F473075

General Info

Members Datasets Scaffolds Average Seq Length
657 339 1314 142

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_100122879|Ga0070706_1001228792
Length 161
Sequence MALAQRNEGANVTSDINVTPMVDVMLVLLIIFMVVTPMLQHGIPVDMARVNNPTDMHDADKEDALQVAITRDDHVFFGADPVKVDELTQKVKDKLANRTDKRVFLKADARAKFGWVVEVVDNVRAAGVDQLGLLTDIKKSGSMAPPPGALPPSPTTPTGGQ

Samples

Sample ID Description Type Environment
1 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
2 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
4 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
74 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009828 Sorghum rhizosphere soil microbial communities in Albany, CA(condition:control)- sample E Metatranscriptome Rhizosphere
86 3300009829 Sorghum rhizosphere soil microbial communities under drought stress in Albany, CA - sample D Metatranscriptome Rhizosphere
87 3300009835 Sorghum rhizosphere soil microbial communities under drought stress in Albany, CA - sample B Metatranscriptome Rhizosphere
88 3300009850 Sorghum rhizosphere soil microbial communities in Albany, CA (condition:control)- sample C Metatranscriptome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300019188 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE2 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
106 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
109 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
115 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
116 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
118 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
169 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
173 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300030882 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
177 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
178 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
179 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
180 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
181 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
182 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
183 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
184 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
185 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
186 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
187 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
188 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
189 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
190 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
191 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
192 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
193 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
194 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
195 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
196 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
197 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
198 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
199 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
200 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
201 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
202 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
203 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
204 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
205 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
206 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
207 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
208 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
209 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
210 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
211 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
212 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
213 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
214 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
215 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
216 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
217 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
218 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
219 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
220 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
221 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
222 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
223 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
224 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
225 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
226 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
227 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
228 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
229 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
230 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
231 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
232 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
233 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
234 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
235 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
236 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
237 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
238 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
239 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
240 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
241 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
242 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
243 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
244 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
245 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
246 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
247 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
248 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
249 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
250 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
251 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
252 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
253 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
254 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
255 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
256 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
257 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
258 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
259 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
260 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
261 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
262 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
263 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
264 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
265 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
266 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
267 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
268 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
269 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
270 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
271 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
272 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
273 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
274 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
275 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
276 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
277 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
278 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
279 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
280 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
281 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
282 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
283 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
284 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
285 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
286 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
287 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
288 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
289 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
290 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
291 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
292 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
293 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
294 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
295 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
296 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
297 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
298 3300059514 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
299 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
300 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
301 3300059606 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 159R_AD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
302 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
303 3300059608 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
304 3300059609 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 227R_SD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
305 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
306 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
307 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
308 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
309 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
310 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
311 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
312 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
313 3300059631 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
314 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
315 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
316 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
317 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
318 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
319 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
320 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
321 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
322 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
323 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
324 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
325 3300059650 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 69R_SD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
326 3300059651 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
327 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
328 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
329 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
330 3300059656 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 153R_AW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
331 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
332 3300059659 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
333 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
334 3300060243 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 1R_CW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
335 3300060245 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 6R_CD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
336 3300060246 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 22R_SD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
337 3300060247 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 61R_AD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
338 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
339 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 66.36
Metatranscriptomes 33.64
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.18
Rhizosphere 94.06
Stem 0
Stem Tuber 0
Unclassified 1.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070706_100122879 3300005467 Bacteria 2420
2 Ga0032354_1060940 3300003693 Bacteria 3371
3 Ga0032354_1119552 3300003693 Bacteria 1133
4 Ga0058859_11468909 3300004798 Bacteria 1580
5 Ga0058863_10085382 3300004799 Bacteria 1663
6 Ga0058863_11564836 3300004799 Bacteria 818
7 Ga0058863_11661751 3300004799 Bacteria 633
8 Ga0058863_11965722 3300004799 Bacteria 1157
9 Ga0058861_10011078 3300004800 Bacteria 3334
10 Ga0058861_10027511 3300004800 Bacteria 4260
11 Ga0058861_10092036 3300004800 Bacteria 1846
12 Ga0058861_11931524 3300004800 Bacteria 1049
13 Ga0058861_11950001 3300004800 Bacteria 1260
14 Ga0058862_10273100 3300004803 Bacteria 1947
15 Ga0058862_12546538 3300004803 Bacteria 2074
16 Ga0058862_12847660 3300004803 Bacteria 2776
17 Ga0065715_10137834 3300005293 Bacteria 1898
18 Ga0065715_10201958 3300005293 Bacteria 1357
19 Ga0070683_100044689 3300005329 Bacteria 4086
20 Ga0070683_100285785 3300005329 Bacteria 1569
21 Ga0070690_100024222 3300005330 Bacteria 3731
22 Ga0070670_100621292 3300005331 Bacteria 968
23 Ga0070677_10437851 3300005333 Bacteria 697
24 Ga0070666_10023589 3300005335 Bacteria 4005
25 Ga0070666_10072906 3300005335 Bacteria 2338
26 Ga0070666_10210942 3300005335 Bacteria 1368
27 Ga0070680_100084366 3300005336 Bacteria 2623
28 Ga0070682_100047174 3300005337 Bacteria 2677
29 Ga0068868_100008261 3300005338 Bacteria 7453
30 Ga0070660_100272666 3300005339 Bacteria 1383
31 Ga0070691_10012010 3300005341 Bacteria 3965
32 Ga0070661_100083047 3300005344 Bacteria 2366
33 Ga0070668_100032413 3300005347 Bacteria 3977
34 Ga0070671_100131598 3300005355 Bacteria 2107
35 Ga0070688_100156275 3300005365 Bacteria 1563
36 Ga0070659_100148355 3300005366 Bacteria 1912
37 Ga0070659_100370666 3300005366 Bacteria 1204
38 Ga0070667_100053885 3300005367 Bacteria 3395
39 Ga0070709_10140461 3300005434 Bacteria 1659
40 Ga0070709_10412386 3300005434 Bacteria 1011
41 Ga0070709_10478158 3300005434 Bacteria 943
42 Ga0070714_100810560 3300005435 Bacteria 907
43 Ga0070713_100002212 3300005436 Bacteria 12602
44 Ga0070713_100140199 3300005436 Bacteria 2141
45 Ga0070713_100289079 3300005436 Bacteria 1506
46 Ga0070710_10702812 3300005437 Bacteria 714
47 Ga0070710_11213317 3300005437 Bacteria 558
48 Ga0070711_100001903 3300005439 Bacteria 11669
49 Ga0070711_100346800 3300005439 Bacteria 1193
50 Ga0070711_100653660 3300005439 Bacteria 882
51 Ga0070694_100899271 3300005444 Bacteria 731
52 Ga0070708_100023165 3300005445 Bacteria 5276
53 Ga0070708_100302655 3300005445 Bacteria 1505
54 Ga0070663_100872292 3300005455 Bacteria 776
55 Ga0070662_100000606 3300005457 Bacteria 21896
56 Ga0070681_10015841 3300005458 Bacteria 7515
57 Ga0070681_10267063 3300005458 Bacteria 1622
58 Ga0070681_10452929 3300005458 Bacteria 1195
59 Ga0070681_10454838 3300005458 Bacteria 1193
60 Ga0070681_11084210 3300005458 Bacteria 722
61 Ga0068867_100163197 3300005459 Bacteria 1758
62 Ga0070707_100059458 3300005468 Bacteria 3666
63 Ga0070707_100064678 3300005468 Bacteria 3512
64 Ga0070707_100217955 3300005468 Bacteria 1859
65 Ga0070707_100380276 3300005468 Bacteria 1372
66 Ga0070707_100558845 3300005468 Bacteria 1106
67 Ga0070698_100576988 3300005471 Bacteria 1065
68 Ga0070699_100231248 3300005518 Bacteria 1649
69 Ga0070699_100281884 3300005518 Bacteria 1488
70 Ga0070699_100784341 3300005518 Bacteria 872
71 Ga0070679_100000387 3300005530 Bacteria 37548
72 Ga0070679_100156601 3300005530 Bacteria 2253
73 Ga0070679_100604458 3300005530 Bacteria 1040
74 Ga0070679_100915222 3300005530 Bacteria 821
75 Ga0070684_100373412 3300005535 Bacteria 1313
76 Ga0070697_100000248 3300005536 Bacteria 43558
77 Ga0070697_100004367 3300005536 Bacteria 10849
78 Ga0070697_100137022 3300005536 Bacteria 2056
79 Ga0070697_100153825 3300005536 Bacteria 1940
80 Ga0070697_100470386 3300005536 Bacteria 1097
81 Ga0068853_100082078 3300005539 Bacteria 2823
82 Ga0070686_100039502 3300005544 Bacteria 2941
83 Ga0070695_100012346 3300005545 Bacteria 5122
84 Ga0070696_100027344 3300005546 Bacteria 3885
85 Ga0070696_100659453 3300005546 Bacteria 849
86 Ga0070693_100251399 3300005547 Bacteria 1172
87 Ga0070665_100050106 3300005548 Bacteria 4190
88 Ga0068855_100034160 3300005563 Bacteria 6066
89 Ga0068855_100056717 3300005563 Bacteria 4594
90 Ga0070664_100045792 3300005564 Bacteria 3694
91 Ga0070664_100248615 3300005564 Bacteria 1598
92 Ga0070664_100776389 3300005564 Bacteria 895
93 Ga0068857_100049425 3300005577 Bacteria 3731
94 Ga0068857_100229524 3300005577 Bacteria 1697
95 Ga0068854_100882490 3300005578 Bacteria 785
96 Ga0068856_100022439 3300005614 Bacteria 6138
97 Ga0068856_100042241 3300005614 Bacteria 4484
98 Ga0070702_100670526 3300005615 Bacteria 787
99 Ga0068852_100080610 3300005616 Bacteria 2886
100 Ga0068852_100262538 3300005616 Bacteria 1659
101 Ga0068859_100059710 3300005617 Bacteria 3842
102 Ga0068859_100643603 3300005617 Bacteria 1152
103 Ga0068864_100004773 3300005618 Bacteria 11106
104 Ga0068864_100185345 3300005618 Bacteria 1905
105 Ga0068864_100368909 3300005618 Bacteria 1358
106 Ga0068866_10105459 3300005718 Bacteria 1563
107 Ga0068861_100216680 3300005719 Bacteria 1615
108 Ga0068851_10043424 3300005834 Bacteria 2266
109 Ga0068863_100006045 3300005841 Bacteria 11880
110 Ga0068863_100025938 3300005841 Bacteria 5592
111 Ga0068863_100106247 3300005841 Bacteria 2671
112 Ga0068858_100146282 3300005842 Bacteria 2219
113 Ga0068858_100376611 3300005842 Bacteria 1362
114 Ga0068860_100010738 3300005843 Bacteria 9042
115 Ga0068860_100398011 3300005843 Bacteria 1362
116 Ga0068860_100515025 3300005843 Bacteria 1196
117 Ga0068860_100776390 3300005843 Bacteria 971
118 Ga0068862_100011606 3300005844 Bacteria 7268
119 Ga0081540_1011878 3300005983 Bacteria 5782
120 Ga0070717_10149562 3300006028 Bacteria 2019
121 Ga0070717_10414714 3300006028 Bacteria 1211
122 Ga0070715_10217134 3300006163 Bacteria 981
123 Ga0070715_10236272 3300006163 Bacteria 948
124 Ga0070716_100033276 3300006173 Bacteria 2818
125 Ga0070716_100579590 3300006173 Bacteria 841
126 Ga0070712_100000655 3300006175 Bacteria 20391
127 Ga0070712_100108954 3300006175 Bacteria 2063
128 Ga0097621_100052507 3300006237 Bacteria 3321
129 Ga0097621_100803718 3300006237 Bacteria 871
130 Ga0068871_100003051 3300006358 Bacteria 11494
131 Ga0068871_100189955 3300006358 Bacteria 1769
132 Ga0075434_100052287 3300006871 Bacteria 4059
133 Ga0097620_100059711 3300006931 Bacteria 3842
134 Ga0097620_100643739 3300006931 Bacteria 1152
135 Ga0075435_101485273 3300007076 Bacteria 594
136 Ga0099794_10036497 3300007265 Bacteria 2324
137 Ga0099795_10066421 3300007788 Bacteria 1351
138 Ga0099795_10195859 3300007788 Bacteria 850
139 Ga0105240_10219592 3300009093 Bacteria 2215
140 Ga0105245_10127034 3300009098 Bacteria 2388
141 Ga0105245_10135553 3300009098 Bacteria 2313
142 Ga0105247_10053983 3300009101 Bacteria 2480
143 Ga0114129_10299874 3300009147 Bacteria 2142
144 Ga0114129_12172555 3300009147 Bacteria 668
145 Ga0105243_10238045 3300009148 Bacteria 1618
146 Ga0105241_10021732 3300009174 Bacteria 4746
147 Ga0105241_10105853 3300009174 Bacteria 2244
148 Ga0105241_10214479 3300009174 Bacteria 1614
149 Ga0105241_10245475 3300009174 Bacteria 1516
150 Ga0105242_10183746 3300009176 Bacteria 1846
151 Ga0105242_10185284 3300009176 Bacteria 1839
152 Ga0105248_10014713 3300009177 Bacteria 8612
153 Ga0105248_10205143 3300009177 Bacteria 2221
154 Ga0105248_12379175 3300009177 Bacteria 603
155 Ga0105237_10161469 3300009545 Bacteria 2239
156 Ga0105238_10102900 3300009551 Bacteria 2837
157 Ga0105238_10173314 3300009551 Bacteria 2134
158 Ga0105238_10227478 3300009551 Bacteria 1842
159 Ga0130087_1009019 3300009828 Bacteria 2567
160 Ga0130086_1042090 3300009829 Bacteria 2567
161 Ga0130084_1099686 3300009835 Bacteria 2567
162 Ga0130085_1004078 3300009850 Bacteria 2567
163 Ga0105239_10818264 3300010375 Bacteria 1067
164 Ga0105246_10669295 3300011119 Bacteria 906
165 Ga0157373_10127059 3300013100 Bacteria 1793
166 Ga0157370_10068178 3300013104 Bacteria 3362
167 Ga0157370_10743907 3300013104 Bacteria 894
168 Ga0157370_11346945 3300013104 Bacteria 643
169 Ga0157369_10015329 3300013105 Bacteria 8644
170 Ga0157369_10073974 3300013105 Bacteria 3654
171 Ga0157369_10119612 3300013105 Bacteria 2795
172 Ga0157369_11660327 3300013105 Bacteria 649
173 Ga0157374_10021497 3300013296 Bacteria 5743
174 Ga0157374_10023323 3300013296 Bacteria 5534
175 Ga0157374_10208872 3300013296 Bacteria 1914
176 Ga0157378_10122426 3300013297 Bacteria 2400
177 Ga0157378_10254683 3300013297 Bacteria 1682
178 Ga0163162_10028062 3300013306 Bacteria 5568
179 Ga0163162_11308654 3300013306 Bacteria 823
180 Ga0163162_11335742 3300013306 Bacteria 815
181 Ga0163162_12357584 3300013306 Bacteria 612
182 Ga0157372_10348611 3300013307 Bacteria 1725
183 Ga0157372_10730107 3300013307 Bacteria 1152
184 Ga0157372_10999263 3300013307 Bacteria 969
185 Ga0157375_10653229 3300013308 Bacteria 1208
186 Ga0163163_10006332 3300014325 Bacteria 10334
187 Ga0163163_10089128 3300014325 Bacteria 3097
188 Ga0163163_11093722 3300014325 Bacteria 860
189 Ga0157377_10099091 3300014745 Bacteria 1733
190 Ga0157379_10003428 3300014968 Bacteria 13411
191 Ga0157376_10046574 3300014969 Bacteria 3576
192 Ga0157376_10053389 3300014969 Bacteria 3365
193 Ga0157376_10176993 3300014969 Bacteria 1947
194 Ga0182007_10057715 3300015262 Bacteria 1274
195 Ga0163161_10765149 3300017792 Bacteria 809
196 Ga0184599_143023 3300019188 Bacteria 1867
197 Ga0206356_11111670 3300020070 Bacteria 3892
198 Ga0206356_11767895 3300020070 Bacteria 1997
199 Ga0206349_1309581 3300020075 Bacteria 2527
200 Ga0206355_1033260 3300020076 Bacteria 3863
201 Ga0206355_1504929 3300020076 Bacteria 754
202 Ga0206351_10041000 3300020077 Unclassified 2191
203 Ga0206351_10244372 3300020077 Bacteria 1185
204 Ga0206352_10083412 3300020078 Bacteria 1292
205 Ga0206352_10117557 3300020078 Bacteria 1382
206 Ga0206352_10923535 3300020078 Bacteria 2346
207 Ga0206352_11014774 3300020078 Bacteria 593
208 Ga0206352_11020715 3300020078 Bacteria 1044
209 Ga0206350_10110272 3300020080 Bacteria 1530
210 Ga0206350_10460900 3300020080 Bacteria 4279
211 Ga0206350_11167594 3300020080 Bacteria 940
212 Ga0206354_10016962 3300020081 Unclassified 2006
213 Ga0206353_10859972 3300020082 Bacteria 3301
214 Ga0154015_1058003 3300020610 Bacteria 2665
215 Ga0154015_1639008 3300020610 Bacteria 2355
216 Ga0213874_10009363 3300021377 Bacteria 2420
217 Ga0224712_10003716 3300022467 Bacteria 4013
218 Ga0224712_10016936 3300022467 Bacteria 2406
219 Ga0224712_10037660 3300022467 Bacteria 1801
220 Ga0224712_10235604 3300022467 Bacteria 842
221 Ga0228598_1020853 3300024227 Bacteria 1290
222 Ga0207682_10004563 3300025893 Bacteria 5769
223 Ga0207680_10226623 3300025903 Bacteria 1283
224 Ga0207647_10138988 3300025904 Bacteria 1424
225 Ga0207685_10225233 3300025905 Bacteria 894
226 Ga0207699_10123821 3300025906 Bacteria 1676
227 Ga0207699_10385386 3300025906 Bacteria 996
228 Ga0207699_10743775 3300025906 Bacteria 719
229 Ga0207645_10006628 3300025907 Bacteria 8273
230 Ga0207684_10524801 3300025910 Bacteria 1014
231 Ga0207654_10017393 3300025911 Bacteria 3757
232 Ga0207654_10089742 3300025911 Bacteria 1871
233 Ga0207654_10176044 3300025911 Bacteria 1393
234 Ga0207707_10002024 3300025912 Bacteria 18406
235 Ga0207707_10282339 3300025912 Bacteria 1438
236 Ga0207707_10368445 3300025912 Bacteria 1236
237 Ga0207707_11230041 3300025912 Bacteria 605
238 Ga0207695_10028523 3300025913 Bacteria 6187
239 Ga0207671_10531164 3300025914 Bacteria 938
240 Ga0207693_10000167 3300025915 Bacteria 59536
241 Ga0207693_10128964 3300025915 Bacteria 1988
242 Ga0207663_10007885 3300025916 Bacteria 5552
243 Ga0207663_10645351 3300025916 Bacteria 835
244 Ga0207663_10672773 3300025916 Bacteria 818
245 Ga0207663_10813640 3300025916 Bacteria 744
246 Ga0207660_10001764 3300025917 Bacteria 14475
247 Ga0207660_10058741 3300025917 Bacteria 2759
248 Ga0207657_10000960 3300025919 Bacteria 30511
249 Ga0207657_10394324 3300025919 Bacteria 1089
250 Ga0207649_10110817 3300025920 Bacteria 1833
251 Ga0207652_10007072 3300025921 Bacteria 9043
252 Ga0207652_10464332 3300025921 Bacteria 1141
253 Ga0207646_10092819 3300025922 Bacteria 2702
254 Ga0207646_10114036 3300025922 Bacteria 2427
255 Ga0207646_10122345 3300025922 Bacteria 2338
256 Ga0207646_10154157 3300025922 Bacteria 2072
257 Ga0207646_10251479 3300025922 Bacteria 1597
258 Ga0207646_10600833 3300025922 Bacteria 988
259 Ga0207694_10325881 3300025924 Bacteria 1268
260 Ga0207694_10408480 3300025924 Bacteria 1130
261 Ga0207694_10960858 3300025924 Bacteria 723
262 Ga0207650_10230701 3300025925 Bacteria 1493
263 Ga0207650_10256970 3300025925 Bacteria 1416
264 Ga0207687_10008121 3300025927 Bacteria 6870
265 Ga0207700_10004873 3300025928 Bacteria 7972
266 Ga0207700_10117611 3300025928 Bacteria 2150
267 Ga0207700_10847242 3300025928 Bacteria 818
268 Ga0207700_11065955 3300025928 Bacteria 723
269 Ga0207664_11046919 3300025929 Bacteria 731
270 Ga0207690_10400714 3300025932 Bacteria 1094
271 Ga0207690_11184831 3300025932 Bacteria 638
272 Ga0207706_10000722 3300025933 Bacteria 34504
273 Ga0207686_10053896 3300025934 Bacteria 2517
274 Ga0207686_10118456 3300025934 Bacteria 1798
275 Ga0207704_10122955 3300025938 Bacteria 1780
276 Ga0207665_10049526 3300025939 Bacteria 2823
277 Ga0207665_10517787 3300025939 Bacteria 923
278 Ga0207711_10004740 3300025941 Bacteria 11548
279 Ga0207711_10086242 3300025941 Bacteria 2752
280 Ga0207711_11523655 3300025941 Bacteria 612
281 Ga0207689_10037230 3300025942 Bacteria 4036
282 Ga0207661_10086090 3300025944 Bacteria 2607
283 Ga0207661_10130898 3300025944 Bacteria 2149
284 Ga0207661_10527230 3300025944 Bacteria 1081
285 Ga0207679_10007143 3300025945 Bacteria 7073
286 Ga0207667_10055605 3300025949 Bacteria 4160
287 Ga0207667_10146623 3300025949 Bacteria 2430
288 Ga0207651_11268849 3300025960 Bacteria 662
289 Ga0207712_10130107 3300025961 Bacteria 1917
290 Ga0207668_10305455 3300025972 Bacteria 1314
291 Ga0207640_10017073 3300025981 Bacteria 4239
292 Ga0207640_10864571 3300025981 Bacteria 788
293 Ga0207658_10120690 3300025986 Bacteria 2089
294 Ga0207677_10026728 3300026023 Bacteria 3624
295 Ga0207703_10150934 3300026035 Bacteria 2026
296 Ga0207703_10179347 3300026035 Bacteria 1868
297 Ga0207703_10671347 3300026035 Bacteria 984
298 Ga0207639_10195927 3300026041 Bacteria 1729
299 Ga0207678_10000405 3300026067 Bacteria 39009
300 Ga0207678_10605823 3300026067 Bacteria 960
301 Ga0207702_10083866 3300026078 Bacteria 2773
302 Ga0207641_10017791 3300026088 Bacteria 5823
303 Ga0207641_10447261 3300026088 Bacteria 1248
304 Ga0207641_10773673 3300026088 Bacteria 948
305 Ga0207648_10041525 3300026089 Bacteria 4038
306 Ga0207676_10051552 3300026095 Bacteria 3213
307 Ga0207676_11294934 3300026095 Bacteria 723
308 Ga0207674_10004549 3300026116 Bacteria 16660
309 Ga0207674_10075528 3300026116 Bacteria 3379
310 Ga0207683_10188181 3300026121 Bacteria 1873
311 Ga0207698_10034173 3300026142 Bacteria 3703
312 Ga0207698_10230594 3300026142 Bacteria 1681
313 Ga0209179_1033669 3300027512 Bacteria 1060
314 Ga0265354_1027082 3300028016 Bacteria 551
315 Ga0268266_11067999 3300028379 Bacteria 781
316 Ga0268265_10032907 3300028380 Bacteria 3763
317 Ga0268264_10297950 3300028381 Bacteria 1517
318 Ga0268264_11484943 3300028381 Bacteria 688
319 Ga0268264_11873723 3300028381 Bacteria 609
320 Ga0265338_10004422 3300028800 Bacteria 18997
321 Ga0265770_1017502 3300030878 Bacteria 1109
322 Ga0265764_103237 3300030882 Bacteria 838
323 Ga0265760_10000603 3300031090 Bacteria 10223
324 Ga0265760_10032855 3300031090 Bacteria 1533
325 Ga0265340_10069302 3300031247 Bacteria 1674
326 Ga0265340_10121850 3300031247 Bacteria 1200
327 Ga0265339_10007342 3300031249 Bacteria 7137
328 Ga0265339_10203610 3300031249 Bacteria 975
329 Ga0265316_10001955 3300031344 Bacteria 21656
330 Ga0265316_10026205 3300031344 Bacteria 4855
331 Ga0307408_100059521 3300031548 Bacteria 2780
332 Ga0307408_100190661 3300031548 Bacteria 1651
333 Ga0307408_100300551 3300031548 Bacteria 1344
334 Ga0265314_10055629 3300031711 Bacteria 2729
335 Ga0265314_10319984 3300031711 Bacteria 863
336 Ga0265314_10522636 3300031711 Bacteria 621
337 Ga0265342_10321331 3300031712 Bacteria 811
338 Ga0307413_10039800 3300031824 Bacteria 2737
339 Ga0307410_10021057 3300031852 Bacteria 4004
340 Ga0307410_10212132 3300031852 Bacteria 1484
341 Ga0307406_10150530 3300031901 Bacteria 1659
342 Ga0307406_11712637 3300031901 Bacteria 557
343 Ga0307407_10630667 3300031903 Bacteria 801
344 Ga0307412_10212820 3300031911 Bacteria 1476
345 Ga0307412_10260321 3300031911 Bacteria 1352
346 Ga0307409_100021755 3300031995 Bacteria 4405
347 Ga0307409_100090887 3300031995 Bacteria 2500
348 Ga0307416_100061596 3300032002 Bacteria 3063
349 Ga0307416_100408970 3300032002 Bacteria 1397
350 Ga0307414_10203587 3300032004 Bacteria 1612
351 Ga0307411_10042552 3300032005 Bacteria 2899
352 Ga0307415_100021643 3300032126 Bacteria 3957
353 Ga0307415_100289637 3300032126 Bacteria 1351
354 Ga0373958_0005868 3300034819 Bacteria 1889
355 Ga0373959_0221614 3300034820 Bacteria 507
356 Ga0373928_0020764 3300035084 Bacteria 1379
357 Ga0373940_0007294 3300035088 Bacteria 2490
358 Ga0373951_0012931 3300035091 Bacteria 1877
359 Ga0373932_0009942 3300035112 Bacteria 2295
360 Ga0373939_0011108 3300035114 Bacteria 2265
361 Ga0373955_0479782 3300035172 Bacteria 759
362 Ga0373942_0034028 3300035207 Bacteria 1362
363 Ga0373931_0074891 3300035691 Bacteria 1855
364 Ga0373931_0185153 3300035691 Bacteria 1235
365 Ga0373935_0086742 3300035692 Bacteria 2043
366 Ga0373927_0382556 3300035695 Bacteria 928
367 Ga0373947_0293065 3300035725 Bacteria 1084
368 Ga0373937_0120983 3300036401 Bacteria 2440
369 Ga0373925_0185231 3300037068 Bacteria 1650
370 Ga0373925_0355672 3300037068 Bacteria 1190
371 Ga0395900_0873171 3300037418 Bacteria 824
372 Ga0395898_1185278 3300037466 Bacteria 695
373 Ga0436363_0093025 3300039450 Bacteria 3654
374 Ga0436363_0520110 3300039450 Bacteria 5837
375 Ga0436363_0610407 3300039450 Bacteria 617
376 Ga0436362_0902448 3300039453 Bacteria 2268
377 Ga0451577_0000334 3300042876 Bacteria 87832
378 Ga0451577_0982168 3300042876 Bacteria 759
379 Ga0453683_0230962 3300044673 Bacteria 1178
380 Ga0466966_0285008 3300044684 Bacteria 993
381 Ga0466963_0000507 3300044694 Bacteria 18164
382 Ga0466963_0068583 3300044694 Bacteria 2382
383 Ga0466963_0623426 3300044694 Bacteria 761
384 Ga0453684_0008433 3300044712 Bacteria 18456
385 Ga0453684_0263301 3300044712 Bacteria 1974
386 Ga0466971_0206126 3300044719 Bacteria 929
387 Ga0466970_0828841 3300044765 Bacteria 542
388 Ga0466959_0450871 3300045049 Bacteria 872
389 Ga0451576_0023421 3300045051 Bacteria 6684
390 Ga0451576_0412615 3300045051 Bacteria 1416
391 Ga0451576_0703597 3300045051 Bacteria 1062
392 Ga0451576_2412108 3300045051 Bacteria 538
393 Ga0466967_0000482 3300045976 Bacteria 19325
394 Ga0466967_0001078 3300045976 Bacteria 15096
395 Ga0466967_0469693 3300045976 Bacteria 1231
396 Ga0495651_0024891 3300046462 Bacteria 4657
397 Ga0495580_0009023 3300046472 Bacteria 7873
398 Ga0495580_0011562 3300046472 Bacteria 6827
399 Ga0495580_0081875 3300046472 Bacteria 2250
400 Ga0495580_0244798 3300046472 Bacteria 1229
401 Ga0495580_0248093 3300046472 Bacteria 1219
402 Ga0495580_0726679 3300046472 Bacteria 648
403 Ga0495582_0479636 3300046473 Bacteria 719
404 Ga0495605_0383249 3300046474 Bacteria 586
405 Ga0495639_0067291 3300046475 Bacteria 1650
406 Ga0495664_0054219 3300046477 Bacteria 2384
407 Ga0495594_0017210 3300046499 Bacteria 3817
408 Ga0495642_0018965 3300046528 Bacteria 2694
409 Ga0495642_0308669 3300046528 Bacteria 694
410 Ga0495652_0348804 3300046529 Bacteria 1061
411 Ga0495665_0324087 3300046531 Bacteria 787
412 Ga0495586_0083059 3300046535 Bacteria 1762
413 Ga0495587_0015500 3300046536 Bacteria 4759
414 Ga0495645_0591801 3300046543 Bacteria 683
415 Ga0495635_0127766 3300046663 Bacteria 1733
416 Ga0495588_0040555 3300046674 Bacteria 2375
417 Ga0495657_0126583 3300046675 Bacteria 1604
418 Ga0495623_0024297 3300046679 Bacteria 3905
419 Ga0495646_0092258 3300046680 Bacteria 1747
420 Ga0495658_0486878 3300046683 Bacteria 789
421 Ga0495669_0033005 3300046684 Bacteria 2277
422 Ga0495669_0102046 3300046684 Bacteria 1333
423 Ga0495669_0116132 3300046684 Bacteria 1252
424 Ga0495600_0462529 3300046809 Bacteria 783
425 Ga0495604_0068862 3300047317 Bacteria 2684
426 Ga0495636_0037805 3300047318 Bacteria 1994
427 Ga0495675_0027619 3300047444 Bacteria 3616
428 Ga0495675_0111378 3300047444 Bacteria 1708
429 Ga0495677_0035427 3300047445 Bacteria 1821
430 Ga0495677_0052941 3300047445 Bacteria 1496
431 Ga0495677_0216037 3300047445 Bacteria 747
432 Ga0495602_0043889 3300048088 Bacteria 4059
433 Ga0495602_0293689 3300048088 Bacteria 1192
434 Ga0495602_1090406 3300048088 Bacteria 524
435 Ga0496100_0110675 3300048903 Bacteria 1907
436 Ga0496101_0478940 3300048904 Bacteria 983
437 Ga0496101_0492668 3300048904 Bacteria 968
438 Ga0496101_0832851 3300048904 Bacteria 727
439 Ga0496101_0887022 3300048904 Bacteria 702
440 Ga0496102_0000542 3300048905 Bacteria 40767
441 Ga0496102_0083645 3300048905 Bacteria 2944
442 Ga0496102_0550263 3300048905 Bacteria 1077
443 Ga0496103_0005309 3300048906 Bacteria 7729
444 Ga0496103_0135413 3300048906 Bacteria 1574
445 Ga0496104_0011286 3300048907 Bacteria 7997
446 Ga0496104_1511207 3300048907 Bacteria 574
447 Ga0496105_0170668 3300048908 Bacteria 1783
448 Ga0496105_0182083 3300048908 Bacteria 1720
449 Ga0496105_0764787 3300048908 Bacteria 737
450 Ga0496106_0002436 3300048909 Bacteria 13863
451 Ga0496106_0083372 3300048909 Bacteria 2458
452 Ga0496106_0469102 3300048909 Bacteria 1011
453 Ga0496106_0518285 3300048909 Bacteria 957
454 Ga0496107_0022567 3300048910 Bacteria 4447
455 Ga0496107_0064286 3300048910 Bacteria 2660
456 Ga0496107_0113052 3300048910 Bacteria 1997
457 Ga0496108_0018858 3300048911 Bacteria 5657
458 Ga0496109_0008953 3300048912 Bacteria 8527
459 Ga0496110_0255744 3300048913 Bacteria 1594
460 Ga0496112_0023278 3300048915 Bacteria 5915
461 Ga0496112_0026037 3300048915 Bacteria 5623
462 Ga0496112_0116371 3300048915 Bacteria 2644
463 Ga0496113_0010832 3300048916 Bacteria 6051
464 Ga0496113_0625749 3300048916 Bacteria 861
465 Ga0496113_0852700 3300048916 Bacteria 722
466 Ga0496114_0128172 3300048917 Bacteria 2189
467 Ga0496115_0078444 3300048918 Bacteria 2687
468 Ga0496115_0080776 3300048918 Bacteria 2647
469 Ga0501309_009120 3300049129 Bacteria 1261
470 Ga0501309_050583 3300049129 Bacteria 652
471 Ga0501296_027799 3300049519 Bacteria 750
472 Ga0501298_004510 3300049521 Bacteria 2197
473 Ga0501301_001736 3300049524 Bacteria 1401
474 Ga0501312_011401 3300049528 Bacteria 1207
475 Ga0501315_051788 3300049531 Bacteria 646
476 Ga0501322_025186 3300049538 Bacteria 541
477 Ga0501323_045979 3300049539 Bacteria 652
478 Ga0501250_008145 3300049680 Bacteria 1149
479 Ga0501219_004613 3300049703 Bacteria 980
480 Ga0501262_037769 3300049759 Bacteria 713
481 Ga0501264_013068 3300049761 Bacteria 820
482 Ga0501283_007056 3300049779 Bacteria 1589
483 nmdc:mga05p37_153003_c1 3300050507 Bacteria 2820
484 nmdc:mga0n895_1572502_c1 3300050512 Unclassified 622
485 nmdc:mga0n895_177120_c1 3300050512 Bacteria 2163
486 nmdc:mga0rr50_563778_c1 3300050513 Bacteria 970
487 nmdc:mga08x19_646768_c1 3300050514 Bacteria 750
488 Ga0495601_0013512 3300053077 Bacteria 4912
489 Ga0495619_0470243 3300053085 Bacteria 866
490 Ga0587084_001016 3300059477 Bacteria 2515
491 Ga0587084_001537 3300059477 Bacteria 2208
492 Ga0587093_001238 3300059478 Bacteria 2102
493 Ga0587093_001790 3300059478 Bacteria 1889
494 Ga0587093_008833 3300059478 Unclassified 1158
495 Ga0587093_048089 3300059478 Bacteria 666
496 Ga0587066_000264 3300059490 Bacteria 3787
497 Ga0587066_000648 3300059490 Bacteria 3000
498 Ga0587066_002554 3300059490 Bacteria 2025
499 Ga0587066_068984 3300059490 Bacteria 740
500 Ga0587066_103529 3300059490 Bacteria 650
501 Ga0587066_197228 3300059490 Bacteria 528
502 Ga0587070_000083 3300059491 Bacteria 5057
503 Ga0587070_000730 3300059491 Bacteria 2982
504 Ga0587070_005606 3300059491 Bacteria 1653
505 Ga0587070_006903 3300059491 Bacteria 1553
506 Ga0587070_029447 3300059491 Bacteria 985
507 Ga0587070_081795 3300059491 Bacteria 710
508 Ga0587073_0000387 3300059492 Bacteria 3844
509 Ga0587073_0000996 3300059492 Bacteria 3049
510 Ga0587073_0006328 3300059492 Bacteria 1814
511 Ga0587073_0061844 3300059492 Bacteria 881
512 Ga0587073_0097626 3300059492 Bacteria 758
513 Ga0587077_000458 3300059493 Bacteria 3500
514 Ga0587077_000534 3300059493 Bacteria 3333
515 Ga0587077_000736 3300059493 Bacteria 3082
516 Ga0587077_009478 3300059493 Bacteria 1479
517 Ga0587080_000483 3300059503 Bacteria 3415
518 Ga0587080_000831 3300059503 Bacteria 2997
519 Ga0587080_003723 3300059503 Bacteria 1924
520 Ga0587080_058673 3300059503 Bacteria 744
521 Ga0587080_064834 3300059503 Bacteria 719
522 Ga0587082_000726 3300059504 Bacteria 2995
523 Ga0587082_002306 3300059504 Bacteria 2136
524 Ga0587082_002722 3300059504 Unclassified 2037
525 Ga0587082_019383 3300059504 Bacteria 1092
526 Ga0587082_031964 3300059504 Bacteria 922
527 Ga0587082_057975 3300059504 Bacteria 756
528 Ga0587083_0000344 3300059505 Bacteria 3850
529 Ga0587083_0000832 3300059505 Bacteria 3108
530 Ga0587083_0000939 3300059505 Bacteria 3001
531 Ga0587083_0179684 3300059505 Bacteria 591
532 Ga0587085_001718 3300059506 Bacteria 2097
533 Ga0587085_001930 3300059506 Bacteria 2036
534 Ga0587085_002130 3300059506 Bacteria 1980
535 Ga0587086_000457 3300059507 Bacteria 2929
536 Ga0587086_007022 3300059507 Bacteria 1278
537 Ga0587086_009056 3300059507 Bacteria 1177
538 Ga0587086_054834 3300059507 Bacteria 651
539 Ga0587088_000405 3300059508 Bacteria 3442
540 Ga0587088_000724 3300059508 Bacteria 2984
541 Ga0587088_028836 3300059508 Bacteria 979
542 Ga0587089_000555 3300059509 Bacteria 2954
543 Ga0587089_000606 3300059509 Bacteria 2888
544 Ga0587089_004330 3300059509 Bacteria 1562
545 Ga0587090_000697 3300059510 Bacteria 2984
546 Ga0587090_001174 3300059510 Bacteria 2575
547 Ga0587091_000292 3300059511 Bacteria 3883
548 Ga0587091_000829 3300059511 Bacteria 2998
549 Ga0587091_008751 3300059511 Bacteria 1504
550 Ga0587092_000544 3300059512 Bacteria 3100
551 Ga0587092_001026 3300059512 Bacteria 2576
552 Ga0587092_007702 3300059512 Bacteria 1405
553 Ga0587092_050012 3300059512 Bacteria 754
554 Ga0587094_000193 3300059513 Bacteria 3900
555 Ga0587094_000549 3300059513 Bacteria 3020
556 Ga0587094_018357 3300059513 Bacteria 994
557 Ga0587094_064942 3300059513 Bacteria 646
558 Ga0587095_000146 3300059514 Bacteria 2978
559 Ga0587095_000251 3300059514 Bacteria 2552
560 Ga0587098_001679 3300059604 Bacteria 1750
561 Ga0587098_002341 3300059604 Bacteria 1589
562 Ga0587106_000670 3300059605 Bacteria 2589
563 Ga0587106_000874 3300059605 Bacteria 2415
564 Ga0587121_00314 3300059606 Bacteria 1914
565 Ga0587121_01118 3300059606 Bacteria 1289
566 Ga0587125_000216 3300059607 Bacteria 2897
567 Ga0587129_000319 3300059608 Bacteria 2049
568 Ga0587129_003477 3300059608 Unclassified 992
569 Ga0587131_001039 3300059609 Bacteria 1283
570 Ga0587099_000150 3300059622 Bacteria 3136
571 Ga0587099_000360 3300059622 Bacteria 2513
572 Ga0587101_000343 3300059623 Bacteria 3099
573 Ga0587101_001173 3300059623 Bacteria 2173
574 Ga0587101_002055 3300059623 Bacteria 1858
575 Ga0587109_003000 3300059624 Bacteria 2207
576 Ga0587109_004251 3300059624 Bacteria 1972
577 Ga0587109_037426 3300059624 Unclassified 948
578 Ga0587109_179915 3300059624 Bacteria 540
579 Ga0587113_000217 3300059625 Bacteria 2676
580 Ga0587113_000231 3300059625 Bacteria 2642
581 Ga0587115_000520 3300059626 Bacteria 2901
582 Ga0587115_001557 3300059626 Bacteria 2130
583 Ga0587115_006598 3300059626 Bacteria 1344
584 Ga0587117_000669 3300059627 Bacteria 2487
585 Ga0587117_001914 3300059627 Unclassified 1859
586 Ga0587117_008659 3300059627 Bacteria 1199
587 Ga0587117_027540 3300059627 Bacteria 836
588 Ga0587122_002680 3300059628 Bacteria 1309
589 Ga0587128_000173 3300059630 Bacteria 3764
590 Ga0587128_000403 3300059630 Bacteria 3124
591 Ga0587128_052517 3300059630 Bacteria 748
592 Ga0587130_000397 3300059631 Bacteria 2661
593 Ga0587062_000435 3300059639 Bacteria 2912
594 Ga0587062_001270 3300059639 Bacteria 2124
595 Ga0587062_002033 3300059639 Bacteria 1871
596 Ga0587067_000857 3300059640 Bacteria 3002
597 Ga0587067_000867 3300059640 Bacteria 2987
598 Ga0587067_133820 3300059640 Bacteria 608
599 Ga0587067_197993 3300059640 Bacteria 532
600 Ga0587068_001518 3300059641 Bacteria 2633
601 Ga0587068_002659 3300059641 Bacteria 2195
602 Ga0587068_008296 3300059641 Bacteria 1501
603 Ga0587068_140295 3300059641 Bacteria 539
604 Ga0587069_000484 3300059642 Bacteria 3001
605 Ga0587069_000551 3300059642 Bacteria 2892
606 Ga0587069_002888 3300059642 Bacteria 1796
607 Ga0587069_039067 3300059642 Bacteria 802
608 Ga0587072_000714 3300059643 Bacteria 3611
609 Ga0587072_000814 3300059643 Bacteria 3489
610 Ga0587072_006463 3300059643 Bacteria 1787
611 Ga0587075_000193 3300059644 Bacteria 3983
612 Ga0587075_000467 3300059644 Bacteria 3225
613 Ga0587075_028173 3300059644 Unclassified 879
614 Ga0587075_053285 3300059644 Bacteria 712
615 Ga0587076_000702 3300059645 Bacteria 2964
616 Ga0587076_000878 3300059645 Bacteria 2795
617 Ga0587076_004977 3300059645 Bacteria 1694
618 Ga0587076_043645 3300059645 Bacteria 848
619 Ga0587076_081228 3300059645 Bacteria 692
620 Ga0587076_138650 3300059645 Bacteria 580
621 Ga0587078_000283 3300059646 Bacteria 3527
622 Ga0587078_000347 3300059646 Bacteria 3305
623 Ga0587078_001649 3300059646 Bacteria 2045
624 Ga0587079_000372 3300059647 Bacteria 3770
625 Ga0587079_000962 3300059647 Bacteria 2971
626 Ga0587079_058807 3300059647 Bacteria 828
627 Ga0587079_179585 3300059647 Bacteria 565
628 Ga0587100_006515 3300059648 Unclassified 900
629 Ga0587100_033612 3300059648 Bacteria 554
630 Ga0587102_000803 3300059649 Bacteria 1968
631 Ga0587102_001284 3300059649 Bacteria 1725
632 Ga0587104_013313 3300059650 Bacteria 631
633 Ga0587105_000140 3300059651 Bacteria 2295
634 Ga0587105_000179 3300059651 Bacteria 2170
635 Ga0587107_000249 3300059652 Bacteria 3197
636 Ga0587107_000305 3300059652 Bacteria 2978
637 Ga0587107_001944 3300059652 Bacteria 1779
638 Ga0587110_000736 3300059654 Bacteria 2084
639 Ga0587114_000090 3300059655 Bacteria 4089
640 Ga0587114_000331 3300059655 Bacteria 2981
641 Ga0587116_00549 3300059656 Bacteria 1530
642 Ga0587116_08039 3300059656 Unclassified 677
643 Ga0587119_000375 3300059658 Bacteria 2818
644 Ga0587119_000542 3300059658 Bacteria 2557
645 Ga0587120_000153 3300059659 Bacteria 2819
646 Ga0587124_000640 3300059660 Bacteria 2001
647 Ga0587060_000132 3300060243 Bacteria 3141
648 Ga0587060_000161 3300060243 Bacteria 2948
649 Ga0587065_09689 3300060245 Bacteria 602
650 Ga0587081_08225 3300060246 Bacteria 726
651 Ga0587081_21553 3300060246 Unclassified 512
652 Ga0587096_03035 3300060247 Bacteria 660
653 Ga0587071_000665 3300060344 Bacteria 3658
654 Ga0587071_001295 3300060344 Bacteria 3061
655 Ga0587071_096739 3300060344 Bacteria 678
656 Ga0587111_0009130 3300060346 Bacteria 1663
657 Ga0587111_0028020 3300060346 Bacteria 1132
658 Ga0070706_100122879
659 Ga0032354_1060940
660 Ga0032354_1119552
661 Ga0058859_11468909
662 Ga0058863_10085382
663 Ga0058863_11564836
664 Ga0058863_11661751
665 Ga0058863_11965722
666 Ga0058861_10011078
667 Ga0058861_10027511
668 Ga0058861_10092036
669 Ga0058861_11931524
670 Ga0058861_11950001
671 Ga0058862_10273100
672 Ga0058862_12546538
673 Ga0058862_12847660
674 Ga0065715_10137834
675 Ga0065715_10201958
676 Ga0070683_100044689
677 Ga0070683_100285785
678 Ga0070690_100024222
679 Ga0070670_100621292
680 Ga0070677_10437851
681 Ga0070666_10023589
682 Ga0070666_10072906
683 Ga0070666_10210942
684 Ga0070680_100084366
685 Ga0070682_100047174
686 Ga0068868_100008261
687 Ga0070660_100272666
688 Ga0070691_10012010
689 Ga0070661_100083047
690 Ga0070668_100032413
691 Ga0070671_100131598
692 Ga0070688_100156275
693 Ga0070659_100148355
694 Ga0070659_100370666
695 Ga0070667_100053885
696 Ga0070709_10140461
697 Ga0070709_10412386
698 Ga0070709_10478158
699 Ga0070714_100810560
700 Ga0070713_100002212
701 Ga0070713_100140199
702 Ga0070713_100289079
703 Ga0070710_10702812
704 Ga0070710_11213317
705 Ga0070711_100001903
706 Ga0070711_100346800
707 Ga0070711_100653660
708 Ga0070694_100899271
709 Ga0070708_100023165
710 Ga0070708_100302655
711 Ga0070663_100872292
712 Ga0070662_100000606
713 Ga0070681_10015841
714 Ga0070681_10267063
715 Ga0070681_10452929
716 Ga0070681_10454838
717 Ga0070681_11084210
718 Ga0068867_100163197
719 Ga0070707_100059458
720 Ga0070707_100064678
721 Ga0070707_100217955
722 Ga0070707_100380276
723 Ga0070707_100558845
724 Ga0070698_100576988
725 Ga0070699_100231248
726 Ga0070699_100281884
727 Ga0070699_100784341
728 Ga0070679_100000387
729 Ga0070679_100156601
730 Ga0070679_100604458
731 Ga0070679_100915222
732 Ga0070684_100373412
733 Ga0070697_100000248
734 Ga0070697_100004367
735 Ga0070697_100137022
736 Ga0070697_100153825
737 Ga0070697_100470386
738 Ga0068853_100082078
739 Ga0070686_100039502
740 Ga0070695_100012346
741 Ga0070696_100027344
742 Ga0070696_100659453
743 Ga0070693_100251399
744 Ga0070665_100050106
745 Ga0068855_100034160
746 Ga0068855_100056717
747 Ga0070664_100045792
748 Ga0070664_100248615
749 Ga0070664_100776389
750 Ga0068857_100049425
751 Ga0068857_100229524
752 Ga0068854_100882490
753 Ga0068856_100022439
754 Ga0068856_100042241
755 Ga0070702_100670526
756 Ga0068852_100080610
757 Ga0068852_100262538
758 Ga0068859_100059710
759 Ga0068859_100643603
760 Ga0068864_100004773
761 Ga0068864_100185345
762 Ga0068864_100368909
763 Ga0068866_10105459
764 Ga0068861_100216680
765 Ga0068851_10043424
766 Ga0068863_100006045
767 Ga0068863_100025938
768 Ga0068863_100106247
769 Ga0068858_100146282
770 Ga0068858_100376611
771 Ga0068860_100010738
772 Ga0068860_100398011
773 Ga0068860_100515025
774 Ga0068860_100776390
775 Ga0068862_100011606
776 Ga0081540_1011878
777 Ga0070717_10149562
778 Ga0070717_10414714
779 Ga0070715_10217134
780 Ga0070715_10236272
781 Ga0070716_100033276
782 Ga0070716_100579590
783 Ga0070712_100000655
784 Ga0070712_100108954
785 Ga0097621_100052507
786 Ga0097621_100803718
787 Ga0068871_100003051
788 Ga0068871_100189955
789 Ga0075434_100052287
790 Ga0097620_100059711
791 Ga0097620_100643739
792 Ga0075435_101485273
793 Ga0099794_10036497
794 Ga0099795_10066421
795 Ga0099795_10195859
796 Ga0105240_10219592
797 Ga0105245_10127034
798 Ga0105245_10135553
799 Ga0105247_10053983
800 Ga0114129_10299874
801 Ga0114129_12172555
802 Ga0105243_10238045
803 Ga0105241_10021732
804 Ga0105241_10105853
805 Ga0105241_10214479
806 Ga0105241_10245475
807 Ga0105242_10183746
808 Ga0105242_10185284
809 Ga0105248_10014713
810 Ga0105248_10205143
811 Ga0105248_12379175
812 Ga0105237_10161469
813 Ga0105238_10102900
814 Ga0105238_10173314
815 Ga0105238_10227478
816 Ga0130087_1009019
817 Ga0130086_1042090
818 Ga0130084_1099686
819 Ga0130085_1004078
820 Ga0105239_10818264
821 Ga0105246_10669295
822 Ga0157373_10127059
823 Ga0157370_10068178
824 Ga0157370_10743907
825 Ga0157370_11346945
826 Ga0157369_10015329
827 Ga0157369_10073974
828 Ga0157369_10119612
829 Ga0157369_11660327
830 Ga0157374_10021497
831 Ga0157374_10023323
832 Ga0157374_10208872
833 Ga0157378_10122426
834 Ga0157378_10254683
835 Ga0163162_10028062
836 Ga0163162_11308654
837 Ga0163162_11335742
838 Ga0163162_12357584
839 Ga0157372_10348611
840 Ga0157372_10730107
841 Ga0157372_10999263
842 Ga0157375_10653229
843 Ga0163163_10006332
844 Ga0163163_10089128
845 Ga0163163_11093722
846 Ga0157377_10099091
847 Ga0157379_10003428
848 Ga0157376_10046574
849 Ga0157376_10053389
850 Ga0157376_10176993
851 Ga0182007_10057715
852 Ga0163161_10765149
853 Ga0184599_143023
854 Ga0206356_11111670
855 Ga0206356_11767895
856 Ga0206349_1309581
857 Ga0206355_1033260
858 Ga0206355_1504929
859 Ga0206351_10041000
860 Ga0206351_10244372
861 Ga0206352_10083412
862 Ga0206352_10117557
863 Ga0206352_10923535
864 Ga0206352_11014774
865 Ga0206352_11020715
866 Ga0206350_10110272
867 Ga0206350_10460900
868 Ga0206350_11167594
869 Ga0206354_10016962
870 Ga0206353_10859972
871 Ga0154015_1058003
872 Ga0154015_1639008
873 Ga0213874_10009363
874 Ga0224712_10003716
875 Ga0224712_10016936
876 Ga0224712_10037660
877 Ga0224712_10235604
878 Ga0228598_1020853
879 Ga0207682_10004563
880 Ga0207680_10226623
881 Ga0207647_10138988
882 Ga0207685_10225233
883 Ga0207699_10123821
884 Ga0207699_10385386
885 Ga0207699_10743775
886 Ga0207645_10006628
887 Ga0207684_10524801
888 Ga0207654_10017393
889 Ga0207654_10089742
890 Ga0207654_10176044
891 Ga0207707_10002024
892 Ga0207707_10282339
893 Ga0207707_10368445
894 Ga0207707_11230041
895 Ga0207695_10028523
896 Ga0207671_10531164
897 Ga0207693_10000167
898 Ga0207693_10128964
899 Ga0207663_10007885
900 Ga0207663_10645351
901 Ga0207663_10672773
902 Ga0207663_10813640
903 Ga0207660_10001764
904 Ga0207660_10058741
905 Ga0207657_10000960
906 Ga0207657_10394324
907 Ga0207649_10110817
908 Ga0207652_10007072
909 Ga0207652_10464332
910 Ga0207646_10092819
911 Ga0207646_10114036
912 Ga0207646_10122345
913 Ga0207646_10154157
914 Ga0207646_10251479
915 Ga0207646_10600833
916 Ga0207694_10325881
917 Ga0207694_10408480
918 Ga0207694_10960858
919 Ga0207650_10230701
920 Ga0207650_10256970
921 Ga0207687_10008121
922 Ga0207700_10004873
923 Ga0207700_10117611
924 Ga0207700_10847242
925 Ga0207700_11065955
926 Ga0207664_11046919
927 Ga0207690_10400714
928 Ga0207690_11184831
929 Ga0207706_10000722
930 Ga0207686_10053896
931 Ga0207686_10118456
932 Ga0207704_10122955
933 Ga0207665_10049526
934 Ga0207665_10517787
935 Ga0207711_10004740
936 Ga0207711_10086242
937 Ga0207711_11523655
938 Ga0207689_10037230
939 Ga0207661_10086090
940 Ga0207661_10130898
941 Ga0207661_10527230
942 Ga0207679_10007143
943 Ga0207667_10055605
944 Ga0207667_10146623
945 Ga0207651_11268849
946 Ga0207712_10130107
947 Ga0207668_10305455
948 Ga0207640_10017073
949 Ga0207640_10864571
950 Ga0207658_10120690
951 Ga0207677_10026728
952 Ga0207703_10150934
953 Ga0207703_10179347
954 Ga0207703_10671347
955 Ga0207639_10195927
956 Ga0207678_10000405
957 Ga0207678_10605823
958 Ga0207702_10083866
959 Ga0207641_10017791
960 Ga0207641_10447261
961 Ga0207641_10773673
962 Ga0207648_10041525
963 Ga0207676_10051552
964 Ga0207676_11294934
965 Ga0207674_10004549
966 Ga0207674_10075528
967 Ga0207683_10188181
968 Ga0207698_10034173
969 Ga0207698_10230594
970 Ga0209179_1033669
971 Ga0265354_1027082
972 Ga0268266_11067999
973 Ga0268265_10032907
974 Ga0268264_10297950
975 Ga0268264_11484943
976 Ga0268264_11873723
977 Ga0265338_10004422
978 Ga0265770_1017502
979 Ga0265764_103237
980 Ga0265760_10000603
981 Ga0265760_10032855
982 Ga0265340_10069302
983 Ga0265340_10121850
984 Ga0265339_10007342
985 Ga0265339_10203610
986 Ga0265316_10001955
987 Ga0265316_10026205
988 Ga0307408_100059521
989 Ga0307408_100190661
990 Ga0307408_100300551
991 Ga0265314_10055629
992 Ga0265314_10319984
993 Ga0265314_10522636
994 Ga0265342_10321331
995 Ga0307413_10039800
996 Ga0307410_10021057
997 Ga0307410_10212132
998 Ga0307406_10150530
999 Ga0307406_11712637
1000 Ga0307407_10630667
1001 Ga0307412_10212820
1002 Ga0307412_10260321
1003 Ga0307409_100021755
1004 Ga0307409_100090887
1005 Ga0307416_100061596
1006 Ga0307416_100408970
1007 Ga0307414_10203587
1008 Ga0307411_10042552
1009 Ga0307415_100021643
1010 Ga0307415_100289637
1011 Ga0373958_0005868
1012 Ga0373959_0221614
1013 Ga0373928_0020764
1014 Ga0373940_0007294
1015 Ga0373951_0012931
1016 Ga0373932_0009942
1017 Ga0373939_0011108
1018 Ga0373955_0479782
1019 Ga0373942_0034028
1020 Ga0373931_0074891
1021 Ga0373931_0185153
1022 Ga0373935_0086742
1023 Ga0373927_0382556
1024 Ga0373947_0293065
1025 Ga0373937_0120983
1026 Ga0373925_0185231
1027 Ga0373925_0355672
1028 Ga0395900_0873171
1029 Ga0395898_1185278
1030 Ga0436363_0093025
1031 Ga0436363_0520110
1032 Ga0436363_0610407
1033 Ga0436362_0902448
1034 Ga0451577_0000334
1035 Ga0451577_0982168
1036 Ga0453683_0230962
1037 Ga0466966_0285008
1038 Ga0466963_0000507
1039 Ga0466963_0068583
1040 Ga0466963_0623426
1041 Ga0453684_0008433
1042 Ga0453684_0263301
1043 Ga0466971_0206126
1044 Ga0466970_0828841
1045 Ga0466959_0450871
1046 Ga0451576_0023421
1047 Ga0451576_0412615
1048 Ga0451576_0703597
1049 Ga0451576_2412108
1050 Ga0466967_0000482
1051 Ga0466967_0001078
1052 Ga0466967_0469693
1053 Ga0495651_0024891
1054 Ga0495580_0009023
1055 Ga0495580_0011562
1056 Ga0495580_0081875
1057 Ga0495580_0244798
1058 Ga0495580_0248093
1059 Ga0495580_0726679
1060 Ga0495582_0479636
1061 Ga0495605_0383249
1062 Ga0495639_0067291
1063 Ga0495664_0054219
1064 Ga0495594_0017210
1065 Ga0495642_0018965
1066 Ga0495642_0308669
1067 Ga0495652_0348804
1068 Ga0495665_0324087
1069 Ga0495586_0083059
1070 Ga0495587_0015500
1071 Ga0495645_0591801
1072 Ga0495635_0127766
1073 Ga0495588_0040555
1074 Ga0495657_0126583
1075 Ga0495623_0024297
1076 Ga0495646_0092258
1077 Ga0495658_0486878
1078 Ga0495669_0033005
1079 Ga0495669_0102046
1080 Ga0495669_0116132
1081 Ga0495600_0462529
1082 Ga0495604_0068862
1083 Ga0495636_0037805
1084 Ga0495675_0027619
1085 Ga0495675_0111378
1086 Ga0495677_0035427
1087 Ga0495677_0052941
1088 Ga0495677_0216037
1089 Ga0495602_0043889
1090 Ga0495602_0293689
1091 Ga0495602_1090406
1092 Ga0496100_0110675
1093 Ga0496101_0478940
1094 Ga0496101_0492668
1095 Ga0496101_0832851
1096 Ga0496101_0887022
1097 Ga0496102_0000542
1098 Ga0496102_0083645
1099 Ga0496102_0550263
1100 Ga0496103_0005309
1101 Ga0496103_0135413
1102 Ga0496104_0011286
1103 Ga0496104_1511207
1104 Ga0496105_0170668
1105 Ga0496105_0182083
1106 Ga0496105_0764787
1107 Ga0496106_0002436
1108 Ga0496106_0083372
1109 Ga0496106_0469102
1110 Ga0496106_0518285
1111 Ga0496107_0022567
1112 Ga0496107_0064286
1113 Ga0496107_0113052
1114 Ga0496108_0018858
1115 Ga0496109_0008953
1116 Ga0496110_0255744
1117 Ga0496112_0023278
1118 Ga0496112_0026037
1119 Ga0496112_0116371
1120 Ga0496113_0010832
1121 Ga0496113_0625749
1122 Ga0496113_0852700
1123 Ga0496114_0128172
1124 Ga0496115_0078444
1125 Ga0496115_0080776
1126 Ga0501309_009120
1127 Ga0501309_050583
1128 Ga0501296_027799
1129 Ga0501298_004510
1130 Ga0501301_001736
1131 Ga0501312_011401
1132 Ga0501315_051788
1133 Ga0501322_025186
1134 Ga0501323_045979
1135 Ga0501250_008145
1136 Ga0501219_004613
1137 Ga0501262_037769
1138 Ga0501264_013068
1139 Ga0501283_007056
1140 nmdc:mga05p37_153003_c1
1141 nmdc:mga0n895_1572502_c1
1142 nmdc:mga0n895_177120_c1
1143 nmdc:mga0rr50_563778_c1
1144 nmdc:mga08x19_646768_c1
1145 Ga0495601_0013512
1146 Ga0495619_0470243
1147 Ga0587084_001016
1148 Ga0587084_001537
1149 Ga0587093_001238
1150 Ga0587093_001790
1151 Ga0587093_008833
1152 Ga0587093_048089
1153 Ga0587066_000264
1154 Ga0587066_000648
1155 Ga0587066_002554
1156 Ga0587066_068984
1157 Ga0587066_103529
1158 Ga0587066_197228
1159 Ga0587070_000083
1160 Ga0587070_000730
1161 Ga0587070_005606
1162 Ga0587070_006903
1163 Ga0587070_029447
1164 Ga0587070_081795
1165 Ga0587073_0000387
1166 Ga0587073_0000996
1167 Ga0587073_0006328
1168 Ga0587073_0061844
1169 Ga0587073_0097626
1170 Ga0587077_000458
1171 Ga0587077_000534
1172 Ga0587077_000736
1173 Ga0587077_009478
1174 Ga0587080_000483
1175 Ga0587080_000831
1176 Ga0587080_003723
1177 Ga0587080_058673
1178 Ga0587080_064834
1179 Ga0587082_000726
1180 Ga0587082_002306
1181 Ga0587082_002722
1182 Ga0587082_019383
1183 Ga0587082_031964
1184 Ga0587082_057975
1185 Ga0587083_0000344
1186 Ga0587083_0000832
1187 Ga0587083_0000939
1188 Ga0587083_0179684
1189 Ga0587085_001718
1190 Ga0587085_001930
1191 Ga0587085_002130
1192 Ga0587086_000457
1193 Ga0587086_007022
1194 Ga0587086_009056
1195 Ga0587086_054834
1196 Ga0587088_000405
1197 Ga0587088_000724
1198 Ga0587088_028836
1199 Ga0587089_000555
1200 Ga0587089_000606
1201 Ga0587089_004330
1202 Ga0587090_000697
1203 Ga0587090_001174
1204 Ga0587091_000292
1205 Ga0587091_000829
1206 Ga0587091_008751
1207 Ga0587092_000544
1208 Ga0587092_001026
1209 Ga0587092_007702
1210 Ga0587092_050012
1211 Ga0587094_000193
1212 Ga0587094_000549
1213 Ga0587094_018357
1214 Ga0587094_064942
1215 Ga0587095_000146
1216 Ga0587095_000251
1217 Ga0587098_001679
1218 Ga0587098_002341
1219 Ga0587106_000670
1220 Ga0587106_000874
1221 Ga0587121_00314
1222 Ga0587121_01118
1223 Ga0587125_000216
1224 Ga0587129_000319
1225 Ga0587129_003477
1226 Ga0587131_001039
1227 Ga0587099_000150
1228 Ga0587099_000360
1229 Ga0587101_000343
1230 Ga0587101_001173
1231 Ga0587101_002055
1232 Ga0587109_003000
1233 Ga0587109_004251
1234 Ga0587109_037426
1235 Ga0587109_179915
1236 Ga0587113_000217
1237 Ga0587113_000231
1238 Ga0587115_000520
1239 Ga0587115_001557
1240 Ga0587115_006598
1241 Ga0587117_000669
1242 Ga0587117_001914
1243 Ga0587117_008659
1244 Ga0587117_027540
1245 Ga0587122_002680
1246 Ga0587128_000173
1247 Ga0587128_000403
1248 Ga0587128_052517
1249 Ga0587130_000397
1250 Ga0587062_000435
1251 Ga0587062_001270
1252 Ga0587062_002033
1253 Ga0587067_000857
1254 Ga0587067_000867
1255 Ga0587067_133820
1256 Ga0587067_197993
1257 Ga0587068_001518
1258 Ga0587068_002659
1259 Ga0587068_008296
1260 Ga0587068_140295
1261 Ga0587069_000484
1262 Ga0587069_000551
1263 Ga0587069_002888
1264 Ga0587069_039067
1265 Ga0587072_000714
1266 Ga0587072_000814
1267 Ga0587072_006463
1268 Ga0587075_000193
1269 Ga0587075_000467
1270 Ga0587075_028173
1271 Ga0587075_053285
1272 Ga0587076_000702
1273 Ga0587076_000878
1274 Ga0587076_004977
1275 Ga0587076_043645
1276 Ga0587076_081228
1277 Ga0587076_138650
1278 Ga0587078_000283
1279 Ga0587078_000347
1280 Ga0587078_001649
1281 Ga0587079_000372
1282 Ga0587079_000962
1283 Ga0587079_058807
1284 Ga0587079_179585
1285 Ga0587100_006515
1286 Ga0587100_033612
1287 Ga0587102_000803
1288 Ga0587102_001284
1289 Ga0587104_013313
1290 Ga0587105_000140
1291 Ga0587105_000179
1292 Ga0587107_000249
1293 Ga0587107_000305
1294 Ga0587107_001944
1295 Ga0587110_000736
1296 Ga0587114_000090
1297 Ga0587114_000331
1298 Ga0587116_00549
1299 Ga0587116_08039
1300 Ga0587119_000375
1301 Ga0587119_000542
1302 Ga0587120_000153
1303 Ga0587124_000640
1304 Ga0587060_000132
1305 Ga0587060_000161
1306 Ga0587065_09689
1307 Ga0587081_08225
1308 Ga0587081_21553
1309 Ga0587096_03035
1310 Ga0587071_000665
1311 Ga0587071_001295
1312 Ga0587071_096739
1313 Ga0587111_0009130
1314 Ga0587111_0028020

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02472

ExbD

Biopolymer transport protein ExbD/TolR

11

138

0.96

Map