F473069
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 657 | 336 | 640 | 227 |
Family's Representative Sequence
| Representative Sequence | 3300005290|Ga0065712_10112866|Ga0065712_101128661 |
| Length | 266 |
| Sequence | MQAGADVASHRSGASPPEASDLADMALADPPGTVGPARLRAVGQIDCAQAIAAMQEFTERRQPDTTDEIWLCEHPPVYTLGLAGDPAHILSAGGIPVLRTNRGGQVTYHGPGQVVAYPLVDLRRLGLYVKEYVHRLEQALIRTLEAYGVTGHRVAGAPGIYVRTDDPFGHAALDPHSLAERHADRDAGPSFDRLAKIAALGIKVSRHCTYHGVALNVAMDLRPFSGIDACGYVGLETVDLSTIGVQAEVGDVAEVLGSKLRAFLSP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 2 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 3 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 4 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 5 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 6 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 7 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 8 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 9 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 10 | 2643221660 | Methylibium sp. Root1272 | Isolate | Unclassified |
| 11 | 2721755523 | Delftia sp. HK171 | Isolate | Unclassified |
| 12 | 2721755763 | Pandoraea thiooxydans ATSB16 | Isolate | Rhizosphere |
| 13 | 2839138175 | Delftia acidovorans B15 | Isolate | Rhizosphere |
| 14 | 2842718218 | Acidovorax sp. R-73343 | Isolate | Unclassified |
| 15 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 16 | 2932422444 | Comamonas sp. 4034 | Isolate | Rhizosphere |
| 17 | 2974320154 | Acidovorax wautersii SORGH_AS 335 | Isolate | Unclassified |
| 18 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 19 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 20 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 21 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 22 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 23 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 24 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 25 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 26 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 27 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 28 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 29 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 30 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 31 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 32 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 33 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 37 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 39 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 40 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 54 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 61 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 63 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 64 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 65 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 66 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 67 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 68 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 69 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 70 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 71 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 72 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 73 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 74 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 75 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 76 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 77 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 78 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 79 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 80 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 82 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 83 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 84 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 86 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 108 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 110 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 111 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 112 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 114 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 116 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 119 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 160 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 169 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 170 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 171 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 172 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 173 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 174 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 175 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 176 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 177 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 178 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 179 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 180 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 181 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 182 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 183 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 184 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 185 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 186 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 187 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 188 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 189 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 190 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 191 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 192 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 193 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 194 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 195 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 196 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 197 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 198 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 199 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 200 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 201 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 202 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 203 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 204 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 205 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 206 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 207 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 208 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 209 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 210 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 211 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 212 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 213 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 214 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 215 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 216 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 217 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 218 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 219 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 220 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 221 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 222 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 223 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 224 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 225 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 226 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 227 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 228 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 229 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 230 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 231 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 232 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 233 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 234 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 235 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 236 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 237 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 238 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 239 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 240 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 241 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 242 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 243 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 244 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 245 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 246 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 247 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 248 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 277 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 278 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 279 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 280 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 281 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 282 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 283 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 284 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 285 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 286 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 287 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 288 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 289 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 298 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 299 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 300 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 301 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 302 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 303 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 304 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 306 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 307 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 308 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 309 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 310 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 311 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 312 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 313 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 315 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 316 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 317 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 318 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 319 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 320 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 321 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 322 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 323 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 324 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 325 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 326 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 327 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 328 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 329 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 330 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 331 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 332 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 333 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 334 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 335 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 336 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.41 |
| Metatranscriptomes | 0 |
| Isolates | 2.59 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 24.2 |
| Nodule | 0.46 |
| Rhizoplane | 3.2 |
| Rhizosphere | 62.1 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.05 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10004370 | 3300001979 | Bacteria | 6085 |
| 2 | JGI25152J39213_1001430 | 3300002773 | Bacteria | 10303 |
| 3 | JGI25153J46596_10006137 | 3300003215 | Bacteria | 6160 |
| 4 | rootL2_10000529 | 3300003322 | Bacteria | 63830 |
| 5 | rootL2_10110021 | 3300003322 | Bacteria | 2090 |
| 6 | rootH1_10046360 | 3300003323 | Bacteria | 2165 |
| 7 | Ga0055525_1000056 | 3300003759 | Bacteria | 212321 |
| 8 | Ga0055526_1012878 | 3300003771 | Bacteria | 3596 |
| 9 | Ga0055526_1019644 | 3300003771 | Bacteria | 2451 |
| 10 | Ga0055524_1000139 | 3300003775 | Bacteria | 86430 |
| 11 | Ga0055534_1005477 | 3300003784 | Bacteria | 3388 |
| 12 | Ga0055530_10004180 | 3300003791 | Bacteria | 7611 |
| 13 | Ga0055540_1000090 | 3300003792 | Bacteria | 99454 |
| 14 | Ga0055540_1000091 | 3300003792 | Bacteria | 99089 |
| 15 | Ga0055540_1016995 | 3300003792 | Bacteria | 2045 |
| 16 | Ga0055531_10004796 | 3300003794 | Bacteria | 8077 |
| 17 | Ga0055543_1003590 | 3300004625 | Bacteria | 4491 |
| 18 | Ga0065165_1000275 | 3300005262 | Bacteria | 87709 |
| 19 | Ga0065165_1000910 | 3300005262 | Bacteria | 38170 |
| 20 | Ga0065712_10112866 | 3300005290 | Bacteria | 1792 |
| 21 | Ga0070676_10029595 | 3300005328 | Bacteria | 3116 |
| 22 | Ga0070676_10068154 | 3300005328 | Bacteria | 2129 |
| 23 | Ga0070670_100000775 | 3300005331 | Bacteria | 24812 |
| 24 | Ga0070670_100019018 | 3300005331 | Bacteria | 5891 |
| 25 | Ga0070670_100022340 | 3300005331 | Bacteria | 5446 |
| 26 | Ga0070670_100243643 | 3300005331 | Bacteria | 1565 |
| 27 | Ga0070670_100424284 | 3300005331 | Bacteria | 1176 |
| 28 | Ga0070677_10075135 | 3300005333 | Bacteria | 1431 |
| 29 | Ga0070677_10080025 | 3300005333 | Bacteria | 1396 |
| 30 | Ga0070677_10128246 | 3300005333 | Bacteria | 1154 |
| 31 | Ga0068869_100485834 | 3300005334 | Bacteria | 1029 |
| 32 | Ga0070666_10019439 | 3300005335 | Bacteria | 4385 |
| 33 | Ga0068868_100084774 | 3300005338 | Bacteria | 2545 |
| 34 | Ga0068868_100235045 | 3300005338 | Bacteria | 1538 |
| 35 | Ga0070689_100371424 | 3300005340 | Bacteria | 1204 |
| 36 | Ga0070661_100000229 | 3300005344 | Bacteria | 46608 |
| 37 | Ga0070668_100131409 | 3300005347 | Bacteria | 2010 |
| 38 | Ga0070668_100135312 | 3300005347 | Bacteria | 1982 |
| 39 | Ga0070668_100442393 | 3300005347 | Bacteria | 1116 |
| 40 | Ga0070669_100020944 | 3300005353 | Bacteria | 4671 |
| 41 | Ga0070669_100065654 | 3300005353 | Bacteria | 2673 |
| 42 | Ga0070669_100255740 | 3300005353 | Bacteria | 1396 |
| 43 | Ga0070669_100350380 | 3300005353 | Bacteria | 1198 |
| 44 | Ga0070675_100001482 | 3300005354 | Bacteria | 17319 |
| 45 | Ga0070675_100034226 | 3300005354 | Bacteria | 4122 |
| 46 | Ga0070675_100173489 | 3300005354 | Bacteria | 1861 |
| 47 | Ga0070675_100708301 | 3300005354 | Bacteria | 917 |
| 48 | Ga0070671_100020586 | 3300005355 | Bacteria | 5381 |
| 49 | Ga0070671_100042415 | 3300005355 | Bacteria | 3781 |
| 50 | Ga0070671_100055566 | 3300005355 | Bacteria | 3293 |
| 51 | Ga0070671_100082453 | 3300005355 | Bacteria | 2689 |
| 52 | Ga0070671_100157340 | 3300005355 | Bacteria | 1920 |
| 53 | Ga0070671_100285619 | 3300005355 | Bacteria | 1404 |
| 54 | Ga0070674_100004643 | 3300005356 | Bacteria | 7847 |
| 55 | Ga0070674_100035498 | 3300005356 | Bacteria | 3339 |
| 56 | Ga0070674_100474844 | 3300005356 | Bacteria | 1037 |
| 57 | Ga0070673_100003372 | 3300005364 | Bacteria | 9941 |
| 58 | Ga0070673_100044736 | 3300005364 | Bacteria | 3429 |
| 59 | Ga0070673_100597514 | 3300005364 | Bacteria | 1006 |
| 60 | Ga0070659_100009239 | 3300005366 | Bacteria | 7237 |
| 61 | Ga0070667_100006649 | 3300005367 | Bacteria | 9611 |
| 62 | Ga0070667_100168601 | 3300005367 | Bacteria | 1932 |
| 63 | Ga0070667_100264966 | 3300005367 | Bacteria | 1539 |
| 64 | Ga0070708_100769021 | 3300005445 | Bacteria | 906 |
| 65 | Ga0070663_100127553 | 3300005455 | Bacteria | 1929 |
| 66 | Ga0070678_100196618 | 3300005456 | Bacteria | 1661 |
| 67 | Ga0070662_100177261 | 3300005457 | Bacteria | 1678 |
| 68 | Ga0068867_100002317 | 3300005459 | Bacteria | 13397 |
| 69 | Ga0068867_100005133 | 3300005459 | Bacteria | 9252 |
| 70 | Ga0068867_100005331 | 3300005459 | Bacteria | 9088 |
| 71 | Ga0068867_100015928 | 3300005459 | Bacteria | 5336 |
| 72 | Ga0068867_100046359 | 3300005459 | Bacteria | 3193 |
| 73 | Ga0068867_100211512 | 3300005459 | Bacteria | 1558 |
| 74 | Ga0068867_100300177 | 3300005459 | Bacteria | 1324 |
| 75 | Ga0070706_100000367 | 3300005467 | Bacteria | 54314 |
| 76 | Ga0070707_100386312 | 3300005468 | Bacteria | 1360 |
| 77 | Ga0070707_100564759 | 3300005468 | Bacteria | 1100 |
| 78 | Ga0070699_100219331 | 3300005518 | Bacteria | 1695 |
| 79 | Ga0070672_100000485 | 3300005543 | Bacteria | 23134 |
| 80 | Ga0070672_100050694 | 3300005543 | Bacteria | 3234 |
| 81 | Ga0070672_100652605 | 3300005543 | Bacteria | 919 |
| 82 | Ga0070686_100257253 | 3300005544 | Bacteria | 1278 |
| 83 | Ga0070665_100058116 | 3300005548 | Bacteria | 3877 |
| 84 | Ga0070665_100190031 | 3300005548 | Bacteria | 2054 |
| 85 | Ga0070665_100901408 | 3300005548 | Bacteria | 897 |
| 86 | Ga0068855_100048111 | 3300005563 | Bacteria | 5035 |
| 87 | Ga0070664_100002915 | 3300005564 | Bacteria | 13849 |
| 88 | Ga0070664_100071927 | 3300005564 | Bacteria | 2965 |
| 89 | Ga0070664_100091085 | 3300005564 | Bacteria | 2640 |
| 90 | Ga0068854_100057248 | 3300005578 | Bacteria | 2812 |
| 91 | Ga0068852_100006370 | 3300005616 | Bacteria | 8525 |
| 92 | Ga0068852_100048807 | 3300005616 | Bacteria | 3619 |
| 93 | Ga0068859_100035247 | 3300005617 | Bacteria | 5020 |
| 94 | Ga0068859_100286744 | 3300005617 | Bacteria | 1739 |
| 95 | Ga0068864_100011131 | 3300005618 | Bacteria | 7434 |
| 96 | Ga0068864_100018209 | 3300005618 | Bacteria | 5863 |
| 97 | Ga0068864_100035355 | 3300005618 | Bacteria | 4253 |
| 98 | Ga0068864_100134250 | 3300005618 | Bacteria | 2227 |
| 99 | Ga0068864_100456503 | 3300005618 | Bacteria | 1223 |
| 100 | Ga0068866_10043103 | 3300005718 | Bacteria | 2250 |
| 101 | Ga0068861_100011019 | 3300005719 | Bacteria | 6284 |
| 102 | Ga0068863_100010999 | 3300005841 | Bacteria | 8776 |
| 103 | Ga0068858_100084797 | 3300005842 | Bacteria | 2947 |
| 104 | Ga0068860_100001559 | 3300005843 | Bacteria | 24688 |
| 105 | Ga0068862_100056270 | 3300005844 | Bacteria | 3370 |
| 106 | Ga0068862_100088642 | 3300005844 | Bacteria | 2692 |
| 107 | Ga0068862_100096490 | 3300005844 | Bacteria | 2581 |
| 108 | Ga0068862_100436574 | 3300005844 | Bacteria | 1232 |
| 109 | Ga0075365_10029216 | 3300006038 | Bacteria | 3521 |
| 110 | Ga0075365_10082684 | 3300006038 | Bacteria | 2177 |
| 111 | Ga0075368_10003231 | 3300006042 | Bacteria | 5425 |
| 112 | Ga0075363_100000145 | 3300006048 | Bacteria | 17501 |
| 113 | Ga0075363_100038891 | 3300006048 | Bacteria | 2502 |
| 114 | Ga0075363_100159152 | 3300006048 | Bacteria | 1278 |
| 115 | Ga0075363_100186555 | 3300006048 | Bacteria | 1182 |
| 116 | Ga0075364_10034817 | 3300006051 | Bacteria | 3252 |
| 117 | Ga0075364_10097895 | 3300006051 | Bacteria | 1951 |
| 118 | Ga0075362_10000580 | 3300006177 | Bacteria | 10685 |
| 119 | Ga0075362_10003899 | 3300006177 | Bacteria | 5296 |
| 120 | Ga0075367_10002249 | 3300006178 | Bacteria | 8731 |
| 121 | Ga0075367_10004330 | 3300006178 | Bacteria | 6910 |
| 122 | Ga0075367_10012127 | 3300006178 | Bacteria | 4585 |
| 123 | Ga0075367_10024628 | 3300006178 | Bacteria | 3395 |
| 124 | Ga0075367_10076032 | 3300006178 | Bacteria | 2026 |
| 125 | Ga0075369_10018407 | 3300006186 | Bacteria | 2843 |
| 126 | Ga0075369_10082969 | 3300006186 | Bacteria | 1423 |
| 127 | Ga0075369_10174554 | 3300006186 | Bacteria | 988 |
| 128 | Ga0075366_10000582 | 3300006195 | Bacteria | 17130 |
| 129 | Ga0075366_10001974 | 3300006195 | Bacteria | 10379 |
| 130 | Ga0075366_10007032 | 3300006195 | Bacteria | 6191 |
| 131 | Ga0075366_10007235 | 3300006195 | Bacteria | 6116 |
| 132 | Ga0075366_10016069 | 3300006195 | Bacteria | 4297 |
| 133 | Ga0075366_10022472 | 3300006195 | Bacteria | 3669 |
| 134 | Ga0075366_10035558 | 3300006195 | Bacteria | 2937 |
| 135 | Ga0075366_10036429 | 3300006195 | Bacteria | 2901 |
| 136 | Ga0075366_10062429 | 3300006195 | Bacteria | 2214 |
| 137 | Ga0075366_10160212 | 3300006195 | Bacteria | 1363 |
| 138 | Ga0075366_10283274 | 3300006195 | Bacteria | 1013 |
| 139 | Ga0075366_10305605 | 3300006195 | Bacteria | 973 |
| 140 | Ga0075366_10381676 | 3300006195 | Bacteria | 866 |
| 141 | Ga0097621_100134922 | 3300006237 | Bacteria | 2104 |
| 142 | Ga0075370_10000142 | 3300006353 | Bacteria | 24311 |
| 143 | Ga0075370_10000854 | 3300006353 | Bacteria | 12360 |
| 144 | Ga0075370_10001171 | 3300006353 | Bacteria | 11031 |
| 145 | Ga0075370_10002800 | 3300006353 | Bacteria | 8175 |
| 146 | Ga0075370_10010740 | 3300006353 | Bacteria | 4800 |
| 147 | Ga0075370_10057297 | 3300006353 | Bacteria | 2215 |
| 148 | Ga0075370_10082740 | 3300006353 | Bacteria | 1846 |
| 149 | Ga0075370_10129241 | 3300006353 | Bacteria | 1474 |
| 150 | Ga0075370_10143256 | 3300006353 | Bacteria | 1398 |
| 151 | Ga0075429_100038607 | 3300006880 | Bacteria | 4157 |
| 152 | Ga0068865_100003673 | 3300006881 | Bacteria | 9217 |
| 153 | Ga0068865_100160693 | 3300006881 | Bacteria | 1713 |
| 154 | Ga0097620_100035247 | 3300006931 | Bacteria | 5020 |
| 155 | Ga0097620_100286764 | 3300006931 | Bacteria | 1739 |
| 156 | Ga0079104_1000623 | 3300006946 | Bacteria | 34666 |
| 157 | Ga0105250_10000388 | 3300009092 | Bacteria | 32790 |
| 158 | Ga0105240_10628568 | 3300009093 | Bacteria | 1179 |
| 159 | Ga0105245_10111121 | 3300009098 | Bacteria | 2549 |
| 160 | Ga0105245_10707779 | 3300009098 | Bacteria | 1041 |
| 161 | Ga0105245_11495013 | 3300009098 | Bacteria | 726 |
| 162 | Ga0105247_10236614 | 3300009101 | Bacteria | 1242 |
| 163 | Ga0105243_10000649 | 3300009148 | Bacteria | 34418 |
| 164 | Ga0105243_10007502 | 3300009148 | Bacteria | 8381 |
| 165 | Ga0105243_10099669 | 3300009148 | Bacteria | 2409 |
| 166 | Ga0105243_10169051 | 3300009148 | Bacteria | 1892 |
| 167 | Ga0105242_10001267 | 3300009176 | Bacteria | 19954 |
| 168 | Ga0105242_10212059 | 3300009176 | Bacteria | 1726 |
| 169 | Ga0105242_11138166 | 3300009176 | Bacteria | 796 |
| 170 | Ga0105248_10063363 | 3300009177 | Bacteria | 4150 |
| 171 | Ga0105248_10112249 | 3300009177 | Bacteria | 3074 |
| 172 | Ga0105237_10044846 | 3300009545 | Bacteria | 4451 |
| 173 | Ga0105249_10062676 | 3300009553 | Bacteria | 3414 |
| 174 | Ga0105239_10466380 | 3300010375 | Bacteria | 1434 |
| 175 | Ga0157369_10588827 | 3300013105 | Bacteria | 1149 |
| 176 | Ga0157374_10083470 | 3300013296 | Bacteria | 3035 |
| 177 | Ga0157374_10143755 | 3300013296 | Bacteria | 2316 |
| 178 | Ga0157378_10001811 | 3300013297 | Bacteria | 19191 |
| 179 | Ga0157378_10186138 | 3300013297 | Bacteria | 1956 |
| 180 | Ga0157378_10315291 | 3300013297 | Bacteria | 1518 |
| 181 | Ga0163162_10146340 | 3300013306 | Bacteria | 2479 |
| 182 | Ga0163162_10457890 | 3300013306 | Bacteria | 1407 |
| 183 | Ga0157375_10090733 | 3300013308 | Bacteria | 3115 |
| 184 | Ga0157375_10168125 | 3300013308 | Bacteria | 2339 |
| 185 | Ga0157375_10411959 | 3300013308 | Bacteria | 1518 |
| 186 | Ga0163163_10011394 | 3300014325 | Bacteria | 8062 |
| 187 | Ga0163163_10519715 | 3300014325 | Bacteria | 1253 |
| 188 | Ga0157380_10418128 | 3300014326 | Bacteria | 1278 |
| 189 | Ga0157377_10000006 | 3300014745 | Bacteria | 419853 |
| 190 | Ga0157377_10195360 | 3300014745 | Bacteria | 1281 |
| 191 | Ga0157379_10015125 | 3300014968 | Bacteria | 6768 |
| 192 | Ga0157379_10016325 | 3300014968 | Bacteria | 6531 |
| 193 | Ga0157379_10181660 | 3300014968 | Bacteria | 1900 |
| 194 | Ga0157379_10500916 | 3300014968 | Bacteria | 1126 |
| 195 | Ga0157376_10101365 | 3300014969 | Bacteria | 2516 |
| 196 | Ga0157376_10179771 | 3300014969 | Bacteria | 1933 |
| 197 | Ga0163161_10092954 | 3300017792 | Bacteria | 2234 |
| 198 | Ga0163161_10185321 | 3300017792 | Bacteria | 1598 |
| 199 | Ga0163161_10459987 | 3300017792 | Bacteria | 1030 |
| 200 | Ga0213872_10000120 | 3300021361 | Bacteria | 73389 |
| 201 | Ga0209563_100014 | 3300025230 | Bacteria | 940582 |
| 202 | Ga0207425_1000703 | 3300025245 | Bacteria | 18068 |
| 203 | Ga0209129_1000933 | 3300025258 | Bacteria | 17722 |
| 204 | Ga0209673_1008819 | 3300025273 | Bacteria | 4443 |
| 205 | Ga0209673_1011570 | 3300025273 | Bacteria | 3628 |
| 206 | Ga0209673_1022805 | 3300025273 | Bacteria | 2149 |
| 207 | Ga0209130_1001737 | 3300025284 | Bacteria | 13011 |
| 208 | Ga0209675_1000571 | 3300025291 | Bacteria | 26587 |
| 209 | Ga0209676_1057233 | 3300025292 | Bacteria | 989 |
| 210 | Ga0209564_1000131 | 3300025295 | Bacteria | 192177 |
| 211 | Ga0209564_1000627 | 3300025295 | Bacteria | 53872 |
| 212 | Ga0209758_1000593 | 3300025297 | Bacteria | 56468 |
| 213 | Ga0209758_1000769 | 3300025297 | Bacteria | 46067 |
| 214 | Ga0209050_1000326 | 3300025298 | Bacteria | 95495 |
| 215 | Ga0209050_1000799 | 3300025298 | Bacteria | 44543 |
| 216 | Ga0209050_1006185 | 3300025298 | Bacteria | 7196 |
| 217 | Ga0209050_1012062 | 3300025298 | Bacteria | 4014 |
| 218 | Ga0209256_1000019 | 3300025299 | Bacteria | 558627 |
| 219 | Ga0209256_1012880 | 3300025299 | Bacteria | 3151 |
| 220 | Ga0209051_1000133 | 3300025303 | Bacteria | 139014 |
| 221 | Ga0209051_1013307 | 3300025303 | Bacteria | 3924 |
| 222 | Ga0209051_1030024 | 3300025303 | Bacteria | 2117 |
| 223 | Ga0209257_1000038 | 3300025304 | Bacteria | 609032 |
| 224 | Ga0209257_1026537 | 3300025304 | Bacteria | 1949 |
| 225 | Ga0207656_10113634 | 3300025321 | Bacteria | 1254 |
| 226 | Ga0207656_10151086 | 3300025321 | Bacteria | 1100 |
| 227 | Ga0207696_1002807 | 3300025711 | Bacteria | 8267 |
| 228 | Ga0207682_10004387 | 3300025893 | Bacteria | 5908 |
| 229 | Ga0207682_10014895 | 3300025893 | Bacteria | 3028 |
| 230 | Ga0207682_10092010 | 3300025893 | Bacteria | 1316 |
| 231 | Ga0207642_10363024 | 3300025899 | Bacteria | 857 |
| 232 | Ga0207680_10027060 | 3300025903 | Bacteria | 3187 |
| 233 | Ga0207645_10038735 | 3300025907 | Bacteria | 3055 |
| 234 | Ga0207645_10060630 | 3300025907 | Bacteria | 2416 |
| 235 | Ga0207645_10117487 | 3300025907 | Bacteria | 1725 |
| 236 | Ga0207645_10215254 | 3300025907 | Bacteria | 1266 |
| 237 | Ga0207645_10281229 | 3300025907 | Bacteria | 1105 |
| 238 | Ga0207645_10309475 | 3300025907 | Bacteria | 1052 |
| 239 | Ga0207643_10032633 | 3300025908 | Bacteria | 2909 |
| 240 | Ga0207671_10031240 | 3300025914 | Bacteria | 3968 |
| 241 | Ga0207646_10403551 | 3300025922 | Bacteria | 1234 |
| 242 | Ga0207681_10060602 | 3300025923 | Bacteria | 2598 |
| 243 | Ga0207681_10315989 | 3300025923 | Bacteria | 1240 |
| 244 | Ga0207650_10000275 | 3300025925 | Bacteria | 53824 |
| 245 | Ga0207650_10032388 | 3300025925 | Bacteria | 3781 |
| 246 | Ga0207650_10076434 | 3300025925 | Bacteria | 2530 |
| 247 | Ga0207650_10400213 | 3300025925 | Bacteria | 1136 |
| 248 | Ga0207659_10003305 | 3300025926 | Bacteria | 9661 |
| 249 | Ga0207659_10098310 | 3300025926 | Bacteria | 2201 |
| 250 | Ga0207659_10135532 | 3300025926 | Bacteria | 1905 |
| 251 | Ga0207659_10400758 | 3300025926 | Bacteria | 1147 |
| 252 | Ga0207659_10553826 | 3300025926 | Bacteria | 978 |
| 253 | Ga0207687_10275771 | 3300025927 | Bacteria | 1346 |
| 254 | Ga0207644_10005477 | 3300025931 | Bacteria | 8268 |
| 255 | Ga0207644_10048247 | 3300025931 | Bacteria | 3043 |
| 256 | Ga0207644_10061537 | 3300025931 | Bacteria | 2719 |
| 257 | Ga0207644_10160485 | 3300025931 | Bacteria | 1747 |
| 258 | Ga0207644_10211412 | 3300025931 | Bacteria | 1534 |
| 259 | Ga0207706_10091751 | 3300025933 | Bacteria | 2670 |
| 260 | Ga0207706_10230598 | 3300025933 | Bacteria | 1620 |
| 261 | Ga0207686_10018660 | 3300025934 | Bacteria | 3929 |
| 262 | Ga0207709_10000696 | 3300025935 | Bacteria | 27115 |
| 263 | Ga0207709_10001139 | 3300025935 | Bacteria | 19377 |
| 264 | Ga0207669_10034388 | 3300025937 | Bacteria | 2871 |
| 265 | Ga0207669_10107865 | 3300025937 | Bacteria | 1858 |
| 266 | Ga0207669_10342375 | 3300025937 | Bacteria | 1152 |
| 267 | Ga0207669_10470736 | 3300025937 | Bacteria | 1000 |
| 268 | Ga0207704_10120769 | 3300025938 | Bacteria | 1793 |
| 269 | Ga0207691_10001335 | 3300025940 | Bacteria | 24610 |
| 270 | Ga0207691_10058049 | 3300025940 | Bacteria | 3520 |
| 271 | Ga0207691_10080650 | 3300025940 | Bacteria | 2926 |
| 272 | Ga0207691_10481919 | 3300025940 | Bacteria | 1054 |
| 273 | Ga0207711_10189790 | 3300025941 | Bacteria | 1872 |
| 274 | Ga0207689_10049644 | 3300025942 | Bacteria | 3461 |
| 275 | Ga0207689_10423688 | 3300025942 | Bacteria | 1111 |
| 276 | Ga0207679_10000339 | 3300025945 | Bacteria | 34501 |
| 277 | Ga0207679_10078325 | 3300025945 | Bacteria | 2517 |
| 278 | Ga0207651_10008298 | 3300025960 | Bacteria | 5603 |
| 279 | Ga0207651_10064540 | 3300025960 | Bacteria | 2563 |
| 280 | Ga0207712_10035567 | 3300025961 | Bacteria | 3385 |
| 281 | Ga0207712_10518260 | 3300025961 | Bacteria | 1021 |
| 282 | Ga0207668_10081035 | 3300025972 | Bacteria | 2353 |
| 283 | Ga0207668_10092283 | 3300025972 | Bacteria | 2228 |
| 284 | Ga0207668_10099690 | 3300025972 | Bacteria | 2156 |
| 285 | Ga0207640_10126527 | 3300025981 | Bacteria | 1840 |
| 286 | Ga0207658_10006476 | 3300025986 | Bacteria | 7992 |
| 287 | Ga0207658_10131102 | 3300025986 | Bacteria | 2014 |
| 288 | Ga0207658_10598098 | 3300025986 | Bacteria | 991 |
| 289 | Ga0207677_10075816 | 3300026023 | Bacteria | 2392 |
| 290 | Ga0207677_10084359 | 3300026023 | Bacteria | 2290 |
| 291 | Ga0207677_10259992 | 3300026023 | Bacteria | 1415 |
| 292 | Ga0207703_10067755 | 3300026035 | Bacteria | 2938 |
| 293 | Ga0207703_10498340 | 3300026035 | Bacteria | 1143 |
| 294 | Ga0207639_10413635 | 3300026041 | Bacteria | 1218 |
| 295 | Ga0207678_10144564 | 3300026067 | Bacteria | 2030 |
| 296 | Ga0207678_10223615 | 3300026067 | Bacteria | 1611 |
| 297 | Ga0207641_11217294 | 3300026088 | Bacteria | 753 |
| 298 | Ga0207648_10000254 | 3300026089 | Bacteria | 57696 |
| 299 | Ga0207648_10000419 | 3300026089 | Bacteria | 46680 |
| 300 | Ga0207648_10024822 | 3300026089 | Bacteria | 5347 |
| 301 | Ga0207648_10063438 | 3300026089 | Bacteria | 3220 |
| 302 | Ga0207648_10066548 | 3300026089 | Bacteria | 3142 |
| 303 | Ga0207648_10161244 | 3300026089 | Bacteria | 1980 |
| 304 | Ga0207648_10178308 | 3300026089 | Bacteria | 1880 |
| 305 | Ga0207648_10347594 | 3300026089 | Bacteria | 1336 |
| 306 | Ga0207648_10908474 | 3300026089 | Bacteria | 823 |
| 307 | Ga0207676_10019987 | 3300026095 | Bacteria | 4893 |
| 308 | Ga0207676_10029853 | 3300026095 | Bacteria | 4086 |
| 309 | Ga0207676_10332647 | 3300026095 | Bacteria | 1398 |
| 310 | Ga0207675_100004240 | 3300026118 | Bacteria | 13863 |
| 311 | Ga0207675_100032919 | 3300026118 | Bacteria | 4830 |
| 312 | Ga0207675_100873252 | 3300026118 | Bacteria | 915 |
| 313 | Ga0207683_10061301 | 3300026121 | Bacteria | 3310 |
| 314 | Ga0207683_10153958 | 3300026121 | Bacteria | 2076 |
| 315 | Ga0207683_10388700 | 3300026121 | Bacteria | 1283 |
| 316 | Ga0207683_10516442 | 3300026121 | Bacteria | 1104 |
| 317 | Ga0207698_10144531 | 3300026142 | Bacteria | 2055 |
| 318 | Ga0207698_10448473 | 3300026142 | Bacteria | 1245 |
| 319 | Ga0207698_10598438 | 3300026142 | Bacteria | 1087 |
| 320 | Ga0209281_1000072 | 3300027111 | Bacteria | 273114 |
| 321 | Ga0209281_1000098 | 3300027111 | Bacteria | 226641 |
| 322 | Ga0209973_1000754 | 3300027252 | Bacteria | 2592 |
| 323 | Ga0209996_1000743 | 3300027395 | Bacteria | 3875 |
| 324 | Ga0209968_1000617 | 3300027526 | Bacteria | 5511 |
| 325 | Ga0209970_1000134 | 3300027614 | Bacteria | 11104 |
| 326 | Ga0209966_1000517 | 3300027695 | Bacteria | 9984 |
| 327 | Ga0209974_10019124 | 3300027876 | Bacteria | 2271 |
| 328 | Ga0209974_10020998 | 3300027876 | Bacteria | 2164 |
| 329 | Ga0268265_10037721 | 3300028380 | Bacteria | 3549 |
| 330 | Ga0268265_10111999 | 3300028380 | Bacteria | 2230 |
| 331 | Ga0268264_10002884 | 3300028381 | Bacteria | 14955 |
| 332 | Ga0307517_10173770 | 3300028786 | Bacteria | 1409 |
| 333 | Ga0307515_10000921 | 3300028794 | Bacteria | 67536 |
| 334 | Ga0307515_10001761 | 3300028794 | Bacteria | 48250 |
| 335 | Ga0307515_10011753 | 3300028794 | Bacteria | 16566 |
| 336 | Ga0307515_10014878 | 3300028794 | Bacteria | 14383 |
| 337 | Ga0307515_10014984 | 3300028794 | Bacteria | 14322 |
| 338 | Ga0307515_10179398 | 3300028794 | Bacteria | 2074 |
| 339 | Ga0307515_10294004 | 3300028794 | Bacteria | 1317 |
| 340 | Ga0307512_10062146 | 3300030522 | Bacteria | 2868 |
| 341 | Ga0307512_10096586 | 3300030522 | Bacteria | 2025 |
| 342 | Ga0307512_10216090 | 3300030522 | Bacteria | 1010 |
| 343 | Ga0265328_10020766 | 3300031239 | Bacteria | 2512 |
| 344 | Ga0265327_10000924 | 3300031251 | Bacteria | 42993 |
| 345 | Ga0307513_10010837 | 3300031456 | Bacteria | 11385 |
| 346 | Ga0307513_10038516 | 3300031456 | Bacteria | 5307 |
| 347 | Ga0307513_10051191 | 3300031456 | Bacteria | 4457 |
| 348 | Ga0307513_10052373 | 3300031456 | Bacteria | 4396 |
| 349 | Ga0307513_10401501 | 3300031456 | Bacteria | 1105 |
| 350 | Ga0307509_10015076 | 3300031507 | Bacteria | 9049 |
| 351 | Ga0307509_10038943 | 3300031507 | Bacteria | 5181 |
| 352 | Ga0307509_10065554 | 3300031507 | Bacteria | 3813 |
| 353 | Ga0307509_10232962 | 3300031507 | Bacteria | 1642 |
| 354 | Ga0307509_10290623 | 3300031507 | Bacteria | 1389 |
| 355 | Ga0307509_10449407 | 3300031507 | Bacteria | 983 |
| 356 | Ga0307408_100001205 | 3300031548 | Bacteria | 19516 |
| 357 | Ga0307408_100086692 | 3300031548 | Bacteria | 2354 |
| 358 | Ga0307408_100246376 | 3300031548 | Bacteria | 1471 |
| 359 | Ga0307408_100257426 | 3300031548 | Bacteria | 1442 |
| 360 | Ga0307408_100307508 | 3300031548 | Bacteria | 1330 |
| 361 | Ga0307508_10000440 | 3300031616 | Bacteria | 49668 |
| 362 | Ga0307508_10004752 | 3300031616 | Bacteria | 13130 |
| 363 | Ga0307508_10015474 | 3300031616 | Bacteria | 6948 |
| 364 | Ga0307508_10279184 | 3300031616 | Bacteria | 1264 |
| 365 | Ga0307514_10066289 | 3300031649 | Bacteria | 2731 |
| 366 | Ga0307514_10104622 | 3300031649 | Bacteria | 2024 |
| 367 | Ga0307514_10146712 | 3300031649 | Bacteria | 1593 |
| 368 | Ga0307516_10001028 | 3300031730 | Bacteria | 38713 |
| 369 | Ga0307516_10004218 | 3300031730 | Bacteria | 17894 |
| 370 | Ga0307516_10054856 | 3300031730 | Bacteria | 3893 |
| 371 | Ga0307516_10074847 | 3300031730 | Bacteria | 3241 |
| 372 | Ga0307405_10020862 | 3300031731 | Bacteria | 3670 |
| 373 | Ga0307405_10042005 | 3300031731 | Bacteria | 2780 |
| 374 | Ga0307413_10229807 | 3300031824 | Bacteria | 1361 |
| 375 | Ga0307410_10057965 | 3300031852 | Bacteria | 2639 |
| 376 | Ga0307406_10022265 | 3300031901 | Bacteria | 3757 |
| 377 | Ga0307406_10035628 | 3300031901 | Bacteria | 3062 |
| 378 | Ga0307406_10052853 | 3300031901 | Bacteria | 2586 |
| 379 | Ga0307406_10882201 | 3300031901 | Bacteria | 760 |
| 380 | Ga0307407_10026775 | 3300031903 | Bacteria | 3059 |
| 381 | Ga0307412_10016042 | 3300031911 | Bacteria | 4452 |
| 382 | Ga0307412_10128716 | 3300031911 | Bacteria | 1835 |
| 383 | Ga0307412_10220062 | 3300031911 | Bacteria | 1455 |
| 384 | Ga0307409_100087784 | 3300031995 | Bacteria | 2536 |
| 385 | Ga0307416_100166662 | 3300032002 | Bacteria | 2044 |
| 386 | Ga0307416_100415644 | 3300032002 | Bacteria | 1387 |
| 387 | Ga0307416_100583780 | 3300032002 | Bacteria | 1195 |
| 388 | Ga0307411_10043269 | 3300032005 | Bacteria | 2880 |
| 389 | Ga0307411_10120508 | 3300032005 | Bacteria | 1897 |
| 390 | Ga0307411_10171933 | 3300032005 | Bacteria | 1635 |
| 391 | Ga0307411_10394400 | 3300032005 | Bacteria | 1142 |
| 392 | Ga0307411_10681630 | 3300032005 | Bacteria | 893 |
| 393 | Ga0307415_100029395 | 3300032126 | Bacteria | 3512 |
| 394 | Ga0307507_10092918 | 3300033179 | Bacteria | 2572 |
| 395 | Ga0307507_10096470 | 3300033179 | Bacteria | 2501 |
| 396 | Ga0307507_10148153 | 3300033179 | Bacteria | 1776 |
| 397 | Ga0307507_10186574 | 3300033179 | Bacteria | 1469 |
| 398 | Ga0307510_10003419 | 3300033180 | Bacteria | 18519 |
| 399 | Ga0307510_10033328 | 3300033180 | Bacteria | 5786 |
| 400 | Ga0307510_10245266 | 3300033180 | Bacteria | 1283 |
| 401 | Ga0373928_0014086 | 3300035084 | Bacteria | 1613 |
| 402 | Ga0373931_0128594 | 3300035691 | Bacteria | 1455 |
| 403 | Ga0373931_0246067 | 3300035691 | Bacteria | 1086 |
| 404 | Ga0373937_0369994 | 3300036401 | Bacteria | 1359 |
| 405 | Ga0373925_0039291 | 3300037068 | Bacteria | 3501 |
| 406 | Ga0395899_0001736 | 3300037312 | Bacteria | 18130 |
| 407 | Ga0395898_0261109 | 3300037466 | Bacteria | 1652 |
| 408 | Ga0395905_0000390 | 3300037471 | Bacteria | 62192 |
| 409 | Ga0395905_0000414 | 3300037471 | Bacteria | 59892 |
| 410 | Ga0395905_0004449 | 3300037471 | Bacteria | 14565 |
| 411 | Ga0395905_0005385 | 3300037471 | Bacteria | 13078 |
| 412 | Ga0395905_0011763 | 3300037471 | Bacteria | 8448 |
| 413 | Ga0395905_0026010 | 3300037471 | Bacteria | 5519 |
| 414 | Ga0395905_0143744 | 3300037471 | Bacteria | 2244 |
| 415 | Ga0395905_0205558 | 3300037471 | Bacteria | 1845 |
| 416 | Ga0395901_0386443 | 3300038443 | Bacteria | 1440 |
| 417 | Ga0395901_0709809 | 3300038443 | Bacteria | 1002 |
| 418 | Ga0436361_0097160 | 3300039447 | Bacteria | 66004 |
| 419 | Ga0439436_0001080 | 3300041404 | Bacteria | 7686 |
| 420 | Ga0439438_030453 | 3300041405 | Bacteria | 1439 |
| 421 | Ga0439439_0005108 | 3300041406 | Bacteria | 2985 |
| 422 | Ga0439466_0027462 | 3300041411 | Bacteria | 1971 |
| 423 | Ga0439465_0047787 | 3300041413 | Bacteria | 1396 |
| 424 | Ga0451789_0850686 | 3300041443 | Bacteria | 2795 |
| 425 | Ga0451793_0799789 | 3300041452 | Bacteria | 979 |
| 426 | Ga0451795_0058901 | 3300041456 | Bacteria | 2049 |
| 427 | Ga0451798_0442166 | 3300041458 | Bacteria | 982 |
| 428 | Ga0451800_0280383 | 3300041459 | Bacteria | 1669 |
| 429 | Ga0451800_0413036 | 3300041459 | Bacteria | 1043 |
| 430 | Ga0451807_0609196 | 3300041486 | Bacteria | 917 |
| 431 | Ga0451807_2394431 | 3300041486 | Bacteria | 930 |
| 432 | Ga0451841_0330404 | 3300041498 | Bacteria | 957 |
| 433 | Ga0451847_0358612 | 3300041503 | Bacteria | 959 |
| 434 | Ga0439431_0013248 | 3300041997 | Bacteria | 1901 |
| 435 | Ga0439433_0012758 | 3300041999 | Bacteria | 1844 |
| 436 | Ga0439442_044501 | 3300042002 | Bacteria | 935 |
| 437 | Ga0439445_0018507 | 3300042004 | Bacteria | 1730 |
| 438 | Ga0439432_008065 | 3300042006 | Bacteria | 3709 |
| 439 | Ga0439449_0003723 | 3300042007 | Bacteria | 5913 |
| 440 | Ga0439452_005832 | 3300042010 | Bacteria | 3924 |
| 441 | Ga0439462_0012837 | 3300042015 | Bacteria | 2143 |
| 442 | Ga0439463_012439 | 3300042016 | Bacteria | 2092 |
| 443 | Ga0450911_000958 | 3300042115 | Bacteria | 7525 |
| 444 | Ga0450919_001362 | 3300042121 | Bacteria | 3191 |
| 445 | Ga0450920_023976 | 3300042122 | Bacteria | 1184 |
| 446 | Ga0450898_019034 | 3300042134 | Bacteria | 1194 |
| 447 | Ga0450899_009776 | 3300042135 | Bacteria | 1059 |
| 448 | Ga0450904_014619 | 3300042139 | Bacteria | 783 |
| 449 | Ga0450906_006531 | 3300042145 | Bacteria | 2349 |
| 450 | Ga0450910_029193 | 3300042147 | Bacteria | 861 |
| 451 | Ga0450908_006357 | 3300042184 | Bacteria | 2247 |
| 452 | Ga0439434_0018569 | 3300042435 | Bacteria | 2083 |
| 453 | Ga0439434_0028567 | 3300042435 | Bacteria | 1689 |
| 454 | Ga0439464_0002359 | 3300042439 | Bacteria | 4640 |
| 455 | Ga0439460_0104476 | 3300042461 | Bacteria | 913 |
| 456 | Ga0450918_000283 | 3300042531 | Bacteria | 11490 |
| 457 | Ga0451577_0011181 | 3300042876 | Bacteria | 8514 |
| 458 | Ga0451577_0012601 | 3300042876 | Bacteria | 7934 |
| 459 | Ga0451577_0320259 | 3300042876 | Bacteria | 1406 |
| 460 | Ga0439440_0033556 | 3300042993 | Bacteria | 1224 |
| 461 | Ga0466969_0035601 | 3300044656 | Bacteria | 2517 |
| 462 | Ga0466969_0046431 | 3300044656 | Bacteria | 2154 |
| 463 | Ga0453683_0153151 | 3300044673 | Bacteria | 1457 |
| 464 | Ga0466965_0132402 | 3300044683 | Bacteria | 1294 |
| 465 | Ga0466966_0011393 | 3300044684 | Bacteria | 5897 |
| 466 | Ga0466966_0185904 | 3300044684 | Bacteria | 1260 |
| 467 | Ga0466966_0237819 | 3300044684 | Bacteria | 1098 |
| 468 | Ga0466961_0005169 | 3300044693 | Bacteria | 8211 |
| 469 | Ga0466961_0006669 | 3300044693 | Bacteria | 7342 |
| 470 | Ga0466961_0031397 | 3300044693 | Bacteria | 3415 |
| 471 | Ga0453684_0029228 | 3300044712 | Bacteria | 7838 |
| 472 | Ga0453684_0286912 | 3300044712 | Bacteria | 1875 |
| 473 | Ga0453684_0433910 | 3300044712 | Bacteria | 1465 |
| 474 | Ga0466968_0014124 | 3300044735 | Bacteria | 3152 |
| 475 | Ga0466970_0010244 | 3300044765 | Bacteria | 4754 |
| 476 | Ga0466970_0222072 | 3300044765 | Bacteria | 1055 |
| 477 | Ga0466957_0349773 | 3300044842 | Bacteria | 1002 |
| 478 | Ga0466959_0028817 | 3300045049 | Bacteria | 4114 |
| 479 | Ga0451576_0022025 | 3300045051 | Bacteria | 6915 |
| 480 | Ga0451576_0609150 | 3300045051 | Bacteria | 1148 |
| 481 | Ga0495592_0000528 | 3300046454 | Bacteria | 27565 |
| 482 | Ga0495603_0397440 | 3300046455 | Bacteria | 790 |
| 483 | Ga0495638_0195584 | 3300046460 | Bacteria | 1145 |
| 484 | Ga0495650_0002706 | 3300046471 | Bacteria | 13746 |
| 485 | Ga0495606_0046495 | 3300046507 | Bacteria | 2868 |
| 486 | Ga0495606_0151581 | 3300046507 | Bacteria | 1360 |
| 487 | Ga0495610_0061187 | 3300046512 | Bacteria | 1790 |
| 488 | Ga0495620_0042763 | 3300046515 | Bacteria | 1977 |
| 489 | Ga0495628_0499329 | 3300046516 | Bacteria | 879 |
| 490 | Ga0495630_0132527 | 3300046517 | Bacteria | 1893 |
| 491 | Ga0495632_0001689 | 3300046519 | Bacteria | 18062 |
| 492 | Ga0495632_0027029 | 3300046519 | Bacteria | 3011 |
| 493 | Ga0495632_0034016 | 3300046519 | Bacteria | 2611 |
| 494 | Ga0495632_0157544 | 3300046519 | Bacteria | 1047 |
| 495 | Ga0495663_0056259 | 3300046525 | Bacteria | 1228 |
| 496 | Ga0495663_0072460 | 3300046525 | Bacteria | 1099 |
| 497 | Ga0495621_0013170 | 3300046539 | Bacteria | 2594 |
| 498 | Ga0495597_0001717 | 3300046542 | Bacteria | 15163 |
| 499 | Ga0495597_0042908 | 3300046542 | Bacteria | 2015 |
| 500 | Ga0495633_0010434 | 3300046558 | Bacteria | 5067 |
| 501 | Ga0495656_0000645 | 3300046615 | Bacteria | 11174 |
| 502 | Ga0495668_0259086 | 3300046616 | Bacteria | 952 |
| 503 | Ga0495625_0027381 | 3300046660 | Bacteria | 4293 |
| 504 | Ga0495625_0138927 | 3300046660 | Bacteria | 1640 |
| 505 | Ga0495625_0280749 | 3300046660 | Bacteria | 1071 |
| 506 | Ga0495659_0146519 | 3300046664 | Bacteria | 945 |
| 507 | Ga0495658_0373100 | 3300046683 | Bacteria | 908 |
| 508 | Ga0495624_0168579 | 3300046690 | Bacteria | 1336 |
| 509 | Ga0495649_0003993 | 3300046694 | Bacteria | 9723 |
| 510 | Ga0495649_0226441 | 3300046694 | Bacteria | 966 |
| 511 | Ga0495660_0035588 | 3300046810 | Bacteria | 2781 |
| 512 | Ga0495676_0019792 | 3300047321 | Bacteria | 5917 |
| 513 | Ga0495687_001797 | 3300047443 | Bacteria | 18906 |
| 514 | Ga0495685_057770 | 3300047447 | Bacteria | 1310 |
| 515 | Ga0495686_0115238 | 3300047472 | Bacteria | 1607 |
| 516 | Ga0495686_0171187 | 3300047472 | Bacteria | 1263 |
| 517 | Ga0495615_0030988 | 3300048090 | Bacteria | 1280 |
| 518 | Ga0495626_0045695 | 3300048091 | Bacteria | 2043 |
| 519 | Ga0496102_0019151 | 3300048905 | Bacteria | 6025 |
| 520 | Ga0496105_0349373 | 3300048908 | Bacteria | 1181 |
| 521 | Ga0496105_0611312 | 3300048908 | Bacteria | 845 |
| 522 | Ga0496106_0013343 | 3300048909 | Bacteria | 6065 |
| 523 | Ga0496109_0588972 | 3300048912 | Bacteria | 1048 |
| 524 | Ga0496109_0709054 | 3300048912 | Bacteria | 944 |
| 525 | Ga0496109_0725556 | 3300048912 | Bacteria | 931 |
| 526 | Ga0496112_0109655 | 3300048915 | Bacteria | 2730 |
| 527 | Ga0496112_0435218 | 3300048915 | Bacteria | 1250 |
| 528 | Ga0496113_0040369 | 3300048916 | Bacteria | 3439 |
| 529 | Ga0496114_0012810 | 3300048917 | Bacteria | 6714 |
| 530 | Ga0496114_0579285 | 3300048917 | Bacteria | 990 |
| 531 | Ga0496114_0611837 | 3300048917 | Bacteria | 960 |
| 532 | Ga0496121_0007296 | 3300048924 | Bacteria | 13370 |
| 533 | Ga0496121_0407793 | 3300048924 | Bacteria | 888 |
| 534 | Ga0496122_0147468 | 3300048925 | Bacteria | 1459 |
| 535 | Ga0496123_0067285 | 3300048926 | Bacteria | 2263 |
| 536 | Ga0496123_0193140 | 3300048926 | Bacteria | 1051 |
| 537 | Ga0496124_0072578 | 3300048927 | Bacteria | 2850 |
| 538 | Ga0496125_0070525 | 3300048928 | Bacteria | 2735 |
| 539 | Ga0496125_0167490 | 3300048928 | Bacteria | 1482 |
| 540 | Ga0496126_0120194 | 3300048929 | Bacteria | 2279 |
| 541 | Ga0496126_0352000 | 3300048929 | Bacteria | 1204 |
| 542 | Ga0496126_0507940 | 3300048929 | Bacteria | 962 |
| 543 | Ga0495682_0137470 | 3300049460 | Bacteria | 873 |
| 544 | Ga0501031_0017890 | 3300049568 | Bacteria | 4610 |
| 545 | Ga0501033_0091106 | 3300049570 | Bacteria | 2230 |
| 546 | Ga0501034_0192758 | 3300049571 | Bacteria | 1999 |
| 547 | Ga0501043_0000277 | 3300049579 | Bacteria | 46284 |
| 548 | Ga0501046_0000345 | 3300049580 | Bacteria | 46730 |
| 549 | Ga0501047_0000395 | 3300049581 | Bacteria | 48969 |
| 550 | Ga0501047_0264303 | 3300049581 | Bacteria | 1568 |
| 551 | Ga0501048_0000111 | 3300049582 | Bacteria | 46009 |
| 552 | Ga0501198_000023 | 3300049649 | Bacteria | 69100 |
| 553 | Ga0501222_000031 | 3300049662 | Bacteria | 56867 |
| 554 | Ga0501233_011743 | 3300049668 | Bacteria | 1748 |
| 555 | Ga0501249_018719 | 3300049679 | Bacteria | 1499 |
| 556 | Ga0501253_024256 | 3300049683 | Bacteria | 1099 |
| 557 | Ga0501257_039041 | 3300049686 | Bacteria | 1162 |
| 558 | Ga0501265_005711 | 3300049762 | Bacteria | 1439 |
| 559 | Ga0501044_0201191 | 3300049823 | Bacteria | 1950 |
| 560 | nmdc:mga03683_183520_c1 | 3300050489 | Bacteria | 955 |
| 561 | nmdc:mga03683_193631_c1 | 3300050489 | Bacteria | 931 |
| 562 | nmdc:mga03683_41757_c1 | 3300050489 | Bacteria | 1885 |
| 563 | nmdc:mga03n38_128795_c1 | 3300050490 | Bacteria | 1252 |
| 564 | nmdc:mga03n38_19557_c1 | 3300050490 | Bacteria | 2693 |
| 565 | nmdc:mga03n38_345959_c1 | 3300050490 | Bacteria | 808 |
| 566 | nmdc:mga03n38_4126_c1 | 3300050490 | Bacteria | 4771 |
| 567 | nmdc:mga00v17_27516_c1 | 3300050491 | Bacteria | 3320 |
| 568 | nmdc:mga00v17_8528_c1 | 3300050491 | Bacteria | 5517 |
| 569 | nmdc:mga0yw44_156222_c1 | 3300050492 | Bacteria | 1491 |
| 570 | nmdc:mga0yw44_69791_c1 | 3300050492 | Bacteria | 2177 |
| 571 | nmdc:mga0k408_108211_c1 | 3300050493 | Bacteria | 1642 |
| 572 | nmdc:mga0k408_11041_c1 | 3300050493 | Bacteria | 4906 |
| 573 | nmdc:mga0k408_114280_c1 | 3300050493 | Bacteria | 1596 |
| 574 | nmdc:mga0k408_13795_c1 | 3300050493 | Bacteria | 4438 |
| 575 | nmdc:mga0k408_1405_c1 | 3300050493 | Bacteria | 13025 |
| 576 | nmdc:mga0k408_1412_c1 | 3300050493 | Bacteria | 12975 |
| 577 | nmdc:mga0k408_185650_c1 | 3300050493 | Bacteria | 1240 |
| 578 | nmdc:mga0k408_21052_c1 | 3300050493 | Bacteria | 3660 |
| 579 | nmdc:mga0k408_2400_c1 | 3300050493 | Bacteria | 9965 |
| 580 | nmdc:mga0k408_253426_c1 | 3300050493 | Bacteria | 1051 |
| 581 | nmdc:mga0k408_2728_c1 | 3300050493 | Bacteria | 4496 |
| 582 | nmdc:mga0k408_322552_c1 | 3300050493 | Bacteria | 922 |
| 583 | nmdc:mga0k408_4980_c1 | 3300050493 | Bacteria | 7039 |
| 584 | nmdc:mga0k408_5321_c1 | 3300050493 | Bacteria | 6838 |
| 585 | nmdc:mga0k408_5383_c1 | 3300050493 | Bacteria | 6807 |
| 586 | nmdc:mga0k408_74914_c1 | 3300050493 | Bacteria | 1977 |
| 587 | nmdc:mga0k408_76377_c1 | 3300050493 | Bacteria | 1958 |
| 588 | nmdc:mga06z11_121291_c1 | 3300050494 | Bacteria | 1459 |
| 589 | nmdc:mga06z11_229286_c1 | 3300050494 | Bacteria | 1088 |
| 590 | nmdc:mga06z11_3034_c1 | 3300050494 | Bacteria | 6460 |
| 591 | nmdc:mga06z11_70879_c1 | 3300050494 | Bacteria | 1844 |
| 592 | nmdc:mga04h51_5190_c1 | 3300050495 | Bacteria | 3305 |
| 593 | nmdc:mga07m45_1136_c1 | 3300050496 | Bacteria | 11938 |
| 594 | nmdc:mga07m45_142595_c1 | 3300050496 | Bacteria | 1388 |
| 595 | nmdc:mga07m45_149947_c1 | 3300050496 | Bacteria | 1352 |
| 596 | nmdc:mga07m45_17485_c1 | 3300050496 | Bacteria | 3852 |
| 597 | nmdc:mga07m45_179112_c1 | 3300050496 | Bacteria | 1233 |
| 598 | nmdc:mga07m45_179352_c1 | 3300050496 | Bacteria | 1232 |
| 599 | nmdc:mga07m45_1876_c1 | 3300050496 | Bacteria | 9712 |
| 600 | nmdc:mga07m45_27001_c1 | 3300050496 | Bacteria | 3159 |
| 601 | nmdc:mga07m45_369984_c1 | 3300050496 | Bacteria | 833 |
| 602 | nmdc:mga07m45_47236_c1 | 3300050496 | Bacteria | 2420 |
| 603 | nmdc:mga07m45_476129_c1 | 3300050496 | Bacteria | 724 |
| 604 | nmdc:mga07m45_50139_c1 | 3300050496 | Bacteria | 2351 |
| 605 | nmdc:mga07m45_59872_c1 | 3300050496 | Bacteria | 2155 |
| 606 | nmdc:mga07m45_82398_c1 | 3300050496 | Bacteria | 1837 |
| 607 | nmdc:mga07m45_8856_c1 | 3300050496 | Bacteria | 5193 |
| 608 | nmdc:mga09592_9369_c1 | 3300050508 | Bacteria | 7965 |
| 609 | nmdc:mga0sz30_123419_c1 | 3300050516 | Bacteria | 1139 |
| 610 | nmdc:mga0sz30_12980_c1 | 3300050516 | Bacteria | 3253 |
| 611 | nmdc:mga0sz30_139147_c1 | 3300050516 | Bacteria | 1072 |
| 612 | Ga0500578_0000406 | 3300053086 | Bacteria | 52894 |
| 613 | Ga0500644_0095571 | 3300053088 | Bacteria | 1120 |
| 614 | Ga0500644_0220080 | 3300053088 | Bacteria | 791 |
| 615 | Ga0500646_0005193 | 3300053090 | Bacteria | 3296 |
| 616 | Ga0500651_0000877 | 3300053093 | Bacteria | 14753 |
| 617 | Ga0500651_0251269 | 3300053093 | Bacteria | 1028 |
| 618 | Ga0500566_0132409 | 3300053094 | Bacteria | 1332 |
| 619 | Ga0500557_025453 | 3300053105 | Bacteria | 1741 |
| 620 | Ga0500592_010373 | 3300053116 | Bacteria | 1484 |
| 621 | Ga0500628_003477 | 3300053129 | Bacteria | 2600 |
| 622 | Ga0500652_000420 | 3300053131 | Bacteria | 15148 |
| 623 | Ga0500655_007928 | 3300053133 | Bacteria | 1912 |
| 624 | Ga0500658_0016399 | 3300053134 | Bacteria | 2760 |
| 625 | Ga0500658_0246243 | 3300053134 | Bacteria | 821 |
| 626 | Ga0500559_0000265 | 3300053136 | Bacteria | 40939 |
| 627 | Ga0500559_0017226 | 3300053136 | Bacteria | 3050 |
| 628 | Ga0500561_0128650 | 3300053137 | Bacteria | 778 |
| 629 | Ga0500568_0005916 | 3300053139 | Bacteria | 6227 |
| 630 | Ga0500568_0105393 | 3300053139 | Bacteria | 1056 |
| 631 | Ga0500586_119185 | 3300053145 | Bacteria | 919 |
| 632 | Ga0500590_014765 | 3300053148 | Bacteria | 4028 |
| 633 | Ga0500604_0018531 | 3300053151 | Bacteria | 1940 |
| 634 | Ga0500622_0001047 | 3300053156 | Bacteria | 23044 |
| 635 | Ga0500622_0002039 | 3300053156 | Bacteria | 15066 |
| 636 | Ga0500570_142560 | 3300053724 | Bacteria | 876 |
| 637 | Ga0500645_003124 | 3300053730 | Bacteria | 6902 |
| 638 | Ga0500587_000568 | 3300053739 | Bacteria | 4573 |
| 639 | Ga0500587_005322 | 3300053739 | Bacteria | 1735 |
| 640 | Ga0466962_0027267 | 3300061719 | Bacteria | 2742 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300037466 | Ga0395898_0261109 | Ga0395898_0261109_24_566 | 178 |
| 2 | 3300041486 | Ga0451807_2394431 | Ga0451807_2394431_36_587 | 178 |
| 3 | 3300026089 | Ga0207648_10908474 | Ga0207648_109084742 | 200 |
| 4 | 3300046664 | Ga0495659_0146519 | Ga0495659_0146519_317_928 | 200 |
| 5 | 3300003784 | Ga0055534_1005477 | Ga0055534_10054772 | 201 |
| 6 | 3300003792 | Ga0055540_1016995 | Ga0055540_10169953 | 201 |
| 7 | 3300005333 | Ga0070677_10128246 | Ga0070677_101282462 | 201 |
| 8 | 3300005347 | Ga0070668_100135312 | Ga0070668_1001353123 | 201 |
| 9 | 3300017792 | Ga0163161_10459987 | Ga0163161_104599872 | 201 |
| 10 | 3300025284 | Ga0209130_1001737 | Ga0209130_10017379 | 201 |
| 11 | 3300025291 | Ga0209675_1000571 | Ga0209675_100057126 | 201 |
| 12 | 3300025292 | Ga0209676_1057233 | Ga0209676_10572332 | 201 |
| 13 | 3300025298 | Ga0209050_1012062 | Ga0209050_10120622 | 201 |
| 14 | 3300025303 | Ga0209051_1013307 | Ga0209051_10133072 | 201 |
| 15 | 3300025304 | Ga0209257_1026537 | Ga0209257_10265373 | 201 |
| 16 | 3300025893 | Ga0207682_10092010 | Ga0207682_100920102 | 201 |
| 17 | 3300025926 | Ga0207659_10400758 | Ga0207659_104007582 | 201 |
| 18 | 3300025972 | Ga0207668_10099690 | Ga0207668_100996902 | 201 |
| 19 | 3300038443 | Ga0395901_0709809 | Ga0395901_0709809_353_964 | 201 |
| 20 | 3300046539 | Ga0495621_0013170 | Ga0495621_0013170_1241_1858 | 201 |
| 21 | 3300046615 | Ga0495656_0000645 | Ga0495656_0000645_5941_6558 | 201 |
| 22 | 3300048090 | Ga0495615_0030988 | Ga0495615_0030988_133_750 | 201 |
| 23 | 3300048917 | Ga0496114_0579285 | Ga0496114_0579285_193_810 | 201 |
| 24 | 3300048917 | Ga0496114_0611837 | Ga0496114_0611837_279_896 | 201 |
| 25 | 3300048929 | Ga0496126_0507940 | Ga0496126_0507940_50_670 | 201 |
| 26 | 3300005367 | Ga0070667_100264966 | Ga0070667_1002649661 | 203 |
| 27 | 3300006195 | Ga0075366_10283274 | Ga0075366_102832742 | 203 |
| 28 | 3300009148 | Ga0105243_10000649 | Ga0105243_100006492 | 203 |
| 29 | 3300014745 | Ga0157377_10000006 | Ga0157377_10000006408 | 203 |
| 30 | 3300031456 | Ga0307513_10051191 | Ga0307513_100511915 | 203 |
| 31 | 3300031507 | Ga0307509_10015076 | Ga0307509_1001507610 | 203 |
| 32 | 3300031507 | Ga0307509_10232962 | Ga0307509_102329622 | 203 |
| 33 | 3300031616 | Ga0307508_10015474 | Ga0307508_100154746 | 203 |
| 34 | 3300033179 | Ga0307507_10148153 | Ga0307507_101481532 | 203 |
| 35 | 3300033179 | Ga0307507_10186574 | Ga0307507_101865742 | 203 |
| 36 | 3300042134 | Ga0450898_019034 | Ga0450898_019034_540_1157 | 203 |
| 37 | 3300044765 | Ga0466970_0222072 | Ga0466970_0222072_416_1033 | 203 |
| 38 | 3300048908 | Ga0496105_0611312 | Ga0496105_0611312_36_647 | 203 |
| 39 | 3300050493 | nmdc:mga0k408_253426_c1 | nmdc:mga0k408_253426_c1_241_852 | 203 |
| 40 | 3300050493 | nmdc:mga0k408_185650_c1 | nmdc:mga0k408_185650_c1_292_954 | 207 |
| 41 | 3300037471 | Ga0395905_0000414 | Ga0395905_0000414_21577_22263 | 208 |
| 42 | 3300038443 | Ga0395901_0386443 | Ga0395901_0386443_179_865 | 208 |
| 43 | iso_pu_bacteria | 2721755763 | 2723876183 | 208 |
| 44 | 3300025297 | Ga0209758_1000769 | Ga0209758_100076940 | 209 |
| 45 | 3300053093 | Ga0500651_0251269 | Ga0500651_0251269_119_781 | 209 |
| 46 | 3300053134 | Ga0500658_0246243 | Ga0500658_0246243_62_697 | 211 |
| 47 | 3300014968 | Ga0157379_10015125 | Ga0157379_100151252 | 213 |
| 48 | 3300049568 | Ga0501031_0017890 | Ga0501031_0017890_3200_3880 | 214 |
| 49 | 3300028794 | Ga0307515_10000921 | Ga0307515_1000092113 | 215 |
| 50 | 3300028794 | Ga0307515_10014878 | Ga0307515_100148785 | 215 |
| 51 | 3300028794 | Ga0307515_10014984 | Ga0307515_1001498411 | 215 |
| 52 | 3300030522 | Ga0307512_10062146 | Ga0307512_100621461 | 215 |
| 53 | 3300030522 | Ga0307512_10216090 | Ga0307512_102160902 | 215 |
| 54 | 3300031616 | Ga0307508_10000440 | Ga0307508_1000044038 | 215 |
| 55 | 3300031649 | Ga0307514_10104622 | Ga0307514_101046223 | 215 |
| 56 | 3300033179 | Ga0307507_10096470 | Ga0307507_100964702 | 215 |
| 57 | 3300041486 | Ga0451807_0609196 | Ga0451807_0609196_25_672 | 215 |
| 58 | 3300048917 | Ga0496114_0012810 | Ga0496114_0012810_5739_6386 | 215 |
| 59 | 3300053088 | Ga0500644_0220080 | Ga0500644_0220080_44_691 | 215 |
| 60 | 3300053724 | Ga0500570_142560 | Ga0500570_142560_14_661 | 215 |
| 61 | iso_pu_bacteria | 2842718218 | 2842722348 | 215 |
| 62 | 3300032002 | Ga0307416_100583780 | Ga0307416_1005837802 | 216 |
| 63 | 3300037471 | Ga0395905_0205558 | Ga0395905_0205558_927_1604 | 216 |
| 64 | 3300042876 | Ga0451577_0320259 | Ga0451577_0320259_666_1316 | 216 |
| 65 | 3300044712 | Ga0453684_0433910 | Ga0453684_0433910_175_825 | 216 |
| 66 | 3300049571 | Ga0501034_0192758 | Ga0501034_0192758_1255_1947 | 216 |
| 67 | 3300049579 | Ga0501043_0000277 | Ga0501043_0000277_35164_35847 | 216 |
| 68 | 3300049580 | Ga0501046_0000345 | Ga0501046_0000345_10884_11567 | 216 |
| 69 | 3300049581 | Ga0501047_0000395 | Ga0501047_0000395_35164_35847 | 216 |
| 70 | 3300049582 | Ga0501048_0000111 | Ga0501048_0000111_35114_35797 | 216 |
| 71 | 3300049649 | Ga0501198_000023 | Ga0501198_000023_63189_63872 | 216 |
| 72 | 3300049662 | Ga0501222_000031 | Ga0501222_000031_5245_5928 | 216 |
| 73 | 3300049823 | Ga0501044_0201191 | Ga0501044_0201191_1089_1772 | 216 |
| 74 | 3300050493 | nmdc:mga0k408_1412_c1 | nmdc:mga0k408_1412_c1_8669_9346 | 216 |
| 75 | iso_pu_bacteria | 2919704043 | 2919708974 | 216 |
| 76 | iso_pu_bacteria | 2932422444 | 2932426529 | 216 |
| 77 | iso_pu_bacteria | 2974320154 | 2974321082 | 216 |
| 78 | 3300005331 | Ga0070670_100424284 | Ga0070670_1004242841 | 217 |
| 79 | 3300005353 | Ga0070669_100065654 | Ga0070669_1000656541 | 217 |
| 80 | 3300005356 | Ga0070674_100474844 | Ga0070674_1004748441 | 217 |
| 81 | 3300005563 | Ga0068855_100048111 | Ga0068855_1000481112 | 217 |
| 82 | 3300005844 | Ga0068862_100056270 | Ga0068862_1000562702 | 217 |
| 83 | 3300005844 | Ga0068862_100088642 | Ga0068862_1000886423 | 217 |
| 84 | 3300025925 | Ga0207650_10400213 | Ga0207650_104002133 | 217 |
| 85 | 3300026118 | Ga0207675_100873252 | Ga0207675_1008732522 | 217 |
| 86 | 3300028380 | Ga0268265_10111999 | Ga0268265_101119993 | 217 |
| 87 | 3300028794 | Ga0307515_10294004 | Ga0307515_102940042 | 217 |
| 88 | 3300031548 | Ga0307408_100086692 | Ga0307408_1000866922 | 217 |
| 89 | 3300032005 | Ga0307411_10394400 | Ga0307411_103944001 | 217 |
| 90 | 3300037312 | Ga0395899_0001736 | Ga0395899_0001736_229_888 | 217 |
| 91 | 3300037471 | Ga0395905_0011763 | Ga0395905_0011763_4149_4808 | 217 |
| 92 | 3300037471 | Ga0395905_0143744 | Ga0395905_0143744_226_894 | 217 |
| 93 | 3300044656 | Ga0466969_0046431 | Ga0466969_0046431_933_1592 | 217 |
| 94 | 3300044684 | Ga0466966_0011393 | Ga0466966_0011393_3029_3688 | 217 |
| 95 | 3300044693 | Ga0466961_0006669 | Ga0466961_0006669_2321_2980 | 217 |
| 96 | 3300044693 | Ga0466961_0031397 | Ga0466961_0031397_249_908 | 217 |
| 97 | 3300044765 | Ga0466970_0010244 | Ga0466970_0010244_4057_4716 | 217 |
| 98 | 3300044842 | Ga0466957_0349773 | Ga0466957_0349773_136_795 | 217 |
| 99 | 3300046525 | Ga0495663_0056259 | Ga0495663_0056259_195_857 | 217 |
| 100 | 3300047447 | Ga0495685_057770 | Ga0495685_057770_523_1185 | 217 |
| 101 | 3300049570 | Ga0501033_0091106 | Ga0501033_0091106_1176_1844 | 217 |
| 102 | 3300049581 | Ga0501047_0264303 | Ga0501047_0264303_777_1445 | 217 |
| 103 | iso_pu_bacteria | 2585428057 | 2587730575 | 217 |
| 104 | iso_pu_bacteria | 2585428058 | 2587736803 | 217 |
| 105 | iso_pu_bacteria | 2588253510 | 2588294950 | 217 |
| 106 | iso_pu_bacteria | 2643221592 | 2643967809 | 217 |
| 107 | iso_pu_bacteria | 2643221625 | 2644140631 | 217 |
| 108 | iso_pu_bacteria | 2643221648 | 2644273598 | 217 |
| 109 | 3300005347 | Ga0070668_100131409 | Ga0070668_1001314093 | 218 |
| 110 | 3300005459 | Ga0068867_100005331 | Ga0068867_1000053312 | 218 |
| 111 | 3300005616 | Ga0068852_100006370 | Ga0068852_1000063704 | 218 |
| 112 | 3300006195 | Ga0075366_10001974 | Ga0075366_1000197411 | 218 |
| 113 | 3300006195 | Ga0075366_10007032 | Ga0075366_100070328 | 218 |
| 114 | 3300006880 | Ga0075429_100038607 | Ga0075429_1000386076 | 218 |
| 115 | 3300013297 | Ga0157378_10315291 | Ga0157378_103152912 | 218 |
| 116 | 3300025935 | Ga0207709_10001139 | Ga0207709_100011392 | 218 |
| 117 | 3300026089 | Ga0207648_10000254 | Ga0207648_1000025456 | 218 |
| 118 | 3300026142 | Ga0207698_10598438 | Ga0207698_105984382 | 218 |
| 119 | 3300037471 | Ga0395905_0000390 | Ga0395905_0000390_45952_46638 | 218 |
| 120 | 3300037471 | Ga0395905_0026010 | Ga0395905_0026010_509_1177 | 218 |
| 121 | 3300041443 | Ga0451789_0850686 | Ga0451789_0850686_1969_2625 | 218 |
| 122 | 3300046660 | Ga0495625_0138927 | Ga0495625_0138927_776_1468 | 218 |
| 123 | 3300050493 | nmdc:mga0k408_114280_c1 | nmdc:mga0k408_114280_c1_151_837 | 218 |
| 124 | 3300050493 | nmdc:mga0k408_1405_c1 | nmdc:mga0k408_1405_c1_10519_11184 | 218 |
| 125 | 3300050493 | nmdc:mga0k408_2400_c1 | nmdc:mga0k408_2400_c1_4913_5602 | 218 |
| 126 | 3300050493 | nmdc:mga0k408_2728_c1 | nmdc:mga0k408_2728_c1_1109_1765 | 218 |
| 127 | 3300053116 | Ga0500592_010373 | Ga0500592_010373_313_969 | 218 |
| 128 | 3300053129 | Ga0500628_003477 | Ga0500628_003477_44_700 | 218 |
| 129 | 3300053156 | Ga0500622_0001047 | Ga0500622_0001047_15237_15893 | 218 |
| 130 | iso_pu_bacteria | 2643221654 | 2644303488 | 218 |
| 131 | iso_pu_bacteria | 2643221660 | 2644339838 | 218 |
| 132 | 3300003215 | JGI25153J46596_10006137 | JGI25153J46596_100061372 | 219 |
| 133 | 3300005331 | Ga0070670_100022340 | Ga0070670_1000223403 | 219 |
| 134 | 3300005459 | Ga0068867_100300177 | Ga0068867_1003001772 | 219 |
| 135 | 3300005618 | Ga0068864_100134250 | Ga0068864_1001342502 | 219 |
| 136 | 3300006195 | Ga0075366_10016069 | Ga0075366_100160692 | 219 |
| 137 | 3300013296 | Ga0157374_10083470 | Ga0157374_100834703 | 219 |
| 138 | 3300025925 | Ga0207650_10032388 | Ga0207650_100323883 | 219 |
| 139 | 3300026088 | Ga0207641_11217294 | Ga0207641_112172941 | 219 |
| 140 | 3300026089 | Ga0207648_10347594 | Ga0207648_103475942 | 219 |
| 141 | 3300026095 | Ga0207676_10332647 | Ga0207676_103326471 | 219 |
| 142 | 3300031548 | Ga0307408_100257426 | Ga0307408_1002574262 | 219 |
| 143 | 3300031731 | Ga0307405_10042005 | Ga0307405_100420053 | 219 |
| 144 | 3300031911 | Ga0307412_10128716 | Ga0307412_101287163 | 219 |
| 145 | 3300032005 | Ga0307411_10681630 | Ga0307411_106816302 | 219 |
| 146 | 3300041404 | Ga0439436_0001080 | Ga0439436_0001080_1726_2391 | 219 |
| 147 | 3300041405 | Ga0439438_030453 | Ga0439438_030453_249_914 | 219 |
| 148 | 3300041406 | Ga0439439_0005108 | Ga0439439_0005108_2261_2926 | 219 |
| 149 | 3300041411 | Ga0439466_0027462 | Ga0439466_0027462_444_1109 | 219 |
| 150 | 3300041997 | Ga0439431_0013248 | Ga0439431_0013248_288_953 | 219 |
| 151 | 3300041999 | Ga0439433_0012758 | Ga0439433_0012758_236_901 | 219 |
| 152 | 3300042002 | Ga0439442_044501 | Ga0439442_044501_101_766 | 219 |
| 153 | 3300042004 | Ga0439445_0018507 | Ga0439445_0018507_740_1414 | 219 |
| 154 | 3300042006 | Ga0439432_008065 | Ga0439432_008065_2935_3600 | 219 |
| 155 | 3300042007 | Ga0439449_0003723 | Ga0439449_0003723_724_1389 | 219 |
| 156 | 3300042010 | Ga0439452_005832 | Ga0439452_005832_3040_3705 | 219 |
| 157 | 3300042015 | Ga0439462_0012837 | Ga0439462_0012837_684_1349 | 219 |
| 158 | 3300042016 | Ga0439463_012439 | Ga0439463_012439_1110_1784 | 219 |
| 159 | 3300042115 | Ga0450911_000958 | Ga0450911_000958_4704_5378 | 219 |
| 160 | 3300042135 | Ga0450899_009776 | Ga0450899_009776_351_1016 | 219 |
| 161 | 3300042139 | Ga0450904_014619 | Ga0450904_014619_29_703 | 219 |
| 162 | 3300042145 | Ga0450906_006531 | Ga0450906_006531_1632_2297 | 219 |
| 163 | 3300042147 | Ga0450910_029193 | Ga0450910_029193_132_797 | 219 |
| 164 | 3300042184 | Ga0450908_006357 | Ga0450908_006357_1419_2084 | 219 |
| 165 | 3300042435 | Ga0439434_0028567 | Ga0439434_0028567_109_774 | 219 |
| 166 | 3300042876 | Ga0451577_0012601 | Ga0451577_0012601_7085_7756 | 219 |
| 167 | 3300044684 | Ga0466966_0185904 | Ga0466966_0185904_297_968 | 219 |
| 168 | 3300044712 | Ga0453684_0029228 | Ga0453684_0029228_3898_4566 | 219 |
| 169 | 3300044712 | Ga0453684_0286912 | Ga0453684_0286912_509_1180 | 219 |
| 170 | 3300048927 | Ga0496124_0072578 | Ga0496124_0072578_2083_2757 | 219 |
| 171 | 3300048929 | Ga0496126_0352000 | Ga0496126_0352000_63_737 | 219 |
| 172 | 3300050508 | nmdc:mga09592_9369_c1 | nmdc:mga09592_9369_c1_7118_7807 | 219 |
| 173 | 3300053145 | Ga0500586_119185 | Ga0500586_119185_216_887 | 219 |
| 174 | 3300053148 | Ga0500590_014765 | Ga0500590_014765_3127_3801 | 219 |
| 175 | 3300002773 | JGI25152J39213_1001430 | JGI25152J39213_10014303 | 220 |
| 176 | 3300003322 | rootL2_10000529 | rootL2_100005292 | 220 |
| 177 | 3300003323 | rootH1_10046360 | rootH1_100463604 | 220 |
| 178 | 3300003771 | Ga0055526_1012878 | Ga0055526_10128783 | 220 |
| 179 | 3300003771 | Ga0055526_1019644 | Ga0055526_10196443 | 220 |
| 180 | 3300004625 | Ga0055543_1003590 | Ga0055543_10035904 | 220 |
| 181 | 3300005262 | Ga0065165_1000275 | Ga0065165_100027518 | 220 |
| 182 | 3300005328 | Ga0070676_10029595 | Ga0070676_100295952 | 220 |
| 183 | 3300005354 | Ga0070675_100708301 | Ga0070675_1007083011 | 220 |
| 184 | 3300005355 | Ga0070671_100157340 | Ga0070671_1001573403 | 220 |
| 185 | 3300005356 | Ga0070674_100004643 | Ga0070674_1000046433 | 220 |
| 186 | 3300005367 | Ga0070667_100168601 | Ga0070667_1001686012 | 220 |
| 187 | 3300005459 | Ga0068867_100005133 | Ga0068867_10000513310 | 220 |
| 188 | 3300005544 | Ga0070686_100257253 | Ga0070686_1002572532 | 220 |
| 189 | 3300005718 | Ga0068866_10043103 | Ga0068866_100431033 | 220 |
| 190 | 3300005719 | Ga0068861_100011019 | Ga0068861_1000110192 | 220 |
| 191 | 3300005842 | Ga0068858_100084797 | Ga0068858_1000847971 | 220 |
| 192 | 3300005843 | Ga0068860_100001559 | Ga0068860_1000015599 | 220 |
| 193 | 3300005844 | Ga0068862_100096490 | Ga0068862_1000964903 | 220 |
| 194 | 3300006038 | Ga0075365_10029216 | Ga0075365_100292162 | 220 |
| 195 | 3300006195 | Ga0075366_10035558 | Ga0075366_100355583 | 220 |
| 196 | 3300006353 | Ga0075370_10082740 | Ga0075370_100827402 | 220 |
| 197 | 3300006881 | Ga0068865_100003673 | Ga0068865_10000367310 | 220 |
| 198 | 3300009098 | Ga0105245_11495013 | Ga0105245_114950131 | 220 |
| 199 | 3300009176 | Ga0105242_11138166 | Ga0105242_111381661 | 220 |
| 200 | 3300013297 | Ga0157378_10001811 | Ga0157378_1000181113 | 220 |
| 201 | 3300013306 | Ga0163162_10146340 | Ga0163162_101463403 | 220 |
| 202 | 3300014326 | Ga0157380_10418128 | Ga0157380_104181281 | 220 |
| 203 | 3300014968 | Ga0157379_10181660 | Ga0157379_101816602 | 220 |
| 204 | 3300014969 | Ga0157376_10179771 | Ga0157376_101797712 | 220 |
| 205 | 3300017792 | Ga0163161_10185321 | Ga0163161_101853213 | 220 |
| 206 | 3300021361 | Ga0213872_10000120 | Ga0213872_1000012042 | 220 |
| 207 | 3300025245 | Ga0207425_1000703 | Ga0207425_100070312 | 220 |
| 208 | 3300025258 | Ga0209129_1000933 | Ga0209129_100093311 | 220 |
| 209 | 3300025273 | Ga0209673_1011570 | Ga0209673_10115702 | 220 |
| 210 | 3300025273 | Ga0209673_1022805 | Ga0209673_10228051 | 220 |
| 211 | 3300025295 | Ga0209564_1000131 | Ga0209564_100013118 | 220 |
| 212 | 3300025295 | Ga0209564_1000627 | Ga0209564_100062749 | 220 |
| 213 | 3300025297 | Ga0209758_1000593 | Ga0209758_100059351 | 220 |
| 214 | 3300025298 | Ga0209050_1006185 | Ga0209050_10061855 | 220 |
| 215 | 3300025299 | Ga0209256_1012880 | Ga0209256_10128804 | 220 |
| 216 | 3300025893 | Ga0207682_10014895 | Ga0207682_100148953 | 220 |
| 217 | 3300025899 | Ga0207642_10363024 | Ga0207642_103630242 | 220 |
| 218 | 3300025907 | Ga0207645_10038735 | Ga0207645_100387352 | 220 |
| 219 | 3300025907 | Ga0207645_10309475 | Ga0207645_103094752 | 220 |
| 220 | 3300025923 | Ga0207681_10315989 | Ga0207681_103159892 | 220 |
| 221 | 3300025926 | Ga0207659_10553826 | Ga0207659_105538262 | 220 |
| 222 | 3300025931 | Ga0207644_10211412 | Ga0207644_102114123 | 220 |
| 223 | 3300025937 | Ga0207669_10107865 | Ga0207669_101078653 | 220 |
| 224 | 3300025961 | Ga0207712_10035567 | Ga0207712_100355671 | 220 |
| 225 | 3300025961 | Ga0207712_10518260 | Ga0207712_105182602 | 220 |
| 226 | 3300025972 | Ga0207668_10092283 | Ga0207668_100922832 | 220 |
| 227 | 3300025986 | Ga0207658_10131102 | Ga0207658_101311023 | 220 |
| 228 | 3300026067 | Ga0207678_10223615 | Ga0207678_102236152 | 220 |
| 229 | 3300026089 | Ga0207648_10000419 | Ga0207648_1000041910 | 220 |
| 230 | 3300026118 | Ga0207675_100004240 | Ga0207675_1000042408 | 220 |
| 231 | 3300027252 | Ga0209973_1000754 | Ga0209973_10007542 | 220 |
| 232 | 3300027395 | Ga0209996_1000743 | Ga0209996_10007433 | 220 |
| 233 | 3300027526 | Ga0209968_1000617 | Ga0209968_10006177 | 220 |
| 234 | 3300027614 | Ga0209970_1000134 | Ga0209970_100013415 | 220 |
| 235 | 3300027695 | Ga0209966_1000517 | Ga0209966_10005172 | 220 |
| 236 | 3300027876 | Ga0209974_10020998 | Ga0209974_100209984 | 220 |
| 237 | 3300028380 | Ga0268265_10037721 | Ga0268265_100377212 | 220 |
| 238 | 3300028381 | Ga0268264_10002884 | Ga0268264_100028849 | 220 |
| 239 | 3300028794 | Ga0307515_10001761 | Ga0307515_1000176112 | 220 |
| 240 | 3300031456 | Ga0307513_10038516 | Ga0307513_100385168 | 220 |
| 241 | 3300031548 | Ga0307408_100001205 | Ga0307408_10000120518 | 220 |
| 242 | 3300031548 | Ga0307408_100307508 | Ga0307408_1003075082 | 220 |
| 243 | 3300031730 | Ga0307516_10074847 | Ga0307516_100748472 | 220 |
| 244 | 3300031901 | Ga0307406_10022265 | Ga0307406_100222655 | 220 |
| 245 | 3300031901 | Ga0307406_10052853 | Ga0307406_100528534 | 220 |
| 246 | 3300031901 | Ga0307406_10882201 | Ga0307406_108822011 | 220 |
| 247 | 3300031911 | Ga0307412_10220062 | Ga0307412_102200622 | 220 |
| 248 | 3300032005 | Ga0307411_10120508 | Ga0307411_101205082 | 220 |
| 249 | 3300032005 | Ga0307411_10171933 | Ga0307411_101719331 | 220 |
| 250 | 3300035691 | Ga0373931_0246067 | Ga0373931_0246067_91_789 | 220 |
| 251 | 3300039447 | Ga0436361_0097160 | Ga0436361_0097160_42185_42847 | 220 |
| 252 | 3300044735 | Ga0466968_0014124 | Ga0466968_0014124_1858_2526 | 220 |
| 253 | 3300046471 | Ga0495650_0002706 | Ga0495650_0002706_9310_9978 | 220 |
| 254 | 3300049679 | Ga0501249_018719 | Ga0501249_018719_415_1113 | 220 |
| 255 | 3300050492 | nmdc:mga0yw44_156222_c1 | nmdc:mga0yw44_156222_c1_776_1480 | 220 |
| 256 | 3300050493 | nmdc:mga0k408_108211_c1 | nmdc:mga0k408_108211_c1_391_1059 | 220 |
| 257 | 3300053094 | Ga0500566_0132409 | Ga0500566_0132409_356_1144 | 220 |
| 258 | iso_pu_bacteria | 2643221644 | 2644247307 | 220 |
| 259 | 3300003322 | rootL2_10110021 | rootL2_101100212 | 221 |
| 260 | 3300005262 | Ga0065165_1000910 | Ga0065165_10009103 | 221 |
| 261 | 3300005331 | Ga0070670_100243643 | Ga0070670_1002436433 | 221 |
| 262 | 3300005335 | Ga0070666_10019439 | Ga0070666_100194393 | 221 |
| 263 | 3300005340 | Ga0070689_100371424 | Ga0070689_1003714242 | 221 |
| 264 | 3300005353 | Ga0070669_100350380 | Ga0070669_1003503801 | 221 |
| 265 | 3300005354 | Ga0070675_100173489 | Ga0070675_1001734892 | 221 |
| 266 | 3300005355 | Ga0070671_100055566 | Ga0070671_1000555664 | 221 |
| 267 | 3300005364 | Ga0070673_100044736 | Ga0070673_1000447362 | 221 |
| 268 | 3300005617 | Ga0068859_100035247 | Ga0068859_1000352475 | 221 |
| 269 | 3300005618 | Ga0068864_100011131 | Ga0068864_1000111314 | 221 |
| 270 | 3300005841 | Ga0068863_100010999 | Ga0068863_1000109994 | 221 |
| 271 | 3300006048 | Ga0075363_100038891 | Ga0075363_1000388912 | 221 |
| 272 | 3300006178 | Ga0075367_10024628 | Ga0075367_100246284 | 221 |
| 273 | 3300006186 | Ga0075369_10174554 | Ga0075369_101745542 | 221 |
| 274 | 3300006195 | Ga0075366_10007235 | Ga0075366_100072352 | 221 |
| 275 | 3300006353 | Ga0075370_10001171 | Ga0075370_1000117110 | 221 |
| 276 | 3300006931 | Ga0097620_100035247 | Ga0097620_1000352475 | 221 |
| 277 | 3300009101 | Ga0105247_10236614 | Ga0105247_102366142 | 221 |
| 278 | 3300009176 | Ga0105242_10212059 | Ga0105242_102120592 | 221 |
| 279 | 3300009177 | Ga0105248_10063363 | Ga0105248_100633633 | 221 |
| 280 | 3300013296 | Ga0157374_10143755 | Ga0157374_101437552 | 221 |
| 281 | 3300013297 | Ga0157378_10186138 | Ga0157378_101861383 | 221 |
| 282 | 3300013308 | Ga0157375_10090733 | Ga0157375_100907332 | 221 |
| 283 | 3300014325 | Ga0163163_10011394 | Ga0163163_100113942 | 221 |
| 284 | 3300014968 | Ga0157379_10016325 | Ga0157379_100163252 | 221 |
| 285 | 3300025273 | Ga0209673_1008819 | Ga0209673_10088196 | 221 |
| 286 | 3300025321 | Ga0207656_10151086 | Ga0207656_101510862 | 221 |
| 287 | 3300025903 | Ga0207680_10027060 | Ga0207680_100270603 | 221 |
| 288 | 3300025907 | Ga0207645_10117487 | Ga0207645_101174872 | 221 |
| 289 | 3300025908 | Ga0207643_10032633 | Ga0207643_100326331 | 221 |
| 290 | 3300025926 | Ga0207659_10135532 | Ga0207659_101355322 | 221 |
| 291 | 3300025931 | Ga0207644_10048247 | Ga0207644_100482474 | 221 |
| 292 | 3300025940 | Ga0207691_10058049 | Ga0207691_100580493 | 221 |
| 293 | 3300025941 | Ga0207711_10189790 | Ga0207711_101897902 | 221 |
| 294 | 3300025942 | Ga0207689_10049644 | Ga0207689_100496444 | 221 |
| 295 | 3300025972 | Ga0207668_10081035 | Ga0207668_100810352 | 221 |
| 296 | 3300025986 | Ga0207658_10598098 | Ga0207658_105980981 | 221 |
| 297 | 3300026035 | Ga0207703_10067755 | Ga0207703_100677553 | 221 |
| 298 | 3300026035 | Ga0207703_10498340 | Ga0207703_104983402 | 221 |
| 299 | 3300026089 | Ga0207648_10024822 | Ga0207648_100248222 | 221 |
| 300 | 3300026118 | Ga0207675_100032919 | Ga0207675_1000329196 | 221 |
| 301 | 3300026121 | Ga0207683_10153958 | Ga0207683_101539583 | 221 |
| 302 | 3300026121 | Ga0207683_10388700 | Ga0207683_103887002 | 221 |
| 303 | 3300031456 | Ga0307513_10401501 | Ga0307513_104015012 | 221 |
| 304 | 3300031649 | Ga0307514_10066289 | Ga0307514_100662893 | 221 |
| 305 | 3300031730 | Ga0307516_10004218 | Ga0307516_1000421812 | 221 |
| 306 | 3300041413 | Ga0439465_0047787 | Ga0439465_0047787_33_704 | 221 |
| 307 | 3300041452 | Ga0451793_0799789 | Ga0451793_0799789_255_920 | 221 |
| 308 | 3300041458 | Ga0451798_0442166 | Ga0451798_0442166_277_942 | 221 |
| 309 | 3300041459 | Ga0451800_0413036 | Ga0451800_0413036_165_830 | 221 |
| 310 | 3300041503 | Ga0451847_0358612 | Ga0451847_0358612_64_729 | 221 |
| 311 | 3300042439 | Ga0439464_0002359 | Ga0439464_0002359_3708_4379 | 221 |
| 312 | 3300042461 | Ga0439460_0104476 | Ga0439460_0104476_217_888 | 221 |
| 313 | 3300042993 | Ga0439440_0033556 | Ga0439440_0033556_505_1176 | 221 |
| 314 | 3300045051 | Ga0451576_0609150 | Ga0451576_0609150_294_977 | 221 |
| 315 | 3300046455 | Ga0495603_0397440 | Ga0495603_0397440_16_687 | 221 |
| 316 | 3300046515 | Ga0495620_0042763 | Ga0495620_0042763_320_985 | 221 |
| 317 | 3300046519 | Ga0495632_0001689 | Ga0495632_0001689_24_689 | 221 |
| 318 | 3300048912 | Ga0496109_0588972 | Ga0496109_0588972_150_821 | 221 |
| 319 | 3300048924 | Ga0496121_0007296 | Ga0496121_0007296_7946_8626 | 221 |
| 320 | 3300048928 | Ga0496125_0167490 | Ga0496125_0167490_82_762 | 221 |
| 321 | 3300050489 | nmdc:mga03683_183520_c1 | nmdc:mga03683_183520_c1_216_881 | 221 |
| 322 | 3300050490 | nmdc:mga03n38_19557_c1 | nmdc:mga03n38_19557_c1_1065_1730 | 221 |
| 323 | 3300050494 | nmdc:mga06z11_229286_c1 | nmdc:mga06z11_229286_c1_407_1072 | 221 |
| 324 | 3300050496 | nmdc:mga07m45_8856_c1 | nmdc:mga07m45_8856_c1_2808_3473 | 221 |
| 325 | 3300050516 | nmdc:mga0sz30_123419_c1 | nmdc:mga0sz30_123419_c1_217_882 | 221 |
| 326 | 3300053086 | Ga0500578_0000406 | Ga0500578_0000406_42817_43482 | 221 |
| 327 | 3300053088 | Ga0500644_0095571 | Ga0500644_0095571_404_1069 | 221 |
| 328 | 3300053090 | Ga0500646_0005193 | Ga0500646_0005193_1360_2025 | 221 |
| 329 | 3300053093 | Ga0500651_0000877 | Ga0500651_0000877_9240_9905 | 221 |
| 330 | 3300053105 | Ga0500557_025453 | Ga0500557_025453_159_824 | 221 |
| 331 | 3300053131 | Ga0500652_000420 | Ga0500652_000420_1781_2446 | 221 |
| 332 | 3300053133 | Ga0500655_007928 | Ga0500655_007928_471_1136 | 221 |
| 333 | 3300053137 | Ga0500561_0128650 | Ga0500561_0128650_48_725 | 221 |
| 334 | 3300053139 | Ga0500568_0005916 | Ga0500568_0005916_5414_6088 | 221 |
| 335 | 3300053151 | Ga0500604_0018531 | Ga0500604_0018531_106_771 | 221 |
| 336 | 3300005331 | Ga0070670_100019018 | Ga0070670_1000190181 | 222 |
| 337 | 3300005333 | Ga0070677_10080025 | Ga0070677_100800252 | 222 |
| 338 | 3300005334 | Ga0068869_100485834 | Ga0068869_1004858342 | 222 |
| 339 | 3300005338 | Ga0068868_100084774 | Ga0068868_1000847742 | 222 |
| 340 | 3300005354 | Ga0070675_100034226 | Ga0070675_1000342261 | 222 |
| 341 | 3300005364 | Ga0070673_100003372 | Ga0070673_10000337210 | 222 |
| 342 | 3300005457 | Ga0070662_100177261 | Ga0070662_1001772613 | 222 |
| 343 | 3300005459 | Ga0068867_100015928 | Ga0068867_1000159286 | 222 |
| 344 | 3300005543 | Ga0070672_100050694 | Ga0070672_1000506942 | 222 |
| 345 | 3300006195 | Ga0075366_10036429 | Ga0075366_100364294 | 222 |
| 346 | 3300006195 | Ga0075366_10160212 | Ga0075366_101602121 | 222 |
| 347 | 3300006353 | Ga0075370_10000142 | Ga0075370_1000014222 | 222 |
| 348 | 3300006353 | Ga0075370_10143256 | Ga0075370_101432562 | 222 |
| 349 | 3300009148 | Ga0105243_10099669 | Ga0105243_100996692 | 222 |
| 350 | 3300009176 | Ga0105242_10001267 | Ga0105242_1000126710 | 222 |
| 351 | 3300013308 | Ga0157375_10168125 | Ga0157375_101681255 | 222 |
| 352 | 3300014325 | Ga0163163_10519715 | Ga0163163_105197152 | 222 |
| 353 | 3300014745 | Ga0157377_10195360 | Ga0157377_101953601 | 222 |
| 354 | 3300025298 | Ga0209050_1000799 | Ga0209050_100079937 | 222 |
| 355 | 3300025303 | Ga0209051_1030024 | Ga0209051_10300242 | 222 |
| 356 | 3300025907 | Ga0207645_10060630 | Ga0207645_100606302 | 222 |
| 357 | 3300025925 | Ga0207650_10076434 | Ga0207650_100764344 | 222 |
| 358 | 3300025926 | Ga0207659_10098310 | Ga0207659_100983103 | 222 |
| 359 | 3300025931 | Ga0207644_10061537 | Ga0207644_100615372 | 222 |
| 360 | 3300025933 | Ga0207706_10230598 | Ga0207706_102305983 | 222 |
| 361 | 3300025934 | Ga0207686_10018660 | Ga0207686_100186603 | 222 |
| 362 | 3300025940 | Ga0207691_10080650 | Ga0207691_100806503 | 222 |
| 363 | 3300025942 | Ga0207689_10423688 | Ga0207689_104236882 | 222 |
| 364 | 3300025960 | Ga0207651_10064540 | Ga0207651_100645403 | 222 |
| 365 | 3300026023 | Ga0207677_10075816 | Ga0207677_100758163 | 222 |
| 366 | 3300026089 | Ga0207648_10161244 | Ga0207648_101612443 | 222 |
| 367 | 3300028794 | Ga0307515_10011753 | Ga0307515_100117538 | 222 |
| 368 | 3300028794 | Ga0307515_10179398 | Ga0307515_101793982 | 222 |
| 369 | 3300030522 | Ga0307512_10096586 | Ga0307512_100965862 | 222 |
| 370 | 3300031239 | Ga0265328_10020766 | Ga0265328_100207662 | 222 |
| 371 | 3300031251 | Ga0265327_10000924 | Ga0265327_1000092428 | 222 |
| 372 | 3300031456 | Ga0307513_10010837 | Ga0307513_100108372 | 222 |
| 373 | 3300031507 | Ga0307509_10038943 | Ga0307509_100389436 | 222 |
| 374 | 3300031507 | Ga0307509_10065554 | Ga0307509_100655542 | 222 |
| 375 | 3300031507 | Ga0307509_10290623 | Ga0307509_102906233 | 222 |
| 376 | 3300031616 | Ga0307508_10004752 | Ga0307508_1000475214 | 222 |
| 377 | 3300031649 | Ga0307514_10146712 | Ga0307514_101467121 | 222 |
| 378 | 3300033179 | Ga0307507_10092918 | Ga0307507_100929182 | 222 |
| 379 | 3300033180 | Ga0307510_10003419 | Ga0307510_1000341910 | 222 |
| 380 | 3300033180 | Ga0307510_10033328 | Ga0307510_100333286 | 222 |
| 381 | 3300035084 | Ga0373928_0014086 | Ga0373928_0014086_783_1451 | 222 |
| 382 | 3300035691 | Ga0373931_0128594 | Ga0373931_0128594_739_1407 | 222 |
| 383 | 3300042876 | Ga0451577_0011181 | Ga0451577_0011181_3994_4716 | 222 |
| 384 | 3300044673 | Ga0453683_0153151 | Ga0453683_0153151_322_1044 | 222 |
| 385 | 3300045051 | Ga0451576_0022025 | Ga0451576_0022025_6136_6858 | 222 |
| 386 | 3300046454 | Ga0495592_0000528 | Ga0495592_0000528_11179_11847 | 222 |
| 387 | 3300046460 | Ga0495638_0195584 | Ga0495638_0195584_130_798 | 222 |
| 388 | 3300046507 | Ga0495606_0046495 | Ga0495606_0046495_544_1212 | 222 |
| 389 | 3300046507 | Ga0495606_0151581 | Ga0495606_0151581_454_1122 | 222 |
| 390 | 3300046512 | Ga0495610_0061187 | Ga0495610_0061187_359_1027 | 222 |
| 391 | 3300046516 | Ga0495628_0499329 | Ga0495628_0499329_120_788 | 222 |
| 392 | 3300046517 | Ga0495630_0132527 | Ga0495630_0132527_153_821 | 222 |
| 393 | 3300046519 | Ga0495632_0157544 | Ga0495632_0157544_94_762 | 222 |
| 394 | 3300046660 | Ga0495625_0280749 | Ga0495625_0280749_299_967 | 222 |
| 395 | 3300046683 | Ga0495658_0373100 | Ga0495658_0373100_31_699 | 222 |
| 396 | 3300046690 | Ga0495624_0168579 | Ga0495624_0168579_468_1136 | 222 |
| 397 | 3300046694 | Ga0495649_0226441 | Ga0495649_0226441_52_720 | 222 |
| 398 | 3300047321 | Ga0495676_0019792 | Ga0495676_0019792_586_1254 | 222 |
| 399 | 3300047472 | Ga0495686_0115238 | Ga0495686_0115238_649_1320 | 222 |
| 400 | 3300048915 | Ga0496112_0435218 | Ga0496112_0435218_356_1024 | 222 |
| 401 | 3300049460 | Ga0495682_0137470 | Ga0495682_0137470_183_851 | 222 |
| 402 | 3300050496 | nmdc:mga07m45_142595_c1 | nmdc:mga07m45_142595_c1_354_1055 | 222 |
| 403 | 3300050496 | nmdc:mga07m45_82398_c1 | nmdc:mga07m45_82398_c1_729_1397 | 222 |
| 404 | 3300053136 | Ga0500559_0000265 | Ga0500559_0000265_28271_28939 | 222 |
| 405 | 3300053139 | Ga0500568_0105393 | Ga0500568_0105393_347_1015 | 222 |
| 406 | 3300053156 | Ga0500622_0002039 | Ga0500622_0002039_2118_2786 | 222 |
| 407 | 3300053730 | Ga0500645_003124 | Ga0500645_003124_246_914 | 222 |
| 408 | 3300053739 | Ga0500587_005322 | Ga0500587_005322_588_1256 | 222 |
| 409 | 3300003775 | Ga0055524_1000139 | Ga0055524_100013926 | 223 |
| 410 | 3300003791 | Ga0055530_10004180 | Ga0055530_100041805 | 223 |
| 411 | 3300003792 | Ga0055540_1000090 | Ga0055540_100009027 | 223 |
| 412 | 3300003792 | Ga0055540_1000091 | Ga0055540_100009125 | 223 |
| 413 | 3300003794 | Ga0055531_10004796 | Ga0055531_100047968 | 223 |
| 414 | 3300005355 | Ga0070671_100042415 | Ga0070671_1000424152 | 223 |
| 415 | 3300005356 | Ga0070674_100035498 | Ga0070674_1000354984 | 223 |
| 416 | 3300005364 | Ga0070673_100597514 | Ga0070673_1005975142 | 223 |
| 417 | 3300005543 | Ga0070672_100652605 | Ga0070672_1006526052 | 223 |
| 418 | 3300005548 | Ga0070665_100058116 | Ga0070665_1000581164 | 223 |
| 419 | 3300005617 | Ga0068859_100286744 | Ga0068859_1002867442 | 223 |
| 420 | 3300005618 | Ga0068864_100035355 | Ga0068864_1000353555 | 223 |
| 421 | 3300006048 | Ga0075363_100186555 | Ga0075363_1001865552 | 223 |
| 422 | 3300006195 | Ga0075366_10000582 | Ga0075366_1000058213 | 223 |
| 423 | 3300006353 | Ga0075370_10002800 | Ga0075370_100028005 | 223 |
| 424 | 3300006353 | Ga0075370_10057297 | Ga0075370_100572972 | 223 |
| 425 | 3300006931 | Ga0097620_100286764 | Ga0097620_1002867642 | 223 |
| 426 | 3300009098 | Ga0105245_10111121 | Ga0105245_101111212 | 223 |
| 427 | 3300013306 | Ga0163162_10457890 | Ga0163162_104578902 | 223 |
| 428 | 3300025298 | Ga0209050_1000326 | Ga0209050_100032663 | 223 |
| 429 | 3300025299 | Ga0209256_1000019 | Ga0209256_1000019496 | 223 |
| 430 | 3300025303 | Ga0209051_1000133 | Ga0209051_100013328 | 223 |
| 431 | 3300025304 | Ga0209257_1000038 | Ga0209257_100003828 | 223 |
| 432 | 3300025927 | Ga0207687_10275771 | Ga0207687_102757713 | 223 |
| 433 | 3300025937 | Ga0207669_10034388 | Ga0207669_100343883 | 223 |
| 434 | 3300025937 | Ga0207669_10470736 | Ga0207669_104707361 | 223 |
| 435 | 3300025940 | Ga0207691_10481919 | Ga0207691_104819192 | 223 |
| 436 | 3300026023 | Ga0207677_10259992 | Ga0207677_102599922 | 223 |
| 437 | 3300026121 | Ga0207683_10516442 | Ga0207683_105164422 | 223 |
| 438 | 3300027111 | Ga0209281_1000098 | Ga0209281_100009822 | 223 |
| 439 | 3300028786 | Ga0307517_10173770 | Ga0307517_101737702 | 223 |
| 440 | 3300031507 | Ga0307509_10449407 | Ga0307509_104494072 | 223 |
| 441 | 3300032002 | Ga0307416_100415644 | Ga0307416_1004156443 | 223 |
| 442 | 3300037471 | Ga0395905_0005385 | Ga0395905_0005385_10428_11105 | 223 |
| 443 | 3300048905 | Ga0496102_0019151 | Ga0496102_0019151_3749_4420 | 223 |
| 444 | 3300049668 | Ga0501233_011743 | Ga0501233_011743_214_915 | 223 |
| 445 | 3300049683 | Ga0501253_024256 | Ga0501253_024256_16_717 | 223 |
| 446 | 3300049686 | Ga0501257_039041 | Ga0501257_039041_114_815 | 223 |
| 447 | 3300049762 | Ga0501265_005711 | Ga0501265_005711_479_1180 | 223 |
| 448 | 3300050493 | nmdc:mga0k408_21052_c1 | nmdc:mga0k408_21052_c1_2674_3378 | 223 |
| 449 | 3300050493 | nmdc:mga0k408_5321_c1 | nmdc:mga0k408_5321_c1_437_1108 | 223 |
| 450 | 3300050496 | nmdc:mga07m45_1876_c1 | nmdc:mga07m45_1876_c1_3412_4083 | 223 |
| 451 | 3300050496 | nmdc:mga07m45_50139_c1 | nmdc:mga07m45_50139_c1_308_979 | 223 |
| 452 | iso_pu_bacteria | 2585428062 | 2587758925 | 223 |
| 453 | 3300003759 | Ga0055525_1000056 | Ga0055525_1000056176 | 224 |
| 454 | 3300005328 | Ga0070676_10068154 | Ga0070676_100681543 | 224 |
| 455 | 3300005355 | Ga0070671_100082453 | Ga0070671_1000824532 | 224 |
| 456 | 3300005455 | Ga0070663_100127553 | Ga0070663_1001275532 | 224 |
| 457 | 3300005459 | Ga0068867_100046359 | Ga0068867_1000463592 | 224 |
| 458 | 3300005459 | Ga0068867_100211512 | Ga0068867_1002115123 | 224 |
| 459 | 3300005578 | Ga0068854_100057248 | Ga0068854_1000572482 | 224 |
| 460 | 3300005616 | Ga0068852_100048807 | Ga0068852_1000488072 | 224 |
| 461 | 3300006038 | Ga0075365_10082684 | Ga0075365_100826844 | 224 |
| 462 | 3300006042 | Ga0075368_10003231 | Ga0075368_100032317 | 224 |
| 463 | 3300006048 | Ga0075363_100000145 | Ga0075363_1000001459 | 224 |
| 464 | 3300006048 | Ga0075363_100159152 | Ga0075363_1001591523 | 224 |
| 465 | 3300006051 | Ga0075364_10034817 | Ga0075364_100348172 | 224 |
| 466 | 3300006051 | Ga0075364_10097895 | Ga0075364_100978953 | 224 |
| 467 | 3300006177 | Ga0075362_10000580 | Ga0075362_1000058012 | 224 |
| 468 | 3300006177 | Ga0075362_10003899 | Ga0075362_100038992 | 224 |
| 469 | 3300006178 | Ga0075367_10004330 | Ga0075367_100043302 | 224 |
| 470 | 3300006178 | Ga0075367_10012127 | Ga0075367_100121275 | 224 |
| 471 | 3300006178 | Ga0075367_10076032 | Ga0075367_100760322 | 224 |
| 472 | 3300006186 | Ga0075369_10018407 | Ga0075369_100184072 | 224 |
| 473 | 3300006186 | Ga0075369_10082969 | Ga0075369_100829692 | 224 |
| 474 | 3300006195 | Ga0075366_10022472 | Ga0075366_100224722 | 224 |
| 475 | 3300006195 | Ga0075366_10062429 | Ga0075366_100624292 | 224 |
| 476 | 3300006195 | Ga0075366_10305605 | Ga0075366_103056052 | 224 |
| 477 | 3300006195 | Ga0075366_10381676 | Ga0075366_103816761 | 224 |
| 478 | 3300006353 | Ga0075370_10000854 | Ga0075370_100008547 | 224 |
| 479 | 3300006353 | Ga0075370_10010740 | Ga0075370_100107406 | 224 |
| 480 | 3300006353 | Ga0075370_10129241 | Ga0075370_101292412 | 224 |
| 481 | 3300009093 | Ga0105240_10628568 | Ga0105240_106285682 | 224 |
| 482 | 3300009098 | Ga0105245_10707779 | Ga0105245_107077792 | 224 |
| 483 | 3300009148 | Ga0105243_10169051 | Ga0105243_101690512 | 224 |
| 484 | 3300009545 | Ga0105237_10044846 | Ga0105237_100448466 | 224 |
| 485 | 3300010375 | Ga0105239_10466380 | Ga0105239_104663802 | 224 |
| 486 | 3300025230 | Ga0209563_100014 | Ga0209563_10001418 | 224 |
| 487 | 3300025907 | Ga0207645_10215254 | Ga0207645_102152542 | 224 |
| 488 | 3300025907 | Ga0207645_10281229 | Ga0207645_102812292 | 224 |
| 489 | 3300025914 | Ga0207671_10031240 | Ga0207671_100312403 | 224 |
| 490 | 3300025931 | Ga0207644_10160485 | Ga0207644_101604853 | 224 |
| 491 | 3300025981 | Ga0207640_10126527 | Ga0207640_101265272 | 224 |
| 492 | 3300026067 | Ga0207678_10144564 | Ga0207678_101445642 | 224 |
| 493 | 3300026089 | Ga0207648_10066548 | Ga0207648_100665482 | 224 |
| 494 | 3300026089 | Ga0207648_10178308 | Ga0207648_101783083 | 224 |
| 495 | 3300026142 | Ga0207698_10144531 | Ga0207698_101445312 | 224 |
| 496 | 3300026142 | Ga0207698_10448473 | Ga0207698_104484732 | 224 |
| 497 | 3300031456 | Ga0307513_10052373 | Ga0307513_100523733 | 224 |
| 498 | 3300031616 | Ga0307508_10279184 | Ga0307508_102791842 | 224 |
| 499 | 3300031730 | Ga0307516_10054856 | Ga0307516_100548563 | 224 |
| 500 | 3300033180 | Ga0307510_10245266 | Ga0307510_102452662 | 224 |
| 501 | 3300041498 | Ga0451841_0330404 | Ga0451841_0330404_153_827 | 224 |
| 502 | 3300042121 | Ga0450919_001362 | Ga0450919_001362_518_1192 | 224 |
| 503 | 3300042122 | Ga0450920_023976 | Ga0450920_023976_417_1091 | 224 |
| 504 | 3300042435 | Ga0439434_0018569 | Ga0439434_0018569_832_1518 | 224 |
| 505 | 3300042531 | Ga0450918_000283 | Ga0450918_000283_2373_3047 | 224 |
| 506 | 3300046519 | Ga0495632_0027029 | Ga0495632_0027029_1602_2276 | 224 |
| 507 | 3300046525 | Ga0495663_0072460 | Ga0495663_0072460_97_801 | 224 |
| 508 | 3300046542 | Ga0495597_0042908 | Ga0495597_0042908_287_961 | 224 |
| 509 | 3300046558 | Ga0495633_0010434 | Ga0495633_0010434_3774_4478 | 224 |
| 510 | 3300046694 | Ga0495649_0003993 | Ga0495649_0003993_8675_9349 | 224 |
| 511 | 3300046810 | Ga0495660_0035588 | Ga0495660_0035588_1547_2221 | 224 |
| 512 | 3300047443 | Ga0495687_001797 | Ga0495687_001797_5385_6059 | 224 |
| 513 | 3300048091 | Ga0495626_0045695 | Ga0495626_0045695_116_790 | 224 |
| 514 | 3300048912 | Ga0496109_0709054 | Ga0496109_0709054_203_901 | 224 |
| 515 | 3300048926 | Ga0496123_0193140 | Ga0496123_0193140_295_999 | 224 |
| 516 | 3300050489 | nmdc:mga03683_193631_c1 | nmdc:mga03683_193631_c1_30_704 | 224 |
| 517 | 3300050489 | nmdc:mga03683_41757_c1 | nmdc:mga03683_41757_c1_271_945 | 224 |
| 518 | 3300050490 | nmdc:mga03n38_128795_c1 | nmdc:mga03n38_128795_c1_440_1114 | 224 |
| 519 | 3300050490 | nmdc:mga03n38_345959_c1 | nmdc:mga03n38_345959_c1_68_742 | 224 |
| 520 | 3300050490 | nmdc:mga03n38_4126_c1 | nmdc:mga03n38_4126_c1_2997_3671 | 224 |
| 521 | 3300050491 | nmdc:mga00v17_27516_c1 | nmdc:mga00v17_27516_c1_2456_3130 | 224 |
| 522 | 3300050491 | nmdc:mga00v17_8528_c1 | nmdc:mga00v17_8528_c1_2890_3564 | 224 |
| 523 | 3300050492 | nmdc:mga0yw44_69791_c1 | nmdc:mga0yw44_69791_c1_825_1499 | 224 |
| 524 | 3300050493 | nmdc:mga0k408_11041_c1 | nmdc:mga0k408_11041_c1_968_1642 | 224 |
| 525 | 3300050493 | nmdc:mga0k408_13795_c1 | nmdc:mga0k408_13795_c1_2741_3415 | 224 |
| 526 | 3300050493 | nmdc:mga0k408_4980_c1 | nmdc:mga0k408_4980_c1_4743_5417 | 224 |
| 527 | 3300050493 | nmdc:mga0k408_5383_c1 | nmdc:mga0k408_5383_c1_1468_2142 | 224 |
| 528 | 3300050493 | nmdc:mga0k408_74914_c1 | nmdc:mga0k408_74914_c1_880_1554 | 224 |
| 529 | 3300050493 | nmdc:mga0k408_76377_c1 | nmdc:mga0k408_76377_c1_411_1085 | 224 |
| 530 | 3300050494 | nmdc:mga06z11_121291_c1 | nmdc:mga06z11_121291_c1_499_1173 | 224 |
| 531 | 3300050494 | nmdc:mga06z11_3034_c1 | nmdc:mga06z11_3034_c1_3478_4152 | 224 |
| 532 | 3300050494 | nmdc:mga06z11_70879_c1 | nmdc:mga06z11_70879_c1_588_1262 | 224 |
| 533 | 3300050495 | nmdc:mga04h51_5190_c1 | nmdc:mga04h51_5190_c1_2404_3078 | 224 |
| 534 | 3300050496 | nmdc:mga07m45_1136_c1 | nmdc:mga07m45_1136_c1_8007_8681 | 224 |
| 535 | 3300050496 | nmdc:mga07m45_149947_c1 | nmdc:mga07m45_149947_c1_650_1324 | 224 |
| 536 | 3300050496 | nmdc:mga07m45_17485_c1 | nmdc:mga07m45_17485_c1_2620_3294 | 224 |
| 537 | 3300050496 | nmdc:mga07m45_27001_c1 | nmdc:mga07m45_27001_c1_1441_2115 | 224 |
| 538 | 3300050496 | nmdc:mga07m45_369984_c1 | nmdc:mga07m45_369984_c1_125_799 | 224 |
| 539 | 3300050496 | nmdc:mga07m45_476129_c1 | nmdc:mga07m45_476129_c1_16_690 | 224 |
| 540 | 3300050496 | nmdc:mga07m45_59872_c1 | nmdc:mga07m45_59872_c1_868_1542 | 224 |
| 541 | 3300050516 | nmdc:mga0sz30_12980_c1 | nmdc:mga0sz30_12980_c1_824_1498 | 224 |
| 542 | 3300050516 | nmdc:mga0sz30_139147_c1 | nmdc:mga0sz30_139147_c1_114_788 | 224 |
| 543 | 3300053134 | Ga0500658_0016399 | Ga0500658_0016399_2057_2731 | 224 |
| 544 | 3300005367 | Ga0070667_100006649 | Ga0070667_10000664911 | 225 |
| 545 | 3300005548 | Ga0070665_100901408 | Ga0070665_1009014082 | 225 |
| 546 | 3300014968 | Ga0157379_10500916 | Ga0157379_105009162 | 225 |
| 547 | 3300025986 | Ga0207658_10006476 | Ga0207658_100064765 | 225 |
| 548 | 3300031548 | Ga0307408_100246376 | Ga0307408_1002463761 | 225 |
| 549 | 3300031731 | Ga0307405_10020862 | Ga0307405_100208624 | 225 |
| 550 | 3300031824 | Ga0307413_10229807 | Ga0307413_102298072 | 225 |
| 551 | 3300031852 | Ga0307410_10057965 | Ga0307410_100579653 | 225 |
| 552 | 3300031901 | Ga0307406_10035628 | Ga0307406_100356282 | 225 |
| 553 | 3300031903 | Ga0307407_10026775 | Ga0307407_100267754 | 225 |
| 554 | 3300031911 | Ga0307412_10016042 | Ga0307412_100160422 | 225 |
| 555 | 3300031995 | Ga0307409_100087784 | Ga0307409_1000877843 | 225 |
| 556 | 3300032002 | Ga0307416_100166662 | Ga0307416_1001666623 | 225 |
| 557 | 3300032005 | Ga0307411_10043269 | Ga0307411_100432694 | 225 |
| 558 | 3300032126 | Ga0307415_100029395 | Ga0307415_1000293952 | 225 |
| 559 | 3300037068 | Ga0373925_0039291 | Ga0373925_0039291_1191_1868 | 225 |
| 560 | 3300048924 | Ga0496121_0407793 | Ga0496121_0407793_53_730 | 225 |
| 561 | 3300005344 | Ga0070661_100000229 | Ga0070661_1000002294 | 226 |
| 562 | 3300005366 | Ga0070659_100009239 | Ga0070659_1000092397 | 226 |
| 563 | 3300005445 | Ga0070708_100769021 | Ga0070708_1007690211 | 226 |
| 564 | 3300005467 | Ga0070706_100000367 | Ga0070706_10000036714 | 226 |
| 565 | 3300005468 | Ga0070707_100386312 | Ga0070707_1003863122 | 226 |
| 566 | 3300005468 | Ga0070707_100564759 | Ga0070707_1005647591 | 226 |
| 567 | 3300005518 | Ga0070699_100219331 | Ga0070699_1002193313 | 226 |
| 568 | 3300005564 | Ga0070664_100002915 | Ga0070664_1000029152 | 226 |
| 569 | 3300005564 | Ga0070664_100071927 | Ga0070664_1000719272 | 226 |
| 570 | 3300005844 | Ga0068862_100436574 | Ga0068862_1004365742 | 226 |
| 571 | 3300006178 | Ga0075367_10002249 | Ga0075367_100022497 | 226 |
| 572 | 3300006946 | Ga0079104_1000623 | Ga0079104_100062329 | 226 |
| 573 | 3300009092 | Ga0105250_10000388 | Ga0105250_1000038823 | 226 |
| 574 | 3300009148 | Ga0105243_10007502 | Ga0105243_100075023 | 226 |
| 575 | 3300025711 | Ga0207696_1002807 | Ga0207696_10028075 | 226 |
| 576 | 3300025922 | Ga0207646_10403551 | Ga0207646_104035512 | 226 |
| 577 | 3300025933 | Ga0207706_10091751 | Ga0207706_100917512 | 226 |
| 578 | 3300025935 | Ga0207709_10000696 | Ga0207709_100006968 | 226 |
| 579 | 3300025945 | Ga0207679_10000339 | Ga0207679_1000033911 | 226 |
| 580 | 3300027111 | Ga0209281_1000072 | Ga0209281_1000072139 | 226 |
| 581 | iso_pu_bacteria | 2721755523 | 2722881241 | 226 |
| 582 | iso_pu_bacteria | 2839138175 | 2839142963 | 226 |
| 583 | 3300005290 | Ga0065712_10112866 | Ga0065712_101128661 | 227 |
| 584 | 3300005331 | Ga0070670_100000775 | Ga0070670_10000077514 | 227 |
| 585 | 3300005333 | Ga0070677_10075135 | Ga0070677_100751352 | 227 |
| 586 | 3300005338 | Ga0068868_100235045 | Ga0068868_1002350452 | 227 |
| 587 | 3300005347 | Ga0070668_100442393 | Ga0070668_1004423931 | 227 |
| 588 | 3300005353 | Ga0070669_100020944 | Ga0070669_1000209445 | 227 |
| 589 | 3300005354 | Ga0070675_100001482 | Ga0070675_10000148215 | 227 |
| 590 | 3300005355 | Ga0070671_100020586 | Ga0070671_1000205865 | 227 |
| 591 | 3300005456 | Ga0070678_100196618 | Ga0070678_1001966182 | 227 |
| 592 | 3300005459 | Ga0068867_100002317 | Ga0068867_1000023179 | 227 |
| 593 | 3300005543 | Ga0070672_100000485 | Ga0070672_10000048514 | 227 |
| 594 | 3300005548 | Ga0070665_100190031 | Ga0070665_1001900312 | 227 |
| 595 | 3300005564 | Ga0070664_100091085 | Ga0070664_1000910854 | 227 |
| 596 | 3300005618 | Ga0068864_100456503 | Ga0068864_1004565032 | 227 |
| 597 | 3300006237 | Ga0097621_100134922 | Ga0097621_1001349222 | 227 |
| 598 | 3300006881 | Ga0068865_100160693 | Ga0068865_1001606932 | 227 |
| 599 | 3300013308 | Ga0157375_10411959 | Ga0157375_104119592 | 227 |
| 600 | 3300014969 | Ga0157376_10101365 | Ga0157376_101013652 | 227 |
| 601 | 3300017792 | Ga0163161_10092954 | Ga0163161_100929543 | 227 |
| 602 | 3300025321 | Ga0207656_10113634 | Ga0207656_101136342 | 227 |
| 603 | 3300025893 | Ga0207682_10004387 | Ga0207682_100043874 | 227 |
| 604 | 3300025923 | Ga0207681_10060602 | Ga0207681_100606023 | 227 |
| 605 | 3300025925 | Ga0207650_10000275 | Ga0207650_1000027547 | 227 |
| 606 | 3300025926 | Ga0207659_10003305 | Ga0207659_100033059 | 227 |
| 607 | 3300025931 | Ga0207644_10005477 | Ga0207644_100054774 | 227 |
| 608 | 3300025937 | Ga0207669_10342375 | Ga0207669_103423752 | 227 |
| 609 | 3300025938 | Ga0207704_10120769 | Ga0207704_101207693 | 227 |
| 610 | 3300025940 | Ga0207691_10001335 | Ga0207691_1000133522 | 227 |
| 611 | 3300025945 | Ga0207679_10078325 | Ga0207679_100783254 | 227 |
| 612 | 3300025960 | Ga0207651_10008298 | Ga0207651_100082987 | 227 |
| 613 | 3300026023 | Ga0207677_10084359 | Ga0207677_100843592 | 227 |
| 614 | 3300026041 | Ga0207639_10413635 | Ga0207639_104136352 | 227 |
| 615 | 3300026089 | Ga0207648_10063438 | Ga0207648_100634382 | 227 |
| 616 | 3300026095 | Ga0207676_10029853 | Ga0207676_100298532 | 227 |
| 617 | 3300026121 | Ga0207683_10061301 | Ga0207683_100613012 | 227 |
| 618 | 3300027876 | Ga0209974_10019124 | Ga0209974_100191241 | 227 |
| 619 | 3300031730 | Ga0307516_10001028 | Ga0307516_1000102813 | 227 |
| 620 | 3300037471 | Ga0395905_0004449 | Ga0395905_0004449_12865_13587 | 227 |
| 621 | 3300041456 | Ga0451795_0058901 | Ga0451795_0058901_650_1420 | 227 |
| 622 | 3300041459 | Ga0451800_0280383 | Ga0451800_0280383_539_1309 | 227 |
| 623 | 3300044656 | Ga0466969_0035601 | Ga0466969_0035601_1297_1992 | 227 |
| 624 | 3300044683 | Ga0466965_0132402 | Ga0466965_0132402_221_916 | 227 |
| 625 | 3300044684 | Ga0466966_0237819 | Ga0466966_0237819_87_782 | 227 |
| 626 | 3300044693 | Ga0466961_0005169 | Ga0466961_0005169_160_855 | 227 |
| 627 | 3300045049 | Ga0466959_0028817 | Ga0466959_0028817_2290_2985 | 227 |
| 628 | 3300046519 | Ga0495632_0034016 | Ga0495632_0034016_307_1077 | 227 |
| 629 | 3300046542 | Ga0495597_0001717 | Ga0495597_0001717_8992_9726 | 227 |
| 630 | 3300046660 | Ga0495625_0027381 | Ga0495625_0027381_582_1352 | 227 |
| 631 | 3300050493 | nmdc:mga0k408_322552_c1 | nmdc:mga0k408_322552_c1_126_896 | 227 |
| 632 | 3300050496 | nmdc:mga07m45_179112_c1 | nmdc:mga07m45_179112_c1_360_1130 | 227 |
| 633 | 3300050496 | nmdc:mga07m45_179352_c1 | nmdc:mga07m45_179352_c1_104_874 | 227 |
| 634 | 3300050496 | nmdc:mga07m45_47236_c1 | nmdc:mga07m45_47236_c1_934_1704 | 227 |
| 635 | 3300053739 | Ga0500587_000568 | Ga0500587_000568_357_1127 | 227 |
| 636 | 3300061719 | Ga0466962_0027267 | Ga0466962_0027267_1632_2327 | 227 |
| 637 | 3300005353 | Ga0070669_100255740 | Ga0070669_1002557402 | 228 |
| 638 | 3300005355 | Ga0070671_100285619 | Ga0070671_1002856192 | 228 |
| 639 | 3300005618 | Ga0068864_100018209 | Ga0068864_1000182093 | 228 |
| 640 | 3300009177 | Ga0105248_10112249 | Ga0105248_101122492 | 228 |
| 641 | 3300009553 | Ga0105249_10062676 | Ga0105249_100626764 | 228 |
| 642 | 3300026095 | Ga0207676_10019987 | Ga0207676_100199874 | 228 |
| 643 | 3300036401 | Ga0373937_0369994 | Ga0373937_0369994_385_1077 | 228 |
| 644 | 3300047472 | Ga0495686_0171187 | Ga0495686_0171187_427_1119 | 228 |
| 645 | 3300048908 | Ga0496105_0349373 | Ga0496105_0349373_437_1138 | 228 |
| 646 | 3300048909 | Ga0496106_0013343 | Ga0496106_0013343_4343_5035 | 228 |
| 647 | 3300048912 | Ga0496109_0725556 | Ga0496109_0725556_28_729 | 228 |
| 648 | 3300048915 | Ga0496112_0109655 | Ga0496112_0109655_613_1314 | 228 |
| 649 | 3300048916 | Ga0496113_0040369 | Ga0496113_0040369_793_1494 | 228 |
| 650 | 3300053136 | Ga0500559_0017226 | Ga0500559_0017226_414_1115 | 228 |
| 651 | 3300013105 | Ga0157369_10588827 | Ga0157369_105888272 | 229 |
| 652 | 3300046616 | Ga0495668_0259086 | Ga0495668_0259086_97_804 | 229 |
| 653 | 3300048925 | Ga0496122_0147468 | Ga0496122_0147468_313_1050 | 230 |
| 654 | 3300048926 | Ga0496123_0067285 | Ga0496123_0067285_1268_2005 | 230 |
| 655 | 3300048928 | Ga0496125_0070525 | Ga0496125_0070525_1260_1997 | 230 |
| 656 | 3300048929 | Ga0496126_0120194 | Ga0496126_0120194_233_970 | 230 |
| 657 | 3300001979 | JGI24740J21852_10004370 | JGI24740J21852_100043704 | 235 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1w66-assembly1.cif.gz_A | structure of a lipoate-protein ligase b from mycobacterium tuberculosis | 0.9172 | 9 | 230 |
| 2qhv-assembly1.cif.gz_A | structural basis of octanoic acid recognition by lipoate-protein ligase b | 0.8909 | 9 | 227 |
| 2qhv-assembly1.cif.gz_A | structural basis of octanoic acid recognition by lipoate-protein ligase b | 0.8626 | 9 | 227 |
| 1w66-assembly1.cif.gz_A | structure of a lipoate-protein ligase b from mycobacterium tuberculosis | 0.8569 | 9 | 230 |
| 2c7i-assembly2.cif.gz_B | structure of protein ta0514, putative lipoate protein ligase from t. acidophilum. | 0.7635 | 9 | 228 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P60720_2_203_3.30.930.10 | Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 | 0.9778 | 8 | 228 | 3.30.930.10 |
| af_P60720_2_203_3.30.930.10 | Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 | 0.9683 | 8 | 228 | 3.30.930.10 |
| 1w66A01 | Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 | 0.9208 | 9 | 228 | 3.30.930.10 |
| af_Q9SXP7_6_215_3.30.930.10 | Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 | 0.9004 | 11 | 228 | 3.30.930.10 |
| 2qhuA01 | Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 | 0.8926 | 9 | 227 | 3.30.930.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D3D3L3-F1-model_v4 | deleted | 0.9953 | 11 | 89 |
|
| AF-A0A2W5KUB8-F1-model_v4 | deleted | 0.9927 | 29 | 118 |
|
| AF-A0A1T2L6V6-F1-model_v4 | lipoyl(octanoyl) transferase (EC 2.3.1.181) | 0.9922 | 19 | 216 |
GO:0033819
|
| AF-A0A1P8FGQ7-F1-model_v4 | Octanoyltransferase (EC 2.3.1.181) (Lipoate-protein ligase B) (Lipoyl/octanoyl transferase) (Octanoyl-[acyl-carrier-protein]-protein N-octanoyltransferase) | 0.992 | 13 | 228 |
GO:0005737
GO:0033819 |
| AF-A0A7Y2HUV1-F1-model_v4 | lipoyl(octanoyl) transferase (EC 2.3.1.181) | 0.99 | 11 | 136 |
GO:0033819
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar