga0a205_8923_c1 | 3300050515 | Bacteria | 9138 |
| 606 | Ga0495601_0003730 | 3300053077 | Bacteria | 8770 |
| 607 | Ga0495601_0024117 | 3300053077 | Bacteria | 3744 |
| 608 | Ga0495595_0057838 | 3300053084 | Bacteria | 1809 |
| 609 | Ga0495619_0006567 | 3300053085 | Bacteria | 7357 |
| 610 | Ga0495619_0022749 | 3300053085 | Bacteria | 4014 |
| 611 | Ga0500641_0003358 | 3300053096 | Bacteria | 5663 |
| 612 | Ga0500555_000185 | 3300053103 | Bacteria | 28382 |
| 613 | Ga0500556_0003578 | 3300053104 | Bacteria | 4536 |
| 614 | Ga0500568_0004926 | 3300053139 | Bacteria | 7023 |
| 615 | Ga0500616_0000173 | 3300053153 | Bacteria | 107646 |
| 616 | Ga0500645_000077 | 3300053730 | Bacteria | 77326 |
| 617 | Ga0501084_0001462 | 3300054114 | Bacteria | 18743 |
| 618 | Ga0501084_0038278 | 3300054114 | Bacteria | 4009 |
| 619 | Ga0501084_0038385 | 3300054114 | Bacteria | 4004 |
| 620 | Ga0501084_0041468 | 3300054114 | Bacteria | 3851 |
| 621 | Ga0501084_0055531 | 3300054114 | Bacteria | 3313 |
| 622 | Ga0501084_0062047 | 3300054114 | Bacteria | 3129 |
| 623 | Ga0501084_0067988 | 3300054114 | Bacteria | 2983 |
| 624 | Ga0501084_0072166 | 3300054114 | Bacteria | 2891 |
| 625 | Ga0501084_0097493 | 3300054114 | Bacteria | 2468 |
| 626 | Ga0501084_0177669 | 3300054114 | Bacteria | 1797 |
| 627 | Ga0590071_000346 | 3300059421 | Bacteria | 13658 |
| 628 | Ga0590075_000232 | 3300059424 | Bacteria | 15676 |
| 629 | Ga0590075_008027 | 3300059424 | Bacteria | 2512 |
| 630 | Ga0590077_001575 | 3300059426 | Bacteria | 5248 |
| 631 | Ga0587066_002459 | 3300059490 | Bacteria | 2049 |
| 632 | Ga0587073_0000253 | 3300059492 | Bacteria | 4288 |
| 633 | Ga0587073_0001165 | 3300059492 | Bacteria | 2932 |
| 634 | Ga0587080_001503 | 3300059503 | Bacteria | 2547 |
| 635 | Ga0587082_001100 | 3300059504 | Bacteria | 2654 |
| 636 | Ga0587082_003187 | 3300059504 | Bacteria | 1945 |
| 637 | Ga0587088_001055 | 3300059508 | Unclassified | 2702 |
| 638 | Ga0587090_001296 | 3300059510 | Bacteria | 2500 |
| 639 | Ga0587091_001116 | 3300059511 | Unclassified | 2766 |
| 640 | Ga0587098_000822 | 3300059604 | Bacteria | 2124 |
| 641 | Ga0587115_000622 | 3300059626 | Bacteria | 2756 |
| 642 | Ga0587128_001549 | 3300059630 | Bacteria | 2197 |
| 643 | Ga0587128_001906 | 3300059630 | Bacteria | 2077 |
| 644 | Ga0587067_003121 | 3300059640 | Bacteria | 2044 |
| 645 | Ga0587067_003581 | 3300059640 | Bacteria | 1955 |
| 646 | Ga0587076_001717 | 3300059645 | Bacteria | 2304 |
| 647 | Ga0587107_000873 | 3300059652 | Bacteria | 2229 |
| 648 | Ga0587114_001461 | 3300059655 | Bacteria | 1986 |
| 649 | Ga0587111_0003945 | 3300060346 | Bacteria | 2162 |
| 650 | Ga0501082_0017507 | 3300060353 | Bacteria | 6175 |
| 651 | Ga0501082_0029344 | 3300060353 | Bacteria | 4738 |
| 652 | Ga0501082_0029654 | 3300060353 | Bacteria | 4713 |
| 653 | Ga0501082_0050478 | 3300060353 | Bacteria | 3587 |
| 654 | Ga0501082_0076488 | 3300060353 | Bacteria | 2885 |
| 655 | Ga0530510_0028940 | 3300061734 | Bacteria | 3974 |
| 656 | Ga0530510_0070912 | 3300061734 | Bacteria | 2529 |
| 657 | Ga0530510_0101971 | 3300061734 | Bacteria | 2099 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300041410 | Ga0439461_0012781 | Ga0439461_0012781_246_1556 | 394 |
| 2 | 3300049824 | Ga0501045_0153654 | Ga0501045_0153654_285_1688 | 398 |
| 3 | 3300050510 | nmdc:mga06r32_191551_c1 | nmdc:mga06r32_191551_c1_643_2019 | 409 |
| 4 | 3300046681 | Ga0495647_0011264 | Ga0495647_0011264_569_2107 | 412 |
| 5 | 3300003693 | Ga0032354_1045718 | Ga0032354_10457182 | 416 |
| 6 | 3300009177 | Ga0105248_10067215 | Ga0105248_100672152 | 420 |
| 7 | 3300053139 | Ga0500568_0004926 | Ga0500568_0004926_2796_4478 | 421 |
| 8 | 3300031995 | Ga0307409_100003509 | Ga0307409_1000035097 | 423 |
| 9 | 3300005354 | Ga0070675_100043940 | Ga0070675_1000439401 | 424 |
| 10 | 3300059645 | Ga0587076_001717 | Ga0587076_001717_519_2150 | 424 |
| 11 | 3300006847 | Ga0075431_100114538 | Ga0075431_1001145382 | 428 |
| 12 | 3300050507 | nmdc:mga05p37_18588_c1 | nmdc:mga05p37_18588_c1_3201_4739 | 429 |
| 13 | 3300053084 | Ga0495595_0057838 | Ga0495595_0057838_167_1687 | 429 |
| 14 | 3300060346 | Ga0587111_0003945 | Ga0587111_0003945_324_2057 | 430 |
| 15 | 3300048912 | Ga0496109_0079309 | Ga0496109_0079309_941_2479 | 431 |
| 16 | 3300006237 | Ga0097621_100011722 | Ga0097621_1000117225 | 432 |
| 17 | 3300004798 | Ga0058859_10104188 | Ga0058859_101041881 | 433 |
| 18 | 3300005354 | Ga0070675_100028899 | Ga0070675_1000288994 | 433 |
| 19 | 3300005364 | Ga0070673_100085693 | Ga0070673_1000856931 | 433 |
| 20 | 3300005456 | Ga0070678_100009865 | Ga0070678_1000098655 | 433 |
| 21 | 3300026121 | Ga0207683_10018931 | Ga0207683_100189315 | 433 |
| 22 | 3300009147 | Ga0114129_10058479 | Ga0114129_100584794 | 434 |
| 23 | 3300050507 | nmdc:mga05p37_4878_c1 | nmdc:mga05p37_4878_c1_13275_14960 | 434 |
| 24 | 3300053096 | Ga0500641_0003358 | Ga0500641_0003358_890_2518 | 434 |
| 25 | 3300005844 | Ga0068862_100006534 | Ga0068862_1000065344 | 435 |
| 26 | 3300028380 | Ga0268265_10013164 | Ga0268265_100131643 | 435 |
| 27 | 3300036401 | Ga0373937_0066997 | Ga0373937_0066997_634_2187 | 435 |
| 28 | 3300009147 | Ga0114129_10006486 | Ga0114129_100064864 | 436 |
| 29 | 3300048904 | Ga0496101_0002334 | Ga0496101_0002334_9951_11507 | 436 |
| 30 | 3300048907 | Ga0496104_0017896 | Ga0496104_0017896_409_1965 | 436 |
| 31 | 3300048910 | Ga0496107_0038142 | Ga0496107_0038142_788_2344 | 436 |
| 32 | 3300048917 | Ga0496114_0000913 | Ga0496114_0000913_12825_14381 | 436 |
| 33 | 3300003544 | Ga0007417J51691_1028357 | Ga0007417J51691_10283572 | 437 |
| 34 | 3300003577 | Ga0007416J51690_1031937 | Ga0007416J51690_10319372 | 437 |
| 35 | 3300009147 | Ga0114129_10255095 | Ga0114129_102550952 | 437 |
| 36 | 3300005471 | Ga0070698_100192018 | Ga0070698_1001920181 | 439 |
| 37 | 3300042436 | Ga0439435_0008790 | Ga0439435_0008790_250_1824 | 440 |
| 38 | 3300045051 | Ga0451576_0121337 | Ga0451576_0121337_406_2001 | 440 |
| 39 | 3300049744 | Ga0501083_0044145 | Ga0501083_0044145_522_2219 | 440 |
| 40 | 3300049579 | Ga0501043_0096988 | Ga0501043_0096988_50_1624 | 441 |
| 41 | 3300049591 | Ga0501075_0045347 | Ga0501075_0045347_1429_3003 | 441 |
| 42 | 3300049592 | Ga0501076_0044215 | Ga0501076_0044215_1039_2613 | 441 |
| 43 | 3300049743 | Ga0501081_0070643 | Ga0501081_0070643_471_2045 | 441 |
| 44 | 3300049573 | Ga0501037_0136856 | Ga0501037_0136856_30_1631 | 442 |
| 45 | 3300054114 | Ga0501084_0062047 | Ga0501084_0062047_1489_3090 | 442 |
| 46 | 3300005618 | Ga0068864_100028057 | Ga0068864_1000280572 | 443 |
| 47 | 3300006852 | Ga0075433_10090207 | Ga0075433_100902072 | 443 |
| 48 | 3300009177 | Ga0105248_10047058 | Ga0105248_100470584 | 443 |
| 49 | 3300013296 | Ga0157374_10048760 | Ga0157374_100487603 | 443 |
| 50 | 3300046460 | Ga0495638_0004431 | Ga0495638_0004431_7916_9583 | 443 |
| 51 | 3300050515 | nmdc:mga0a205_27842_c1 | nmdc:mga0a205_27842_c1_1320_2999 | 443 |
| 52 | 3300054114 | Ga0501084_0177669 | Ga0501084_0177669_16_1653 | 444 |
| 53 | 3300005354 | Ga0070675_100002124 | Ga0070675_1000021241 | 445 |
| 54 | 3300005355 | Ga0070671_100009207 | Ga0070671_1000092075 | 445 |
| 55 | 3300005364 | Ga0070673_100036998 | Ga0070673_1000369983 | 445 |
| 56 | 3300005367 | Ga0070667_100015415 | Ga0070667_1000154155 | 445 |
| 57 | 3300009177 | Ga0105248_10005629 | Ga0105248_100056298 | 445 |
| 58 | 3300026088 | Ga0207641_10002265 | Ga0207641_100022654 | 445 |
| 59 | 3300049586 | Ga0501070_0022289 | Ga0501070_0022289_3387_5144 | 445 |
| 60 | 3300049587 | Ga0501071_0049453 | Ga0501071_0049453_1314_2831 | 445 |
| 61 | 3300049591 | Ga0501075_0060873 | Ga0501075_0060873_64_1581 | 445 |
| 62 | 3300005336 | Ga0070680_100041770 | Ga0070680_1000417703 | 446 |
| 63 | 3300009094 | Ga0111539_10020021 | Ga0111539_100200214 | 446 |
| 64 | 3300009147 | Ga0114129_10002040 | Ga0114129_1000204013 | 446 |
| 65 | 3300014326 | Ga0157380_10016008 | Ga0157380_100160085 | 446 |
| 66 | 3300025917 | Ga0207660_10051265 | Ga0207660_100512653 | 446 |
| 67 | 3300046684 | Ga0495669_0007347 | Ga0495669_0007347_691_2400 | 446 |
| 68 | 3300049588 | Ga0501072_0155842 | Ga0501072_0155842_35_1792 | 446 |
| 69 | 3300049590 | Ga0501074_0093862 | Ga0501074_0093862_136_1824 | 446 |
| 70 | 3300050507 | nmdc:mga05p37_10205_c1 | nmdc:mga05p37_10205_c1_7173_8879 | 446 |
| 71 | 3300050511 | nmdc:mga08y16_94317_c1 | nmdc:mga08y16_94317_c1_783_2456 | 446 |
| 72 | 3300005367 | Ga0070667_100162181 | Ga0070667_1001621811 | 447 |
| 73 | 3300025986 | Ga0207658_10149259 | Ga0207658_101492591 | 447 |
| 74 | 3300026121 | Ga0207683_10038678 | Ga0207683_100386783 | 447 |
| 75 | 3300035086 | Ga0373934_0020319 | Ga0373934_0020319_38_1597 | 447 |
| 76 | 3300035119 | Ga0373956_0016396 | Ga0373956_0016396_657_2216 | 447 |
| 77 | 3300035172 | Ga0373955_0012621 | Ga0373955_0012621_36_1595 | 447 |
| 78 | 3300036401 | Ga0373937_0000965 | Ga0373937_0000965_22662_24221 | 447 |
| 79 | 3300005544 | Ga0070686_100024951 | Ga0070686_1000249514 | 448 |
| 80 | 3300009147 | Ga0114129_10002887 | Ga0114129_1000288715 | 448 |
| 81 | 3300009147 | Ga0114129_10044664 | Ga0114129_100446643 | 448 |
| 82 | 3300009176 | Ga0105242_10014843 | Ga0105242_100148431 | 448 |
| 83 | 3300026089 | Ga0207648_10052603 | Ga0207648_100526031 | 448 |
| 84 | 3300028379 | Ga0268266_10017050 | Ga0268266_100170505 | 448 |
| 85 | 3300046511 | Ga0495608_0003942 | Ga0495608_0003942_8290_9990 | 448 |
| 86 | 3300046516 | Ga0495628_0021148 | Ga0495628_0021148_3415_5115 | 448 |
| 87 | 3300046536 | Ga0495587_0051732 | Ga0495587_0051732_33_1751 | 448 |
| 88 | 3300046543 | Ga0495645_0010462 | Ga0495645_0010462_541_2241 | 448 |
| 89 | 3300046559 | Ga0495667_0084520 | Ga0495667_0084520_347_2047 | 448 |
| 90 | 3300046689 | Ga0495613_0001676 | Ga0495613_0001676_6433_8133 | 448 |
| 91 | 3300047471 | Ga0495684_0002679 | Ga0495684_0002679_10360_12060 | 448 |
| 92 | 3300048915 | Ga0496112_0035087 | Ga0496112_0035087_2818_4524 | 448 |
| 93 | 3300049576 | Ga0501040_0092029 | Ga0501040_0092029_326_1975 | 448 |
| 94 | 3300049578 | Ga0501042_0000551 | Ga0501042_0000551_15848_17497 | 448 |
| 95 | 3300049588 | Ga0501072_0027598 | Ga0501072_0027598_2766_4415 | 448 |
| 96 | 3300049590 | Ga0501074_0080579 | Ga0501074_0080579_577_2226 | 448 |
| 97 | 3300049593 | Ga0501077_0033249 | Ga0501077_0033249_1034_2683 | 448 |
| 98 | 3300050510 | nmdc:mga06r32_299062_c1 | nmdc:mga06r32_299062_c1_10_1527 | 448 |
| 99 | 3300050513 | nmdc:mga0rr50_45_c1 | nmdc:mga0rr50_45_c1_34419_36116 | 448 |
| 100 | 3300050514 | nmdc:mga08x19_33446_c1 | nmdc:mga08x19_33446_c1_139_1836 | 448 |
| 101 | 3300053077 | Ga0495601_0003730 | Ga0495601_0003730_5791_7491 | 448 |
| 102 | 3300053085 | Ga0495619_0006567 | Ga0495619_0006567_4326_6026 | 448 |
| 103 | 3300048088 | Ga0495602_0086955 | Ga0495602_0086955_610_2328 | 449 |
| 104 | 3300049568 | Ga0501031_0108255 | Ga0501031_0108255_17_1678 | 449 |
| 105 | 3300049570 | Ga0501033_0035764 | Ga0501033_0035764_688_2349 | 449 |
| 106 | 3300049572 | Ga0501036_0048668 | Ga0501036_0048668_1447_3108 | 449 |
| 107 | 3300049574 | Ga0501038_0075564 | Ga0501038_0075564_1150_2811 | 449 |
| 108 | 3300049575 | Ga0501039_0060303 | Ga0501039_0060303_969_2630 | 449 |
| 109 | 3300049577 | Ga0501041_0012056 | Ga0501041_0012056_291_1952 | 449 |
| 110 | 3300049579 | Ga0501043_0123373 | Ga0501043_0123373_357_2018 | 449 |
| 111 | 3300049580 | Ga0501046_0078290 | Ga0501046_0078290_753_2399 | 449 |
| 112 | 3300049582 | Ga0501048_0029438 | Ga0501048_0029438_1341_3002 | 449 |
| 113 | 3300049584 | Ga0501068_0023174 | Ga0501068_0023174_704_2365 | 449 |
| 114 | 3300049587 | Ga0501071_0075220 | Ga0501071_0075220_451_2127 | 449 |
| 115 | 3300049589 | Ga0501073_0000524 | Ga0501073_0000524_5873_7486 | 449 |
| 116 | 3300049590 | Ga0501074_0086484 | Ga0501074_0086484_283_1896 | 449 |
| 117 | 3300049592 | Ga0501076_0107417 | Ga0501076_0107417_326_2002 | 449 |
| 118 | 3300049822 | Ga0501035_0143659 | Ga0501035_0143659_286_1947 | 449 |
| 119 | 3300003693 | Ga0032354_1004787 | Ga0032354_10047873 | 450 |
| 120 | 3300005545 | Ga0070695_100078438 | Ga0070695_1000784382 | 450 |
| 121 | 3300006237 | Ga0097621_100012231 | Ga0097621_1000122313 | 450 |
| 122 | 3300006358 | Ga0068871_100004321 | Ga0068871_1000043215 | 450 |
| 123 | 3300014325 | Ga0163163_10000013 | Ga0163163_10000013120 | 450 |
| 124 | 3300014969 | Ga0157376_10045942 | Ga0157376_100459424 | 450 |
| 125 | 3300042436 | Ga0439435_0012655 | Ga0439435_0012655_41_1696 | 450 |
| 126 | 3300048905 | Ga0496102_0145594 | Ga0496102_0145594_706_2205 | 450 |
| 127 | 3300049590 | Ga0501074_0134007 | Ga0501074_0134007_44_1714 | 450 |
| 128 | 3300049824 | Ga0501045_0063695 | Ga0501045_0063695_755_2437 | 450 |
| 129 | 3300053104 | Ga0500556_0003578 | Ga0500556_0003578_961_2592 | 450 |
| 130 | 3300005842 | Ga0068858_100002991 | Ga0068858_1000029918 | 451 |
| 131 | 3300009094 | Ga0111539_10001752 | Ga0111539_100017525 | 451 |
| 132 | 3300027907 | Ga0207428_10000294 | Ga0207428_1000029438 | 451 |
| 133 | 3300050511 | nmdc:mga08y16_2234_c1 | nmdc:mga08y16_2234_c1_5156_6748 | 451 |
| 134 | 3300050511 | nmdc:mga08y16_47196_c1 | nmdc:mga08y16_47196_c1_912_2474 | 451 |
| 135 | 3300004801 | Ga0058860_10047880 | Ga0058860_100478801 | 452 |
| 136 | 3300005617 | Ga0068859_100098545 | Ga0068859_1000985451 | 452 |
| 137 | 3300006931 | Ga0097620_100098537 | Ga0097620_1000985371 | 452 |
| 138 | 3300009093 | Ga0105240_10051258 | Ga0105240_100512583 | 452 |
| 139 | 3300009094 | Ga0111539_10000763 | Ga0111539_1000076310 | 452 |
| 140 | 3300009177 | Ga0105248_10003067 | Ga0105248_1000306711 | 452 |
| 141 | 3300025913 | Ga0207695_10025538 | Ga0207695_100255384 | 452 |
| 142 | 3300026035 | Ga0207703_10004978 | Ga0207703_100049784 | 452 |
| 143 | 3300027907 | Ga0207428_10002348 | Ga0207428_1000234810 | 452 |
| 144 | 3300046683 | Ga0495658_0015421 | Ga0495658_0015421_1255_2781 | 452 |
| 145 | 3300048911 | Ga0496108_0007619 | Ga0496108_0007619_173_1873 | 452 |
| 146 | 3300050511 | nmdc:mga08y16_150_c1 | nmdc:mga08y16_150_c1_32239_33984 | 452 |
| 147 | 3300005518 | Ga0070699_100024264 | Ga0070699_1000242642 | 453 |
| 148 | 3300025920 | Ga0207649_10050275 | Ga0207649_100502751 | 453 |
| 149 | 3300026121 | Ga0207683_10036135 | Ga0207683_100361352 | 453 |
| 150 | 3300031548 | Ga0307408_100009645 | Ga0307408_1000096454 | 453 |
| 151 | 3300031995 | Ga0307409_100063883 | Ga0307409_1000638831 | 453 |
| 152 | 3300049592 | Ga0501076_0010111 | Ga0501076_0010111_336_1958 | 453 |
| 153 | 3300049742 | Ga0501080_0104410 | Ga0501080_0104410_1017_2615 | 453 |
| 154 | 3300050509 | nmdc:mga0qj67_95222_c1 | nmdc:mga0qj67_95222_c1_14_1525 | 453 |
| 155 | 3300005290 | Ga0065712_10067993 | Ga0065712_1006799310 | 454 |
| 156 | 3300005438 | Ga0070701_10015399 | Ga0070701_100153992 | 454 |
| 157 | 3300006871 | Ga0075434_100004677 | Ga0075434_10000467712 | 454 |
| 158 | 3300014326 | Ga0157380_10005365 | Ga0157380_100053657 | 454 |
| 159 | 3300025908 | Ga0207643_10043937 | Ga0207643_100439372 | 454 |
| 160 | 3300027907 | Ga0207428_10086058 | Ga0207428_100860582 | 454 |
| 161 | 3300031995 | Ga0307409_100054892 | Ga0307409_1000548923 | 454 |
| 162 | 3300009094 | Ga0111539_10134974 | Ga0111539_101349742 | 455 |
| 163 | 3300014326 | Ga0157380_10001836 | Ga0157380_1000183612 | 455 |
| 164 | 3300025917 | Ga0207660_10131672 | Ga0207660_101316722 | 455 |
| 165 | 3300005340 | Ga0070689_100034367 | Ga0070689_1000343674 | 456 |
| 166 | 3300005365 | Ga0070688_100020510 | Ga0070688_1000205105 | 456 |
| 167 | 3300025926 | Ga0207659_10000196 | Ga0207659_100001961 | 456 |
| 168 | 3300025936 | Ga0207670_10005956 | Ga0207670_100059564 | 456 |
| 169 | 3300049823 | Ga0501044_0006115 | Ga0501044_0006115_11364_13079 | 456 |
| 170 | 3300050515 | nmdc:mga0a205_166094_c1 | nmdc:mga0a205_166094_c1_494_2041 | 456 |
| 171 | 3300005335 | Ga0070666_10047193 | Ga0070666_100471932 | 457 |
| 172 | 3300005459 | Ga0068867_100039474 | Ga0068867_1000394742 | 457 |
| 173 | 3300006237 | Ga0097621_100005522 | Ga0097621_1000055223 | 457 |
| 174 | 3300006844 | Ga0075428_100185395 | Ga0075428_1001853952 | 457 |
| 175 | 3300006846 | Ga0075430_100040384 | Ga0075430_1000403842 | 457 |
| 176 | 3300006881 | Ga0068865_100016927 | Ga0068865_1000169274 | 457 |
| 177 | 3300009093 | Ga0105240_10119947 | Ga0105240_101199472 | 457 |
| 178 | 3300009176 | Ga0105242_10018202 | Ga0105242_100182023 | 457 |
| 179 | 3300014969 | Ga0157376_10014296 | Ga0157376_100142963 | 457 |
| 180 | 3300022467 | Ga0224712_10014336 | Ga0224712_100143362 | 457 |
| 181 | 3300025938 | Ga0207704_10003166 | Ga0207704_100031663 | 457 |
| 182 | 3300025941 | Ga0207711_10093023 | Ga0207711_100930232 | 457 |
| 183 | 3300026089 | Ga0207648_10055729 | Ga0207648_100557293 | 457 |
| 184 | 3300048915 | Ga0496112_0018705 | Ga0496112_0018705_3260_4870 | 457 |
| 185 | 3300049569 | Ga0501032_0024275 | Ga0501032_0024275_1642_3342 | 457 |
| 186 | 3300049572 | Ga0501036_0009652 | Ga0501036_0009652_3256_4956 | 457 |
| 187 | 3300049572 | Ga0501036_0087865 | Ga0501036_0087865_283_1992 | 457 |
| 188 | 3300049576 | Ga0501040_0044809 | Ga0501040_0044809_446_2155 | 457 |
| 189 | 3300049580 | Ga0501046_0090356 | Ga0501046_0090356_646_2346 | 457 |
| 190 | 3300049582 | Ga0501048_0014220 | Ga0501048_0014220_2013_3722 | 457 |
| 191 | 3300049588 | Ga0501072_0016347 | Ga0501072_0016347_1509_3218 | 457 |
| 192 | 3300049590 | Ga0501074_0009117 | Ga0501074_0009117_4320_6020 | 457 |
| 193 | 3300049591 | Ga0501075_0033760 | Ga0501075_0033760_552_2261 | 457 |
| 194 | 3300049592 | Ga0501076_0006912 | Ga0501076_0006912_5685_7394 | 457 |
| 195 | 3300049592 | Ga0501076_0039086 | Ga0501076_0039086_1482_3182 | 457 |
| 196 | 3300049742 | Ga0501080_0061341 | Ga0501080_0061341_1664_3373 | 457 |
| 197 | 3300049744 | Ga0501083_0006371 | Ga0501083_0006371_2525_4225 | 457 |
| 198 | 3300049822 | Ga0501035_0003037 | Ga0501035_0003037_3289_4989 | 457 |
| 199 | 3300050514 | nmdc:mga08x19_24553_c1 | nmdc:mga08x19_24553_c1_1292_2839 | 457 |
| 200 | 3300054114 | Ga0501084_0001462 | Ga0501084_0001462_13095_14795 | 457 |
| 201 | 3300059424 | Ga0590075_008027 | Ga0590075_008027_67_1719 | 457 |
| 202 | 3300059492 | Ga0587073_0000253 | Ga0587073_0000253_2049_3764 | 457 |
| 203 | 3300059503 | Ga0587080_001503 | Ga0587080_001503_313_2028 | 457 |
| 204 | 3300059508 | Ga0587088_001055 | Ga0587088_001055_525_2240 | 457 |
| 205 | 3300059510 | Ga0587090_001296 | Ga0587090_001296_500_2215 | 457 |
| 206 | 3300059511 | Ga0587091_001116 | Ga0587091_001116_537_2252 | 457 |
| 207 | 3300059630 | Ga0587128_001549 | Ga0587128_001549_446_2161 | 457 |
| 208 | 3300060353 | Ga0501082_0029344 | Ga0501082_0029344_1125_2825 | 457 |
| 209 | 3300061734 | Ga0530510_0101971 | Ga0530510_0101971_270_1844 | 457 |
| 210 | 3300004799 | Ga0058863_10034124 | Ga0058863_100341243 | 458 |
| 211 | 3300005336 | Ga0070680_100143461 | Ga0070680_1001434611 | 458 |
| 212 | 3300005339 | Ga0070660_100047168 | Ga0070660_1000471682 | 458 |
| 213 | 3300005563 | Ga0068855_100088768 | Ga0068855_1000887682 | 458 |
| 214 | 3300005937 | Ga0081455_10075493 | Ga0081455_100754932 | 458 |
| 215 | 3300006358 | Ga0068871_100058588 | Ga0068871_1000585883 | 458 |
| 216 | 3300009094 | Ga0111539_10008025 | Ga0111539_100080255 | 458 |
| 217 | 3300009147 | Ga0114129_10002681 | Ga0114129_100026816 | 458 |
| 218 | 3300009551 | Ga0105238_10102382 | Ga0105238_101023822 | 458 |
| 219 | 3300020070 | Ga0206356_10872851 | Ga0206356_108728512 | 458 |
| 220 | 3300020081 | Ga0206354_10781424 | Ga0206354_107814242 | 458 |
| 221 | 3300022467 | Ga0224712_10017077 | Ga0224712_100170773 | 458 |
| 222 | 3300025919 | Ga0207657_10053562 | Ga0207657_100535623 | 458 |
| 223 | 3300049588 | Ga0501072_0040448 | Ga0501072_0040448_2046_3566 | 458 |
| 224 | 3300049588 | Ga0501072_0050134 | Ga0501072_0050134_1589_3133 | 458 |
| 225 | 3300050511 | nmdc:mga08y16_1308_c1 | nmdc:mga08y16_1308_c1_16145_17911 | 458 |
| 226 | 3300054114 | Ga0501084_0067988 | Ga0501084_0067988_1385_2929 | 458 |
| 227 | 3300006880 | Ga0075429_100002051 | Ga0075429_1000020517 | 459 |
| 228 | 3300009094 | Ga0111539_10004701 | Ga0111539_1000470110 | 459 |
| 229 | 3300009094 | Ga0111539_10038002 | Ga0111539_100380022 | 459 |
| 230 | 3300027907 | Ga0207428_10009454 | Ga0207428_100094544 | 459 |
| 231 | 3300050508 | nmdc:mga09592_10903_c1 | nmdc:mga09592_10903_c1_1686_3383 | 459 |
| 232 | 3300050509 | nmdc:mga0qj67_10127_c1 | nmdc:mga0qj67_10127_c1_2895_4592 | 459 |
| 233 | 3300050511 | nmdc:mga08y16_3307_c1 | nmdc:mga08y16_3307_c1_14103_15758 | 459 |
| 234 | 3300050511 | nmdc:mga08y16_56912_c1 | nmdc:mga08y16_56912_c1_1635_3311 | 459 |
| 235 | 3300005354 | Ga0070675_100001858 | Ga0070675_10000185810 | 460 |
| 236 | 3300005364 | Ga0070673_100001301 | Ga0070673_1000013018 | 460 |
| 237 | 3300005434 | Ga0070709_10091572 | Ga0070709_100915721 | 460 |
| 238 | 3300005466 | Ga0070685_10067350 | Ga0070685_100673501 | 460 |
| 239 | 3300005549 | Ga0070704_100038820 | Ga0070704_1000388201 | 460 |
| 240 | 3300006880 | Ga0075429_100018790 | Ga0075429_1000187902 | 460 |
| 241 | 3300007076 | Ga0075435_100024331 | Ga0075435_1000243313 | 460 |
| 242 | 3300014326 | Ga0157380_10002997 | Ga0157380_100029973 | 460 |
| 243 | 3300025926 | Ga0207659_10004899 | Ga0207659_100048992 | 460 |
| 244 | 3300027907 | Ga0207428_10021150 | Ga0207428_100211502 | 460 |
| 245 | 3300035691 | Ga0373931_0084222 | Ga0373931_0084222_88_1644 | 460 |
| 246 | 3300049576 | Ga0501040_0038476 | Ga0501040_0038476_69_1811 | 460 |
| 247 | 3300004800 | Ga0058861_11984001 | Ga0058861_119840011 | 461 |
| 248 | 3300004803 | Ga0058862_12893455 | Ga0058862_128934551 | 461 |
| 249 | 3300005367 | Ga0070667_100047841 | Ga0070667_1000478413 | 461 |
| 250 | 3300005530 | Ga0070679_100146066 | Ga0070679_1001460661 | 461 |
| 251 | 3300005547 | Ga0070693_100013639 | Ga0070693_1000136392 | 461 |
| 252 | 3300005843 | Ga0068860_100070741 | Ga0068860_1000707412 | 461 |
| 253 | 3300005985 | Ga0081539_10044591 | Ga0081539_100445911 | 461 |
| 254 | 3300009094 | Ga0111539_10037248 | Ga0111539_100372482 | 461 |
| 255 | 3300009147 | Ga0114129_10098361 | Ga0114129_100983612 | 461 |
| 256 | 3300025921 | Ga0207652_10164609 | Ga0207652_101646091 | 461 |
| 257 | 3300026041 | Ga0207639_10092276 | Ga0207639_100922762 | 461 |
| 258 | 3300028381 | Ga0268264_10087530 | Ga0268264_100875302 | 461 |
| 259 | 3300032002 | Ga0307416_100049923 | Ga0307416_1000499232 | 461 |
| 260 | 3300042133 | Ga0450896_002431 | Ga0450896_002431_604_2265 | 461 |
| 261 | 3300049569 | Ga0501032_0044638 | Ga0501032_0044638_862_2673 | 461 |
| 262 | 3300049572 | Ga0501036_0042173 | Ga0501036_0042173_1946_3757 | 461 |
| 263 | 3300049574 | Ga0501038_0003987 | Ga0501038_0003987_4521_6332 | 461 |
| 264 | 3300049575 | Ga0501039_0015015 | Ga0501039_0015015_3557_5368 | 461 |
| 265 | 3300049577 | Ga0501041_0053020 | Ga0501041_0053020_526_2418 | 461 |
| 266 | 3300049580 | Ga0501046_0054796 | Ga0501046_0054796_857_2668 | 461 |
| 267 | 3300049589 | Ga0501073_0058951 | Ga0501073_0058951_52_1863 | 461 |
| 268 | 3300049822 | Ga0501035_0099193 | Ga0501035_0099193_734_2545 | 461 |
| 269 | 3300049823 | Ga0501044_0007614 | Ga0501044_0007614_4581_6392 | 461 |
| 270 | 3300050493 | nmdc:mga0k408_1389_c1 | nmdc:mga0k408_1389_c1_6383_8089 | 461 |
| 271 | 3300050507 | nmdc:mga05p37_170622_c1 | nmdc:mga05p37_170622_c1_38_1834 | 461 |
| 272 | 3300050511 | nmdc:mga08y16_8550_c1 | nmdc:mga08y16_8550_c1_2555_4351 | 461 |
| 273 | 3300060353 | Ga0501082_0050478 | Ga0501082_0050478_1329_3221 | 461 |
| 274 | 3300005344 | Ga0070661_100104122 | Ga0070661_1001041221 | 462 |
| 275 | 3300005354 | Ga0070675_100178210 | Ga0070675_1001782101 | 462 |
| 276 | 3300005364 | Ga0070673_100013792 | Ga0070673_1000137924 | 462 |
| 277 | 3300005455 | Ga0070663_100038053 | Ga0070663_1000380533 | 462 |
| 278 | 3300005564 | Ga0070664_100205560 | Ga0070664_1002055601 | 462 |
| 279 | 3300009177 | Ga0105248_10033643 | Ga0105248_100336433 | 462 |
| 280 | 3300025931 | Ga0207644_10023604 | Ga0207644_100236041 | 462 |
| 281 | 3300025940 | Ga0207691_10005565 | Ga0207691_100055655 | 462 |
| 282 | 3300025944 | Ga0207661_10141119 | Ga0207661_101411192 | 462 |
| 283 | 3300025945 | Ga0207679_10051639 | Ga0207679_100516392 | 462 |
| 284 | 3300025960 | Ga0207651_10005371 | Ga0207651_100053714 | 462 |
| 285 | 3300026067 | Ga0207678_10018364 | Ga0207678_100183644 | 462 |
| 286 | 3300048915 | Ga0496112_0241470 | Ga0496112_0241470_205_1740 | 462 |
| 287 | 3300050493 | nmdc:mga0k408_3514_c1 | nmdc:mga0k408_3514_c1_3755_5425 | 462 |
| 288 | 3300059504 | Ga0587082_003187 | Ga0587082_003187_120_1865 | 462 |
| 289 | 3300059640 | Ga0587067_003581 | Ga0587067_003581_90_1835 | 462 |
| 290 | 3300009098 | Ga0105245_10039025 | Ga0105245_100390252 | 463 |
| 291 | 3300014326 | Ga0157380_10046959 | Ga0157380_100469592 | 463 |
| 292 | 3300049568 | Ga0501031_0001226 | Ga0501031_0001226_9665_11386 | 463 |
| 293 | 3300049571 | Ga0501034_0041541 | Ga0501034_0041541_21_1742 | 463 |
| 294 | 3300049573 | Ga0501037_0012782 | Ga0501037_0012782_4223_5944 | 463 |
| 295 | 3300049574 | Ga0501038_0003687 | Ga0501038_0003687_1411_3132 | 463 |
| 296 | 3300049575 | Ga0501039_0037349 | Ga0501039_0037349_534_2255 | 463 |
| 297 | 3300049576 | Ga0501040_0088365 | Ga0501040_0088365_80_1762 | 463 |
| 298 | 3300049578 | Ga0501042_0002232 | Ga0501042_0002232_188_1909 | 463 |
| 299 | 3300049583 | Ga0501067_0002412 | Ga0501067_0002412_4103_5824 | 463 |
| 300 | 3300049585 | Ga0501069_0012427 | Ga0501069_0012427_2784_4505 | 463 |
| 301 | 3300049587 | Ga0501071_0008094 | Ga0501071_0008094_268_1989 | 463 |
| 302 | 3300049588 | Ga0501072_0026113 | Ga0501072_0026113_1618_3300 | 463 |
| 303 | 3300049590 | Ga0501074_0011828 | Ga0501074_0011828_184_1905 | 463 |
| 304 | 3300049591 | Ga0501075_0044534 | Ga0501075_0044534_1465_3147 | 463 |
| 305 | 3300049592 | Ga0501076_0102434 | Ga0501076_0102434_602_2284 | 463 |
| 306 | 3300049742 | Ga0501080_0026783 | Ga0501080_0026783_2099_3820 | 463 |
| 307 | 3300049744 | Ga0501083_0001145 | Ga0501083_0001145_10356_12200 | 463 |
| 308 | 3300049824 | Ga0501045_0010474 | Ga0501045_0010474_4241_5923 | 463 |
| 309 | 3300054114 | Ga0501084_0055531 | Ga0501084_0055531_501_2345 | 463 |
| 310 | 3300054114 | Ga0501084_0097493 | Ga0501084_0097493_256_1977 | 463 |
| 311 | 3300059490 | Ga0587066_002459 | Ga0587066_002459_203_1951 | 463 |
| 312 | 3300060353 | Ga0501082_0029654 | Ga0501082_0029654_2658_4379 | 463 |
| 313 | 3300060353 | Ga0501082_0076488 | Ga0501082_0076488_686_2530 | 463 |
| 314 | 3300005456 | Ga0070678_100123059 | Ga0070678_1001230591 | 464 |
| 315 | 3300005457 | Ga0070662_100122927 | Ga0070662_1001229272 | 464 |
| 316 | 3300009147 | Ga0114129_10021939 | Ga0114129_100219391 | 464 |
| 317 | 3300009177 | Ga0105248_10022958 | Ga0105248_100229583 | 464 |
| 318 | 3300009553 | Ga0105249_10106280 | Ga0105249_101062802 | 464 |
| 319 | 3300025933 | Ga0207706_10082047 | Ga0207706_100820471 | 464 |
| 320 | 3300025941 | Ga0207711_10111373 | Ga0207711_101113731 | 464 |
| 321 | 3300026067 | Ga0207678_10101618 | Ga0207678_101016181 | 464 |
| 322 | 3300027907 | Ga0207428_10002363 | Ga0207428_100023639 | 464 |
| 323 | 3300032005 | Ga0307411_10017014 | Ga0307411_100170142 | 464 |
| 324 | 3300035171 | Ga0373946_0057414 | Ga0373946_0057414_49_1617 | 464 |
| 325 | 3300049568 | Ga0501031_0012051 | Ga0501031_0012051_3213_4994 | 464 |
| 326 | 3300049570 | Ga0501033_0003900 | Ga0501033_0003900_7644_9425 | 464 |
| 327 | 3300049572 | Ga0501036_0004166 | Ga0501036_0004166_4787_6568 | 464 |
| 328 | 3300049573 | Ga0501037_0021613 | Ga0501037_0021613_611_2392 | 464 |
| 329 | 3300049574 | Ga0501038_0005770 | Ga0501038_0005770_3320_5101 | 464 |
| 330 | 3300049575 | Ga0501039_0035877 | Ga0501039_0035877_500_2197 | 464 |
| 331 | 3300049580 | Ga0501046_0023381 | Ga0501046_0023381_116_1897 | 464 |
| 332 | 3300049581 | Ga0501047_0002381 | Ga0501047_0002381_6916_8604 | 464 |
| 333 | 3300049582 | Ga0501048_0010204 | Ga0501048_0010204_3738_5519 | 464 |
| 334 | 3300049583 | Ga0501067_0004704 | Ga0501067_0004704_3093_4874 | 464 |
| 335 | 3300049584 | Ga0501068_0005054 | Ga0501068_0005054_4164_5945 | 464 |
| 336 | 3300049590 | Ga0501074_0012875 | Ga0501074_0012875_1816_3597 | 464 |
| 337 | 3300049742 | Ga0501080_0007987 | Ga0501080_0007987_269_2050 | 464 |
| 338 | 3300049744 | Ga0501083_0020384 | Ga0501083_0020384_1656_3437 | 464 |
| 339 | 3300049823 | Ga0501044_0057335 | Ga0501044_0057335_2182_3870 | 464 |
| 340 | 3300049824 | Ga0501045_0023082 | Ga0501045_0023082_217_1998 | 464 |
| 341 | 3300050508 | nmdc:mga09592_145535_c1 | nmdc:mga09592_145535_c1_280_1956 | 464 |
| 342 | 3300050515 | nmdc:mga0a205_7140_c1 | nmdc:mga0a205_7140_c1_4023_5579 | 464 |
| 343 | 3300054114 | Ga0501084_0038385 | Ga0501084_0038385_613_2394 | 464 |
| 344 | 3300054114 | Ga0501084_0072166 | Ga0501084_0072166_256_1953 | 464 |
| 345 | 3300003163 | Ga0006759J45824_1031218 | Ga0006759J45824_10312182 | 465 |
| 346 | 3300003574 | Ga0007410J51695_1016549 | Ga0007410J51695_10165492 | 465 |
| 347 | 3300003575 | Ga0007409J51694_1020425 | Ga0007409J51694_10204252 | 465 |
| 348 | 3300003577 | Ga0007416J51690_1013267 | Ga0007416J51690_10132672 | 465 |
| 349 | 3300006852 | Ga0075433_10057140 | Ga0075433_100571403 | 465 |
| 350 | 3300049588 | Ga0501072_0047397 | Ga0501072_0047397_784_2475 | 465 |
| 351 | 3300050507 | nmdc:mga05p37_22643_c1 | nmdc:mga05p37_22643_c1_5752_7314 | 465 |
| 352 | 3300050509 | nmdc:mga0qj67_29562_c1 | nmdc:mga0qj67_29562_c1_2019_3581 | 465 |
| 353 | 3300050510 | nmdc:mga06r32_38432_c1 | nmdc:mga06r32_38432_c1_2479_4041 | 465 |
| 354 | 3300006237 | Ga0097621_100095458 | Ga0097621_1000954582 | 466 |
| 355 | 3300006358 | Ga0068871_100094550 | Ga0068871_1000945501 | 466 |
| 356 | 3300006844 | Ga0075428_100061501 | Ga0075428_1000615012 | 466 |
| 357 | 3300006852 | Ga0075433_10051074 | Ga0075433_100510743 | 466 |
| 358 | 3300020070 | Ga0206356_10818170 | Ga0206356_108181702 | 466 |
| 359 | 3300020080 | Ga0206350_10488288 | Ga0206350_104882882 | 466 |
| 360 | 3300025941 | Ga0207711_10050134 | Ga0207711_100501342 | 466 |
| 361 | 3300035170 | Ga0373943_0057749 | Ga0373943_0057749_10_1575 | 466 |
| 362 | 3300049579 | Ga0501043_0002195 | Ga0501043_0002195_4495_6342 | 466 |
| 363 | 3300049581 | Ga0501047_0002980 | Ga0501047_0002980_3059_4906 | 466 |
| 364 | 3300049591 | Ga0501075_0043394 | Ga0501075_0043394_986_2545 | 466 |
| 365 | 3300049744 | Ga0501083_0006214 | Ga0501083_0006214_4657_6504 | 466 |
| 366 | 3300050512 | nmdc:mga0n895_11166_c1 | nmdc:mga0n895_11166_c1_5389_7110 | 466 |
| 367 | 3300050515 | nmdc:mga0a205_29030_c1 | nmdc:mga0a205_29030_c1_3136_4857 | 466 |
| 368 | 3300053103 | Ga0500555_000185 | Ga0500555_000185_19418_21118 | 466 |
| 369 | 3300053153 | Ga0500616_0000173 | Ga0500616_0000173_66130_67827 | 466 |
| 370 | 3300053730 | Ga0500645_000077 | Ga0500645_000077_29546_31246 | 466 |
| 371 | 3300054114 | Ga0501084_0038278 | Ga0501084_0038278_2037_3884 | 466 |
| 372 | 3300059492 | Ga0587073_0001165 | Ga0587073_0001165_371_2131 | 466 |
| 373 | 3300059504 | Ga0587082_001100 | Ga0587082_001100_369_2129 | 466 |
| 374 | 3300059604 | Ga0587098_000822 | Ga0587098_000822_215_1975 | 466 |
| 375 | 3300059626 | Ga0587115_000622 | Ga0587115_000622_391_2151 | 466 |
| 376 | 3300059630 | Ga0587128_001906 | Ga0587128_001906_250_2010 | 466 |
| 377 | 3300059640 | Ga0587067_003121 | Ga0587067_003121_210_1970 | 466 |
| 378 | 3300059652 | Ga0587107_000873 | Ga0587107_000873_61_1821 | 466 |
| 379 | 3300059655 | Ga0587114_001461 | Ga0587114_001461_29_1777 | 466 |
| 380 | 3300005518 | Ga0070699_100093606 | Ga0070699_1000936062 | 467 |
| 381 | 3300006871 | Ga0075434_100028466 | Ga0075434_1000284661 | 467 |
| 382 | 3300006914 | Ga0075436_100009468 | Ga0075436_1000094686 | 467 |
| 383 | 3300031548 | Ga0307408_100016732 | Ga0307408_1000167325 | 467 |
| 384 | 3300032002 | Ga0307416_100019338 | Ga0307416_1000193382 | 467 |
| 385 | 3300049583 | Ga0501067_0054491 | Ga0501067_0054491_67_1893 | 467 |
| 386 | 3300049585 | Ga0501069_0025233 | Ga0501069_0025233_1040_2866 | 467 |
| 387 | 3300050514 | nmdc:mga08x19_8275_c1 | nmdc:mga08x19_8275_c1_4010_5596 | 467 |
| 388 | 3300059421 | Ga0590071_000346 | Ga0590071_000346_11645_13327 | 467 |
| 389 | 3300059424 | Ga0590075_000232 | Ga0590075_000232_12413_14095 | 467 |
| 390 | 3300059426 | Ga0590077_001575 | Ga0590077_001575_1518_3200 | 467 |
| 391 | 3300005329 | Ga0070683_100003662 | Ga0070683_1000036625 | 468 |
| 392 | 3300020070 | Ga0206356_10089078 | Ga0206356_100890782 | 468 |
| 393 | 3300032002 | Ga0307416_100064890 | Ga0307416_1000648904 | 468 |
| 394 | 3300042435 | Ga0439434_0012064 | Ga0439434_0012064_919_2451 | 468 |
| 395 | 3300047322 | Ga0495680_0142187 | Ga0495680_0142187_54_1745 | 468 |
| 396 | 3300048905 | Ga0496102_0238289 | Ga0496102_0238289_120_1682 | 468 |
| 397 | 3300048908 | Ga0496105_0017872 | Ga0496105_0017872_4048_5610 | 468 |
| 398 | 3300048909 | Ga0496106_0139339 | Ga0496106_0139339_244_1806 | 468 |
| 399 | 3300048911 | Ga0496108_0001529 | Ga0496108_0001529_6221_7783 | 468 |
| 400 | 3300048914 | Ga0496111_0010159 | Ga0496111_0010159_4085_5647 | 468 |
| 401 | 3300049576 | Ga0501040_0099139 | Ga0501040_0099139_321_2006 | 468 |
| 402 | 3300049587 | Ga0501071_0090619 | Ga0501071_0090619_450_2135 | 468 |
| 403 | 3300049591 | Ga0501075_0027261 | Ga0501075_0027261_1865_3517 | 468 |
| 404 | 3300050495 | nmdc:mga04h51_6591_c1 | nmdc:mga04h51_6591_c1_712_2457 | 468 |
| 405 | 3300050515 | nmdc:mga0a205_58922_c1 | nmdc:mga0a205_58922_c1_792_2351 | 468 |
| 406 | 3300004801 | Ga0058860_10070698 | Ga0058860_100706982 | 469 |
| 407 | 3300005331 | Ga0070670_100022034 | Ga0070670_1000220345 | 469 |
| 408 | 3300005435 | Ga0070714_100013434 | Ga0070714_1000134346 | 469 |
| 409 | 3300005466 | Ga0070685_10045828 | Ga0070685_100458282 | 469 |
| 410 | 3300005548 | Ga0070665_100113684 | Ga0070665_1001136844 | 469 |
| 411 | 3300005844 | Ga0068862_100033033 | Ga0068862_1000330334 | 469 |
| 412 | 3300006852 | Ga0075433_10083731 | Ga0075433_100837312 | 469 |
| 413 | 3300009094 | Ga0111539_10019674 | Ga0111539_100196743 | 469 |
| 414 | 3300009147 | Ga0114129_10006089 | Ga0114129_100060899 | 469 |
| 415 | 3300014325 | Ga0163163_10021804 | Ga0163163_100218043 | 469 |
| 416 | 3300025914 | Ga0207671_10084770 | Ga0207671_100847702 | 469 |
| 417 | 3300025925 | Ga0207650_10083044 | Ga0207650_100830442 | 469 |
| 418 | 3300027907 | Ga0207428_10028461 | Ga0207428_100284612 | 469 |
| 419 | 3300028379 | Ga0268266_10182583 | Ga0268266_101825831 | 469 |
| 420 | 3300028380 | Ga0268265_10021852 | Ga0268265_100218522 | 469 |
| 421 | 3300037068 | Ga0373925_0003186 | Ga0373925_0003186_11222_12787 | 469 |
| 422 | 3300050507 | nmdc:mga05p37_28785_c1 | nmdc:mga05p37_28785_c1_2095_3819 | 469 |
| 423 | 3300050511 | nmdc:mga08y16_30870_c1 | nmdc:mga08y16_30870_c1_3015_4739 | 469 |
| 424 | 3300050514 | nmdc:mga08x19_52680_c1 | nmdc:mga08x19_52680_c1_282_1847 | 469 |
| 425 | 3300050515 | nmdc:mga0a205_45771_c1 | nmdc:mga0a205_45771_c1_1725_3449 | 469 |
| 426 | 3300005354 | Ga0070675_100000033 | Ga0070675_10000003352 | 470 |
| 427 | 3300005471 | Ga0070698_100049353 | Ga0070698_1000493532 | 470 |
| 428 | 3300009147 | Ga0114129_10013889 | Ga0114129_100138895 | 470 |
| 429 | 3300009177 | Ga0105248_10027631 | Ga0105248_100276314 | 470 |
| 430 | 3300025926 | Ga0207659_10000202 | Ga0207659_1000020211 | 470 |
| 431 | 3300035692 | Ga0373935_0026577 | Ga0373935_0026577_431_2206 | 470 |
| 432 | 3300042876 | Ga0451577_0116561 | Ga0451577_0116561_306_1850 | 470 |
| 433 | 3300044712 | Ga0453684_0298900 | Ga0453684_0298900_189_1733 | 470 |
| 434 | 3300049743 | Ga0501081_0126265 | Ga0501081_0126265_86_1798 | 470 |
| 435 | 3300050507 | nmdc:mga05p37_9438_c1 | nmdc:mga05p37_9438_c1_4169_5887 | 470 |
| 436 | 3300003577 | Ga0007416J51690_1020095 | Ga0007416J51690_10200953 | 471 |
| 437 | 3300005295 | Ga0065707_10083167 | Ga0065707_100831673 | 471 |
| 438 | 3300005530 | Ga0070679_100164783 | Ga0070679_1001647832 | 471 |
| 439 | 3300006844 | Ga0075428_100003534 | Ga0075428_1000035348 | 471 |
| 440 | 3300006846 | Ga0075430_100006037 | Ga0075430_1000060374 | 471 |
| 441 | 3300006880 | Ga0075429_100017665 | Ga0075429_1000176653 | 471 |
| 442 | 3300007076 | Ga0075435_100000227 | Ga0075435_10000022720 | 471 |
| 443 | 3300009094 | Ga0111539_10010653 | Ga0111539_100106534 | 471 |
| 444 | 3300009147 | Ga0114129_10001838 | Ga0114129_1000183813 | 471 |
| 445 | 3300009147 | Ga0114129_10012628 | Ga0114129_100126285 | 471 |
| 446 | 3300014968 | Ga0157379_10052075 | Ga0157379_100520753 | 471 |
| 447 | 3300027907 | Ga0207428_10008328 | Ga0207428_100083286 | 471 |
| 448 | 3300042008 | Ga0439450_008299 | Ga0439450_008299_134_1729 | 471 |
| 449 | 3300046683 | Ga0495658_0078170 | Ga0495658_0078170_124_1839 | 471 |
| 450 | 3300049570 | Ga0501033_0012408 | Ga0501033_0012408_4359_6194 | 471 |
| 451 | 3300049571 | Ga0501034_0010668 | Ga0501034_0010668_562_2271 | 471 |
| 452 | 3300049573 | Ga0501037_0055376 | Ga0501037_0055376_179_2014 | 471 |
| 453 | 3300049574 | Ga0501038_0039366 | Ga0501038_0039366_2269_4104 | 471 |
| 454 | 3300049582 | Ga0501048_0028312 | Ga0501048_0028312_1815_3650 | 471 |
| 455 | 3300049583 | Ga0501067_0038604 | Ga0501067_0038604_367_2103 | 471 |
| 456 | 3300049590 | Ga0501074_0117873 | Ga0501074_0117873_47_1882 | 471 |
| 457 | 3300049742 | Ga0501080_0128071 | Ga0501080_0128071_214_2049 | 471 |
| 458 | 3300049822 | Ga0501035_0106549 | Ga0501035_0106549_73_1908 | 471 |
| 459 | 3300050507 | nmdc:mga05p37_11028_c1 | nmdc:mga05p37_11028_c1_1590_3320 | 471 |
| 460 | 3300050507 | nmdc:mga05p37_3800_c1 | nmdc:mga05p37_3800_c1_542_2140 | 471 |
| 461 | 3300050508 | nmdc:mga09592_3603_c1 | nmdc:mga09592_3603_c1_242_1840 | 471 |
| 462 | 3300050511 | nmdc:mga08y16_12383_c1 | nmdc:mga08y16_12383_c1_4135_5733 | 471 |
| 463 | 3300050512 | nmdc:mga0n895_72715_c1 | nmdc:mga0n895_72715_c1_1109_2671 | 471 |
| 464 | 3300050513 | nmdc:mga0rr50_910_c1 | nmdc:mga0rr50_910_c1_11489_13225 | 471 |
| 465 | 3300004801 | Ga0058860_10004412 | Ga0058860_100044122 | 472 |
| 466 | 3300005331 | Ga0070670_100066580 | Ga0070670_1000665802 | 472 |
| 467 | 3300005355 | Ga0070671_100062713 | Ga0070671_1000627133 | 472 |
| 468 | 3300005471 | Ga0070698_100120713 | Ga0070698_1001207132 | 472 |
| 469 | 3300005549 | Ga0070704_100008604 | Ga0070704_1000086044 | 472 |
| 470 | 3300005617 | Ga0068859_100009968 | Ga0068859_1000099689 | 472 |
| 471 | 3300006931 | Ga0097620_100009967 | Ga0097620_1000099674 | 472 |
| 472 | 3300025922 | Ga0207646_10032768 | Ga0207646_100327683 | 472 |
| 473 | 3300026118 | Ga0207675_100023705 | Ga0207675_1000237054 | 472 |
| 474 | 3300049577 | Ga0501041_0072104 | Ga0501041_0072104_302_2023 | 472 |
| 475 | 3300049584 | Ga0501068_0095723 | Ga0501068_0095723_74_1783 | 472 |
| 476 | 3300049587 | Ga0501071_0008546 | Ga0501071_0008546_3627_5315 | 472 |
| 477 | 3300049589 | Ga0501073_0131029 | Ga0501073_0131029_26_1714 | 472 |
| 478 | 3300049592 | Ga0501076_0019667 | Ga0501076_0019667_562_2283 | 472 |
| 479 | 3300049593 | Ga0501077_0050316 | Ga0501077_0050316_248_1936 | 472 |
| 480 | 3300049743 | Ga0501081_0096010 | Ga0501081_0096010_60_1748 | 472 |
| 481 | 3300049824 | Ga0501045_0013053 | Ga0501045_0013053_3631_5319 | 472 |
| 482 | 3300050507 | nmdc:mga05p37_16419_c1 | nmdc:mga05p37_16419_c1_4076_5812 | 472 |
| 483 | 3300050510 | nmdc:mga06r32_1666_c1 | nmdc:mga06r32_1666_c1_7343_8935 | 472 |
| 484 | 3300050515 | nmdc:mga0a205_8923_c1 | nmdc:mga0a205_8923_c1_2772_4364 | 472 |
| 485 | 3300061734 | Ga0530510_0028940 | Ga0530510_0028940_1498_3186 | 472 |
| 486 | 3300061734 | Ga0530510_0070912 | Ga0530510_0070912_20_1822 | 472 |
| 487 | 3300005327 | Ga0070658_10020720 | Ga0070658_100207204 | 473 |
| 488 | 3300005331 | Ga0070670_100009033 | Ga0070670_1000090334 | 473 |
| 489 | 3300005335 | Ga0070666_10016095 | Ga0070666_100160954 | 473 |
| 490 | 3300005340 | Ga0070689_100076412 | Ga0070689_1000764122 | 473 |
| 491 | 3300005364 | Ga0070673_100026380 | Ga0070673_1000263803 | 473 |
| 492 | 3300005436 | Ga0070713_100038745 | Ga0070713_1000387452 | 473 |
| 493 | 3300005518 | Ga0070699_100005625 | Ga0070699_1000056254 | 473 |
| 494 | 3300005616 | Ga0068852_100074866 | Ga0068852_1000748662 | 473 |
| 495 | 3300005618 | Ga0068864_100084020 | Ga0068864_1000840202 | 473 |
| 496 | 3300005842 | Ga0068858_100164348 | Ga0068858_1001643482 | 473 |
| 497 | 3300007076 | Ga0075435_100017470 | Ga0075435_1000174704 | 473 |
| 498 | 3300009093 | Ga0105240_10096617 | Ga0105240_100966172 | 473 |
| 499 | 3300009147 | Ga0114129_10034701 | Ga0114129_100347015 | 473 |
| 500 | 3300025315 | Ga0207697_10010765 | Ga0207697_100107653 | 473 |
| 501 | 3300025910 | Ga0207684_10132789 | Ga0207684_101327892 | 473 |
| 502 | 3300025913 | Ga0207695_10137046 | Ga0207695_101370462 | 473 |
| 503 | 3300025928 | Ga0207700_10006978 | Ga0207700_100069783 | 473 |
| 504 | 3300025940 | Ga0207691_10038623 | Ga0207691_100386234 | 473 |
| 505 | 3300025960 | Ga0207651_10050208 | Ga0207651_100502081 | 473 |
| 506 | 3300026035 | Ga0207703_10025184 | Ga0207703_100251842 | 473 |
| 507 | 3300026095 | Ga0207676_10107685 | Ga0207676_101076851 | 473 |
| 508 | 3300032002 | Ga0307416_100019252 | Ga0307416_1000192525 | 473 |
| 509 | 3300034820 | Ga0373959_0001827 | Ga0373959_0001827_44_1780 | 473 |
| 510 | 3300035085 | Ga0373929_0000084 | Ga0373929_0000084_9743_11479 | 473 |
| 511 | 3300035090 | Ga0373949_0000458 | Ga0373949_0000458_1464_3200 | 473 |
| 512 | 3300035091 | Ga0373951_0004686 | Ga0373951_0004686_1139_2875 | 473 |
| 513 | 3300035112 | Ga0373932_0003788 | Ga0373932_0003788_1291_3027 | 473 |
| 514 | 3300035115 | Ga0373941_0000491 | Ga0373941_0000491_5358_7094 | 473 |
| 515 | 3300035121 | Ga0373960_0001976 | Ga0373960_0001976_20_1756 | 473 |
| 516 | 3300035241 | Ga0373961_0005974 | Ga0373961_0005974_643_2379 | 473 |
| 517 | 3300035691 | Ga0373931_0000748 | Ga0373931_0000748_11720_13456 | 473 |
| 518 | 3300045051 | Ga0451576_0007358 | Ga0451576_0007358_7235_8971 | 473 |
| 519 | 3300048904 | Ga0496101_0055336 | Ga0496101_0055336_587_2314 | 473 |
| 520 | 3300048915 | Ga0496112_0001657 | Ga0496112_0001657_8012_9739 | 473 |
| 521 | 3300048917 | Ga0496114_0143698 | Ga0496114_0143698_262_1989 | 473 |
| 522 | 3300050513 | nmdc:mga0rr50_61271_c1 | nmdc:mga0rr50_61271_c1_614_2347 | 473 |
| 523 | 3300005347 | Ga0070668_100066077 | Ga0070668_1000660774 | 474 |
| 524 | 3300005356 | Ga0070674_100010219 | Ga0070674_1000102196 | 474 |
| 525 | 3300005440 | Ga0070705_100014159 | Ga0070705_1000141592 | 474 |
| 526 | 3300005458 | Ga0070681_10193788 | Ga0070681_101937881 | 474 |
| 527 | 3300005546 | Ga0070696_100012815 | Ga0070696_1000128154 | 474 |
| 528 | 3300006844 | Ga0075428_100000007 | Ga0075428_100000007229 | 474 |
| 529 | 3300009094 | Ga0111539_10000009 | Ga0111539_10000009162 | 474 |
| 530 | 3300009148 | Ga0105243_10010061 | Ga0105243_100100614 | 474 |
| 531 | 3300009176 | Ga0105242_10020330 | Ga0105242_100203304 | 474 |
| 532 | 3300009176 | Ga0105242_10102061 | Ga0105242_101020611 | 474 |
| 533 | 3300014326 | Ga0157380_10007605 | Ga0157380_100076054 | 474 |
| 534 | 3300025921 | Ga0207652_10012813 | Ga0207652_100128135 | 474 |
| 535 | 3300025941 | Ga0207711_10051810 | Ga0207711_100518103 | 474 |
| 536 | 3300026118 | Ga0207675_100039295 | Ga0207675_1000392952 | 474 |
| 537 | 3300027907 | Ga0207428_10000022 | Ga0207428_10000022229 | 474 |
| 538 | 3300032002 | Ga0307416_100038333 | Ga0307416_1000383334 | 474 |
| 539 | 3300032002 | Ga0307416_100073635 | Ga0307416_1000736354 | 474 |
| 540 | 3300041997 | Ga0439431_0004697 | Ga0439431_0004697_812_2554 | 474 |
| 541 | 3300042156 | Ga0439446_0001479 | Ga0439446_0001479_2410_4152 | 474 |
| 542 | 3300049572 | Ga0501036_0076618 | Ga0501036_0076618_623_2323 | 474 |
| 543 | 3300049582 | Ga0501048_0077740 | Ga0501048_0077740_551_2251 | 474 |
| 544 | 3300049592 | Ga0501076_0060228 | Ga0501076_0060228_526_2226 | 474 |
| 545 | 3300049824 | Ga0501045_0061233 | Ga0501045_0061233_608_2308 | 474 |
| 546 | 3300050511 | nmdc:mga08y16_21_c1 | nmdc:mga08y16_21_c1_16067_17767 | 474 |
| 547 | 3300050514 | nmdc:mga08x19_101405_c1 | nmdc:mga08x19_101405_c1_160_1896 | 474 |
| 548 | 3300054114 | Ga0501084_0041468 | Ga0501084_0041468_1670_3370 | 474 |
| 549 | 3300005343 | Ga0070687_100006711 | Ga0070687_1000067113 | 475 |
| 550 | 3300005366 | Ga0070659_100030340 | Ga0070659_1000303402 | 475 |
| 551 | 3300005436 | Ga0070713_100061646 | Ga0070713_1000616463 | 475 |
| 552 | 3300005544 | Ga0070686_100000149 | Ga0070686_10000014934 | 475 |
| 553 | 3300006028 | Ga0070717_10174215 | Ga0070717_101742151 | 475 |
| 554 | 3300006353 | Ga0075370_10004647 | Ga0075370_100046474 | 475 |
| 555 | 3300025909 | Ga0207705_10125308 | Ga0207705_101253081 | 475 |
| 556 | 3300025918 | Ga0207662_10019813 | Ga0207662_100198133 | 475 |
| 557 | 3300025932 | Ga0207690_10084519 | Ga0207690_100845192 | 475 |
| 558 | 3300046463 | Ga0495653_0005429 | Ga0495653_0005429_61_1833 | 475 |
| 559 | 3300049568 | Ga0501031_0010460 | Ga0501031_0010460_3956_5671 | 475 |
| 560 | 3300053077 | Ga0495601_0024117 | Ga0495601_0024117_1088_2869 | 475 |
| 561 | 3300060353 | Ga0501082_0017507 | Ga0501082_0017507_268_1983 | 475 |
| 562 | 3300005331 | Ga0070670_100023242 | Ga0070670_1000232424 | 476 |
| 563 | 3300005339 | Ga0070660_100066652 | Ga0070660_1000666522 | 476 |
| 564 | 3300006844 | Ga0075428_100138284 | Ga0075428_1001382841 | 476 |
| 565 | 3300006846 | Ga0075430_100003772 | Ga0075430_1000037723 | 476 |
| 566 | 3300006847 | Ga0075431_100007345 | Ga0075431_1000073453 | 476 |
| 567 | 3300006871 | Ga0075434_100095782 | Ga0075434_1000957821 | 476 |
| 568 | 3300009147 | Ga0114129_10005748 | Ga0114129_100057484 | 476 |
| 569 | 3300025925 | Ga0207650_10023408 | Ga0207650_100234084 | 476 |
| 570 | 3300049571 | Ga0501034_0006507 | Ga0501034_0006507_5316_7103 | 476 |
| 571 | 3300049742 | Ga0501080_0041000 | Ga0501080_0041000_2165_3916 | 476 |
| 572 | 3300050507 | nmdc:mga05p37_1547_c1 | nmdc:mga05p37_1547_c1_16859_18589 | 476 |
| 573 | 3300050515 | nmdc:mga0a205_21189_c1 | nmdc:mga0a205_21189_c1_2312_4042 | 476 |
| 574 | 3300042007 | Ga0439449_0025026 | Ga0439449_0025026_189_1943 | 477 |
| 575 | 3300042156 | Ga0439446_0012122 | Ga0439446_0012122_464_2218 | 477 |
| 576 | 3300048915 | Ga0496112_0077562 | Ga0496112_0077562_10_1761 | 477 |
| 577 | 3300003162 | Ga0006778J45830_1035146 | Ga0006778J45830_10351462 | 478 |
| 578 | 3300003577 | Ga0007416J51690_1013494 | Ga0007416J51690_10134942 | 478 |
| 579 | 3300003693 | Ga0032354_1006421 | Ga0032354_10064212 | 478 |
| 580 | 3300004801 | Ga0058860_12181476 | Ga0058860_121814762 | 478 |
| 581 | 3300050513 | nmdc:mga0rr50_9579_c1 | nmdc:mga0rr50_9579_c1_1033_2652 | 478 |
| 582 | 3300050515 | nmdc:mga0a205_32367_c1 | nmdc:mga0a205_32367_c1_2324_3943 | 478 |
| 583 | 3300053085 | Ga0495619_0022749 | Ga0495619_0022749_1681_3432 | 478 |
| 584 | 3300005328 | Ga0070676_10022394 | Ga0070676_100223943 | 479 |
| 585 | 3300005341 | Ga0070691_10014987 | Ga0070691_100149872 | 479 |
| 586 | 3300005353 | Ga0070669_100025468 | Ga0070669_1000254683 | 479 |
| 587 | 3300005355 | Ga0070671_100015606 | Ga0070671_1000156065 | 479 |
| 588 | 3300005367 | Ga0070667_100076368 | Ga0070667_1000763682 | 479 |
| 589 | 3300005438 | Ga0070701_10006600 | Ga0070701_100066004 | 479 |
| 590 | 3300005441 | Ga0070700_100050380 | Ga0070700_1000503802 | 479 |
| 591 | 3300005456 | Ga0070678_100046932 | Ga0070678_1000469322 | 479 |
| 592 | 3300005530 | Ga0070679_100138153 | Ga0070679_1001381531 | 479 |
| 593 | 3300005617 | Ga0068859_100067301 | Ga0068859_1000673014 | 479 |
| 594 | 3300006847 | Ga0075431_100191097 | Ga0075431_1001910972 | 479 |
| 595 | 3300006931 | Ga0097620_100067301 | Ga0097620_1000673013 | 479 |
| 596 | 3300009147 | Ga0114129_10126228 | Ga0114129_101262282 | 479 |
| 597 | 3300009148 | Ga0105243_10014062 | Ga0105243_100140624 | 479 |
| 598 | 3300009176 | Ga0105242_10023819 | Ga0105242_100238194 | 479 |
| 599 | 3300009177 | Ga0105248_10100656 | Ga0105248_101006563 | 479 |
| 600 | 3300009553 | Ga0105249_10043569 | Ga0105249_100435693 | 479 |
| 601 | 3300020080 | Ga0206350_11054261 | Ga0206350_110542612 | 479 |
| 602 | 3300025907 | Ga0207645_10002364 | Ga0207645_100023645 | 479 |
| 603 | 3300025918 | Ga0207662_10002541 | Ga0207662_100025416 | 479 |
| 604 | 3300025926 | Ga0207659_10083354 | Ga0207659_100833542 | 479 |
| 605 | 3300025932 | Ga0207690_10039956 | Ga0207690_100399562 | 479 |
| 606 | 3300025937 | Ga0207669_10007991 | Ga0207669_100079912 | 479 |
| 607 | 3300025940 | Ga0207691_10014038 | Ga0207691_100140384 | 479 |
| 608 | 3300025941 | Ga0207711_10007837 | Ga0207711_100078375 | 479 |
| 609 | 3300025960 | Ga0207651_10001095 | Ga0207651_100010954 | 479 |
| 610 | 3300026035 | Ga0207703_10068158 | Ga0207703_100681582 | 479 |
| 611 | 3300026075 | Ga0207708_10002436 | Ga0207708_100024363 | 479 |
| 612 | 3300026118 | Ga0207675_100085609 | Ga0207675_1000856093 | 479 |
| 613 | 3300026121 | Ga0207683_10060044 | Ga0207683_100600442 | 479 |
| 614 | 3300028381 | Ga0268264_10048412 | Ga0268264_100484124 | 479 |
| 615 | 3300031824 | Ga0307413_10052123 | Ga0307413_100521232 | 479 |
| 616 | 3300050507 | nmdc:mga05p37_135344_c1 | nmdc:mga05p37_135344_c1_910_2640 | 479 |
| 617 | 3300050510 | nmdc:mga06r32_50291_c2 | nmdc:mga06r32_50291_c2_388_2118 | 479 |
| 618 | 3300035170 | Ga0373943_0012876 | Ga0373943_0012876_1898_3679 | 480 |
| 619 | 3300046683 | Ga0495658_0060204 | Ga0495658_0060204_219_2000 | 480 |
| 620 | 3300005293 | Ga0065715_10090070 | Ga0065715_100900705 | 482 |
| 621 | 3300005459 | Ga0068867_100044322 | Ga0068867_1000443222 | 482 |
| 622 | 3300005547 | Ga0070693_100026698 | Ga0070693_1000266981 | 482 |
| 623 | 3300005617 | Ga0068859_100096400 | Ga0068859_1000964002 | 482 |
| 624 | 3300005844 | Ga0068862_100009105 | Ga0068862_1000091054 | 482 |
| 625 | 3300006844 | Ga0075428_100095734 | Ga0075428_1000957343 | 482 |
| 626 | 3300006871 | Ga0075434_100145371 | Ga0075434_1001453711 | 482 |
| 627 | 3300006871 | Ga0075434_100182991 | Ga0075434_1001829912 | 482 |
| 628 | 3300006880 | Ga0075429_100051087 | Ga0075429_1000510871 | 482 |
| 629 | 3300006931 | Ga0097620_100096401 | Ga0097620_1000964012 | 482 |
| 630 | 3300025940 | Ga0207691_10030433 | Ga0207691_100304334 | 482 |
| 631 | 3300027907 | Ga0207428_10008515 | Ga0207428_100085153 | 482 |
| 632 | 3300027907 | Ga0207428_10042173 | Ga0207428_100421733 | 482 |
| 633 | 3300050507 | nmdc:mga05p37_20134_c1 | nmdc:mga05p37_20134_c1_1396_3180 | 482 |
| 634 | 3300005329 | Ga0070683_100000059 | Ga0070683_1000000598 | 483 |
| 635 | 3300005367 | Ga0070667_100077401 | Ga0070667_1000774012 | 483 |
| 636 | 3300005455 | Ga0070663_100017284 | Ga0070663_1000172843 | 483 |
| 637 | 3300005544 | Ga0070686_100075395 | Ga0070686_1000753952 | 483 |
| 638 | 3300009545 | Ga0105237_10186657 | Ga0105237_101866572 | 483 |
| 639 | 3300010375 | Ga0105239_10206816 | Ga0105239_102068162 | 483 |
| 640 | 3300013308 | Ga0157375_10123905 | Ga0157375_101239052 | 483 |
| 641 | 3300025920 | Ga0207649_10093603 | Ga0207649_100936031 | 483 |
| 642 | 3300025944 | Ga0207661_10012004 | Ga0207661_100120041 | 483 |
| 643 | 3300005439 | Ga0070711_100040437 | Ga0070711_1000404371 | 484 |
| 644 | 3300005841 | Ga0068863_100113371 | Ga0068863_1001133711 | 484 |
| 645 | 3300005441 | Ga0070700_100041058 | Ga0070700_1000410582 | 485 |
| 646 | 3300006844 | Ga0075428_100103065 | Ga0075428_1001030652 | 485 |
| 647 | 3300006852 | Ga0075433_10022542 | Ga0075433_100225424 | 485 |
| 648 | 3300025923 | Ga0207681_10007797 | Ga0207681_100077975 | 485 |
| 649 | 3300026075 | Ga0207708_10019848 | Ga0207708_100198483 | 485 |
| 650 | 3300026116 | Ga0207674_10108335 | Ga0207674_101083352 | 485 |
| 651 | 3300002459 | JGI24751J29686_10009595 | JGI24751J29686_100095952 | 486 |
| 652 | 3300005353 | Ga0070669_100070750 | Ga0070669_1000707502 | 486 |
| 653 | 3300005577 | Ga0068857_100046481 | Ga0068857_1000464812 | 486 |
| 654 | 3300025926 | Ga0207659_10030853 | Ga0207659_100308532 | 486 |
| 655 | 3300025933 | Ga0207706_10155877 | Ga0207706_101558771 | 486 |
| 656 | 3300025940 | Ga0207691_10164204 | Ga0207691_101642042 | 486 |
| 657 | 3300026116 | Ga0207674_10034434 | Ga0207674_100344343 | 486 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4pr7-assembly1.cif.gz_A | kdgm porin in complex with disordered oligogalacturonate | 0.8095 | 31 | 300 |
| 4pr7-assembly1.cif.gz_A | kdgm porin in complex with disordered oligogalacturonate | 0.792 | 31 | 300 |
| 4fqe-assembly1.cif.gz_A | kdgm porin | 0.789 | 31 | 300 |
| 2hqs-assembly1.cif.gz_H | crystal structure of tolb/pal complex | 0.7822 | 380 | 482 |
| 4pwt-assembly3.cif.gz_C | crystal structure of peptidoglycan-associated outer membrane lipoprotein from yersinia pestis co92 | 0.7724 | 380 | 486 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4fqeA00 | Mainly Beta;Beta Barrel;Porin;monomeric porin ompg | 0.789 | 31 | 300 | 2.40.160.40 |
| 4fqeA00 | Mainly Beta;Beta Barrel;Porin;monomeric porin ompg | 0.7721 | 31 | 300 | 2.40.160.40 |
| 4pwtC00 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;OmpA-like domain | 0.7667 | 380 | 486 | 3.30.1330.60 |
| 2w8bC00 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;OmpA-like domain | 0.7661 | 380 | 482 | 3.30.1330.60 |
| af_P0A910_199_343_3.30.1330.60 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;OmpA-like domain | 0.7602 | 371 | 486 | 3.30.1330.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W0LC21-F1-model_v4 | Uncharacterized protein | 0.9953 | 6 | 243 |
|
| AF-A0A3R5YUZ6-F1-model_v4 | OmpA-like domain-containing protein | 0.8573 | 374 | 485 |
GO:0009279
|
| AF-A0A6N8WW03-F1-model_v4 | Transporter | 0.8382 | 19 | 299 |
|
| AF-A0A7Y1XZE7-F1-model_v4 | OmpA family protein | 0.8271 | 370 | 486 |
GO:0016020
|
| AF-A0A5C6U808-F1-model_v4 | OmpA family protein | 0.826 | 370 | 486 |
GO:0016020
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar