F473069

General Info

Members Datasets Scaffolds Average Seq Length
657 336 640 227

Family's Representative Sequence

Representative Sequence 3300005290|Ga0065712_10112866|Ga0065712_101128661
Length 266
Sequence MQAGADVASHRSGASPPEASDLADMALADPPGTVGPARLRAVGQIDCAQAIAAMQEFTERRQPDTTDEIWLCEHPPVYTLGLAGDPAHILSAGGIPVLRTNRGGQVTYHGPGQVVAYPLVDLRRLGLYVKEYVHRLEQALIRTLEAYGVTGHRVAGAPGIYVRTDDPFGHAALDPHSLAERHADRDAGPSFDRLAKIAALGIKVSRHCTYHGVALNVAMDLRPFSGIDACGYVGLETVDLSTIGVQAEVGDVAEVLGSKLRAFLSP

Samples

Sample ID Description Type Environment
1 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
2 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
3 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
4 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
5 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
6 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
7 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
8 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
9 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
10 2643221660 Methylibium sp. Root1272 Isolate Unclassified
11 2721755523 Delftia sp. HK171 Isolate Unclassified
12 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
13 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
14 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
15 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
16 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
17 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
18 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
19 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
20 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
21 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
22 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
23 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
24 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
25 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
26 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
27 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
28 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
29 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
30 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
31 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
32 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
33 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
34 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
35 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
36 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
37 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
38 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
39 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
40 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
41 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
42 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
43 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
44 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
45 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
46 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
47 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
48 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
49 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
50 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
51 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
52 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
53 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
54 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
55 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
56 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
73 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
74 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
75 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
76 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
77 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
78 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
79 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
82 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
86 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
108 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
110 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
111 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
113 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
114 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
116 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
117 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
119 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
160 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
169 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
170 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
171 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
172 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
173 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
174 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
175 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
176 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
177 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
178 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
179 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
180 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
181 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
182 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
183 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
184 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
185 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
186 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
187 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
188 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
189 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
190 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
191 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
192 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
193 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
194 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
195 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
196 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
197 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
198 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
199 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
200 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
201 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
202 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
203 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
204 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
205 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
206 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
207 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
208 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
209 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
210 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
211 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
212 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
213 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
214 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
215 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
216 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
217 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
218 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
219 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
220 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
221 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
222 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
223 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
224 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
225 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
226 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
227 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
228 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
229 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
230 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
231 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
232 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
233 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
234 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
235 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
236 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
237 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
238 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
239 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
240 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
241 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
242 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
243 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
244 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
245 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
246 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
247 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
248 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
249 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
250 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
251 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
252 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
253 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
254 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
255 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
256 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
257 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
258 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
259 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
260 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
261 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
262 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
263 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
264 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
265 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
266 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
267 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
268 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
269 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
270 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
271 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
272 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
273 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
274 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
275 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
276 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
277 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
278 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
279 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
280 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
281 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
282 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
283 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
284 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
285 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
286 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
287 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
288 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
289 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
290 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
292 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
297 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
298 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
299 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
300 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
301 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
302 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
303 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
304 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
305 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
306 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
307 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
308 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
309 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
310 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
311 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
312 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
313 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
314 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
315 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
316 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
317 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
318 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
319 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
320 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
321 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
322 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
323 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
324 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
325 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
326 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
327 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
328 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
329 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
330 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
331 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
332 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
333 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
334 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
335 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
336 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.41
Metatranscriptomes 0
Isolates 2.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 24.2
Nodule 0.46
Rhizoplane 3.2
Rhizosphere 62.1
Stem 0
Stem Tuber 0
Unclassified 10.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10004370 3300001979 Bacteria 6085
2 JGI25152J39213_1001430 3300002773 Bacteria 10303
3 JGI25153J46596_10006137 3300003215 Bacteria 6160
4 rootL2_10000529 3300003322 Bacteria 63830
5 rootL2_10110021 3300003322 Bacteria 2090
6 rootH1_10046360 3300003323 Bacteria 2165
7 Ga0055525_1000056 3300003759 Bacteria 212321
8 Ga0055526_1012878 3300003771 Bacteria 3596
9 Ga0055526_1019644 3300003771 Bacteria 2451
10 Ga0055524_1000139 3300003775 Bacteria 86430
11 Ga0055534_1005477 3300003784 Bacteria 3388
12 Ga0055530_10004180 3300003791 Bacteria 7611
13 Ga0055540_1000090 3300003792 Bacteria 99454
14 Ga0055540_1000091 3300003792 Bacteria 99089
15 Ga0055540_1016995 3300003792 Bacteria 2045
16 Ga0055531_10004796 3300003794 Bacteria 8077
17 Ga0055543_1003590 3300004625 Bacteria 4491
18 Ga0065165_1000275 3300005262 Bacteria 87709
19 Ga0065165_1000910 3300005262 Bacteria 38170
20 Ga0065712_10112866 3300005290 Bacteria 1792
21 Ga0070676_10029595 3300005328 Bacteria 3116
22 Ga0070676_10068154 3300005328 Bacteria 2129
23 Ga0070670_100000775 3300005331 Bacteria 24812
24 Ga0070670_100019018 3300005331 Bacteria 5891
25 Ga0070670_100022340 3300005331 Bacteria 5446
26 Ga0070670_100243643 3300005331 Bacteria 1565
27 Ga0070670_100424284 3300005331 Bacteria 1176
28 Ga0070677_10075135 3300005333 Bacteria 1431
29 Ga0070677_10080025 3300005333 Bacteria 1396
30 Ga0070677_10128246 3300005333 Bacteria 1154
31 Ga0068869_100485834 3300005334 Bacteria 1029
32 Ga0070666_10019439 3300005335 Bacteria 4385
33 Ga0068868_100084774 3300005338 Bacteria 2545
34 Ga0068868_100235045 3300005338 Bacteria 1538
35 Ga0070689_100371424 3300005340 Bacteria 1204
36 Ga0070661_100000229 3300005344 Bacteria 46608
37 Ga0070668_100131409 3300005347 Bacteria 2010
38 Ga0070668_100135312 3300005347 Bacteria 1982
39 Ga0070668_100442393 3300005347 Bacteria 1116
40 Ga0070669_100020944 3300005353 Bacteria 4671
41 Ga0070669_100065654 3300005353 Bacteria 2673
42 Ga0070669_100255740 3300005353 Bacteria 1396
43 Ga0070669_100350380 3300005353 Bacteria 1198
44 Ga0070675_100001482 3300005354 Bacteria 17319
45 Ga0070675_100034226 3300005354 Bacteria 4122
46 Ga0070675_100173489 3300005354 Bacteria 1861
47 Ga0070675_100708301 3300005354 Bacteria 917
48 Ga0070671_100020586 3300005355 Bacteria 5381
49 Ga0070671_100042415 3300005355 Bacteria 3781
50 Ga0070671_100055566 3300005355 Bacteria 3293
51 Ga0070671_100082453 3300005355 Bacteria 2689
52 Ga0070671_100157340 3300005355 Bacteria 1920
53 Ga0070671_100285619 3300005355 Bacteria 1404
54 Ga0070674_100004643 3300005356 Bacteria 7847
55 Ga0070674_100035498 3300005356 Bacteria 3339
56 Ga0070674_100474844 3300005356 Bacteria 1037
57 Ga0070673_100003372 3300005364 Bacteria 9941
58 Ga0070673_100044736 3300005364 Bacteria 3429
59 Ga0070673_100597514 3300005364 Bacteria 1006
60 Ga0070659_100009239 3300005366 Bacteria 7237
61 Ga0070667_100006649 3300005367 Bacteria 9611
62 Ga0070667_100168601 3300005367 Bacteria 1932
63 Ga0070667_100264966 3300005367 Bacteria 1539
64 Ga0070708_100769021 3300005445 Bacteria 906
65 Ga0070663_100127553 3300005455 Bacteria 1929
66 Ga0070678_100196618 3300005456 Bacteria 1661
67 Ga0070662_100177261 3300005457 Bacteria 1678
68 Ga0068867_100002317 3300005459 Bacteria 13397
69 Ga0068867_100005133 3300005459 Bacteria 9252
70 Ga0068867_100005331 3300005459 Bacteria 9088
71 Ga0068867_100015928 3300005459 Bacteria 5336
72 Ga0068867_100046359 3300005459 Bacteria 3193
73 Ga0068867_100211512 3300005459 Bacteria 1558
74 Ga0068867_100300177 3300005459 Bacteria 1324
75 Ga0070706_100000367 3300005467 Bacteria 54314
76 Ga0070707_100386312 3300005468 Bacteria 1360
77 Ga0070707_100564759 3300005468 Bacteria 1100
78 Ga0070699_100219331 3300005518 Bacteria 1695
79 Ga0070672_100000485 3300005543 Bacteria 23134
80 Ga0070672_100050694 3300005543 Bacteria 3234
81 Ga0070672_100652605 3300005543 Bacteria 919
82 Ga0070686_100257253 3300005544 Bacteria 1278
83 Ga0070665_100058116 3300005548 Bacteria 3877
84 Ga0070665_100190031 3300005548 Bacteria 2054
85 Ga0070665_100901408 3300005548 Bacteria 897
86 Ga0068855_100048111 3300005563 Bacteria 5035
87 Ga0070664_100002915 3300005564 Bacteria 13849
88 Ga0070664_100071927 3300005564 Bacteria 2965
89 Ga0070664_100091085 3300005564 Bacteria 2640
90 Ga0068854_100057248 3300005578 Bacteria 2812
91 Ga0068852_100006370 3300005616 Bacteria 8525
92 Ga0068852_100048807 3300005616 Bacteria 3619
93 Ga0068859_100035247 3300005617 Bacteria 5020
94 Ga0068859_100286744 3300005617 Bacteria 1739
95 Ga0068864_100011131 3300005618 Bacteria 7434
96 Ga0068864_100018209 3300005618 Bacteria 5863
97 Ga0068864_100035355 3300005618 Bacteria 4253
98 Ga0068864_100134250 3300005618 Bacteria 2227
99 Ga0068864_100456503 3300005618 Bacteria 1223
100 Ga0068866_10043103 3300005718 Bacteria 2250
101 Ga0068861_100011019 3300005719 Bacteria 6284
102 Ga0068863_100010999 3300005841 Bacteria 8776
103 Ga0068858_100084797 3300005842 Bacteria 2947
104 Ga0068860_100001559 3300005843 Bacteria 24688
105 Ga0068862_100056270 3300005844 Bacteria 3370
106 Ga0068862_100088642 3300005844 Bacteria 2692
107 Ga0068862_100096490 3300005844 Bacteria 2581
108 Ga0068862_100436574 3300005844 Bacteria 1232
109 Ga0075365_10029216 3300006038 Bacteria 3521
110 Ga0075365_10082684 3300006038 Bacteria 2177
111 Ga0075368_10003231 3300006042 Bacteria 5425
112 Ga0075363_100000145 3300006048 Bacteria 17501
113 Ga0075363_100038891 3300006048 Bacteria 2502
114 Ga0075363_100159152 3300006048 Bacteria 1278
115 Ga0075363_100186555 3300006048 Bacteria 1182
116 Ga0075364_10034817 3300006051 Bacteria 3252
117 Ga0075364_10097895 3300006051 Bacteria 1951
118 Ga0075362_10000580 3300006177 Bacteria 10685
119 Ga0075362_10003899 3300006177 Bacteria 5296
120 Ga0075367_10002249 3300006178 Bacteria 8731
121 Ga0075367_10004330 3300006178 Bacteria 6910
122 Ga0075367_10012127 3300006178 Bacteria 4585
123 Ga0075367_10024628 3300006178 Bacteria 3395
124 Ga0075367_10076032 3300006178 Bacteria 2026
125 Ga0075369_10018407 3300006186 Bacteria 2843
126 Ga0075369_10082969 3300006186 Bacteria 1423
127 Ga0075369_10174554 3300006186 Bacteria 988
128 Ga0075366_10000582 3300006195 Bacteria 17130
129 Ga0075366_10001974 3300006195 Bacteria 10379
130 Ga0075366_10007032 3300006195 Bacteria 6191
131 Ga0075366_10007235 3300006195 Bacteria 6116
132 Ga0075366_10016069 3300006195 Bacteria 4297
133 Ga0075366_10022472 3300006195 Bacteria 3669
134 Ga0075366_10035558 3300006195 Bacteria 2937
135 Ga0075366_10036429 3300006195 Bacteria 2901
136 Ga0075366_10062429 3300006195 Bacteria 2214
137 Ga0075366_10160212 3300006195 Bacteria 1363
138 Ga0075366_10283274 3300006195 Bacteria 1013
139 Ga0075366_10305605 3300006195 Bacteria 973
140 Ga0075366_10381676 3300006195 Bacteria 866
141 Ga0097621_100134922 3300006237 Bacteria 2104
142 Ga0075370_10000142 3300006353 Bacteria 24311
143 Ga0075370_10000854 3300006353 Bacteria 12360
144 Ga0075370_10001171 3300006353 Bacteria 11031
145 Ga0075370_10002800 3300006353 Bacteria 8175
146 Ga0075370_10010740 3300006353 Bacteria 4800
147 Ga0075370_10057297 3300006353 Bacteria 2215
148 Ga0075370_10082740 3300006353 Bacteria 1846
149 Ga0075370_10129241 3300006353 Bacteria 1474
150 Ga0075370_10143256 3300006353 Bacteria 1398
151 Ga0075429_100038607 3300006880 Bacteria 4157
152 Ga0068865_100003673 3300006881 Bacteria 9217
153 Ga0068865_100160693 3300006881 Bacteria 1713
154 Ga0097620_100035247 3300006931 Bacteria 5020
155 Ga0097620_100286764 3300006931 Bacteria 1739
156 Ga0079104_1000623 3300006946 Bacteria 34666
157 Ga0105250_10000388 3300009092 Bacteria 32790
158 Ga0105240_10628568 3300009093 Bacteria 1179
159 Ga0105245_10111121 3300009098 Bacteria 2549
160 Ga0105245_10707779 3300009098 Bacteria 1041
161 Ga0105245_11495013 3300009098 Bacteria 726
162 Ga0105247_10236614 3300009101 Bacteria 1242
163 Ga0105243_10000649 3300009148 Bacteria 34418
164 Ga0105243_10007502 3300009148 Bacteria 8381
165 Ga0105243_10099669 3300009148 Bacteria 2409
166 Ga0105243_10169051 3300009148 Bacteria 1892
167 Ga0105242_10001267 3300009176 Bacteria 19954
168 Ga0105242_10212059 3300009176 Bacteria 1726
169 Ga0105242_11138166 3300009176 Bacteria 796
170 Ga0105248_10063363 3300009177 Bacteria 4150
171 Ga0105248_10112249 3300009177 Bacteria 3074
172 Ga0105237_10044846 3300009545 Bacteria 4451
173 Ga0105249_10062676 3300009553 Bacteria 3414
174 Ga0105239_10466380 3300010375 Bacteria 1434
175 Ga0157369_10588827 3300013105 Bacteria 1149
176 Ga0157374_10083470 3300013296 Bacteria 3035
177 Ga0157374_10143755 3300013296 Bacteria 2316
178 Ga0157378_10001811 3300013297 Bacteria 19191
179 Ga0157378_10186138 3300013297 Bacteria 1956
180 Ga0157378_10315291 3300013297 Bacteria 1518
181 Ga0163162_10146340 3300013306 Bacteria 2479
182 Ga0163162_10457890 3300013306 Bacteria 1407
183 Ga0157375_10090733 3300013308 Bacteria 3115
184 Ga0157375_10168125 3300013308 Bacteria 2339
185 Ga0157375_10411959 3300013308 Bacteria 1518
186 Ga0163163_10011394 3300014325 Bacteria 8062
187 Ga0163163_10519715 3300014325 Bacteria 1253
188 Ga0157380_10418128 3300014326 Bacteria 1278
189 Ga0157377_10000006 3300014745 Bacteria 419853
190 Ga0157377_10195360 3300014745 Bacteria 1281
191 Ga0157379_10015125 3300014968 Bacteria 6768
192 Ga0157379_10016325 3300014968 Bacteria 6531
193 Ga0157379_10181660 3300014968 Bacteria 1900
194 Ga0157379_10500916 3300014968 Bacteria 1126
195 Ga0157376_10101365 3300014969 Bacteria 2516
196 Ga0157376_10179771 3300014969 Bacteria 1933
197 Ga0163161_10092954 3300017792 Bacteria 2234
198 Ga0163161_10185321 3300017792 Bacteria 1598
199 Ga0163161_10459987 3300017792 Bacteria 1030
200 Ga0213872_10000120 3300021361 Bacteria 73389
201 Ga0209563_100014 3300025230 Bacteria 940582
202 Ga0207425_1000703 3300025245 Bacteria 18068
203 Ga0209129_1000933 3300025258 Bacteria 17722
204 Ga0209673_1008819 3300025273 Bacteria 4443
205 Ga0209673_1011570 3300025273 Bacteria 3628
206 Ga0209673_1022805 3300025273 Bacteria 2149
207 Ga0209130_1001737 3300025284 Bacteria 13011
208 Ga0209675_1000571 3300025291 Bacteria 26587
209 Ga0209676_1057233 3300025292 Bacteria 989
210 Ga0209564_1000131 3300025295 Bacteria 192177
211 Ga0209564_1000627 3300025295 Bacteria 53872
212 Ga0209758_1000593 3300025297 Bacteria 56468
213 Ga0209758_1000769 3300025297 Bacteria 46067
214 Ga0209050_1000326 3300025298 Bacteria 95495
215 Ga0209050_1000799 3300025298 Bacteria 44543
216 Ga0209050_1006185 3300025298 Bacteria 7196
217 Ga0209050_1012062 3300025298 Bacteria 4014
218 Ga0209256_1000019 3300025299 Bacteria 558627
219 Ga0209256_1012880 3300025299 Bacteria 3151
220 Ga0209051_1000133 3300025303 Bacteria 139014
221 Ga0209051_1013307 3300025303 Bacteria 3924
222 Ga0209051_1030024 3300025303 Bacteria 2117
223 Ga0209257_1000038 3300025304 Bacteria 609032
224 Ga0209257_1026537 3300025304 Bacteria 1949
225 Ga0207656_10113634 3300025321 Bacteria 1254
226 Ga0207656_10151086 3300025321 Bacteria 1100
227 Ga0207696_1002807 3300025711 Bacteria 8267
228 Ga0207682_10004387 3300025893 Bacteria 5908
229 Ga0207682_10014895 3300025893 Bacteria 3028
230 Ga0207682_10092010 3300025893 Bacteria 1316
231 Ga0207642_10363024 3300025899 Bacteria 857
232 Ga0207680_10027060 3300025903 Bacteria 3187
233 Ga0207645_10038735 3300025907 Bacteria 3055
234 Ga0207645_10060630 3300025907 Bacteria 2416
235 Ga0207645_10117487 3300025907 Bacteria 1725
236 Ga0207645_10215254 3300025907 Bacteria 1266
237 Ga0207645_10281229 3300025907 Bacteria 1105
238 Ga0207645_10309475 3300025907 Bacteria 1052
239 Ga0207643_10032633 3300025908 Bacteria 2909
240 Ga0207671_10031240 3300025914 Bacteria 3968
241 Ga0207646_10403551 3300025922 Bacteria 1234
242 Ga0207681_10060602 3300025923 Bacteria 2598
243 Ga0207681_10315989 3300025923 Bacteria 1240
244 Ga0207650_10000275 3300025925 Bacteria 53824
245 Ga0207650_10032388 3300025925 Bacteria 3781
246 Ga0207650_10076434 3300025925 Bacteria 2530
247 Ga0207650_10400213 3300025925 Bacteria 1136
248 Ga0207659_10003305 3300025926 Bacteria 9661
249 Ga0207659_10098310 3300025926 Bacteria 2201
250 Ga0207659_10135532 3300025926 Bacteria 1905
251 Ga0207659_10400758 3300025926 Bacteria 1147
252 Ga0207659_10553826 3300025926 Bacteria 978
253 Ga0207687_10275771 3300025927 Bacteria 1346
254 Ga0207644_10005477 3300025931 Bacteria 8268
255 Ga0207644_10048247 3300025931 Bacteria 3043
256 Ga0207644_10061537 3300025931 Bacteria 2719
257 Ga0207644_10160485 3300025931 Bacteria 1747
258 Ga0207644_10211412 3300025931 Bacteria 1534
259 Ga0207706_10091751 3300025933 Bacteria 2670
260 Ga0207706_10230598 3300025933 Bacteria 1620
261 Ga0207686_10018660 3300025934 Bacteria 3929
262 Ga0207709_10000696 3300025935 Bacteria 27115
263 Ga0207709_10001139 3300025935 Bacteria 19377
264 Ga0207669_10034388 3300025937 Bacteria 2871
265 Ga0207669_10107865 3300025937 Bacteria 1858
266 Ga0207669_10342375 3300025937 Bacteria 1152
267 Ga0207669_10470736 3300025937 Bacteria 1000
268 Ga0207704_10120769 3300025938 Bacteria 1793
269 Ga0207691_10001335 3300025940 Bacteria 24610
270 Ga0207691_10058049 3300025940 Bacteria 3520
271 Ga0207691_10080650 3300025940 Bacteria 2926
272 Ga0207691_10481919 3300025940 Bacteria 1054
273 Ga0207711_10189790 3300025941 Bacteria 1872
274 Ga0207689_10049644 3300025942 Bacteria 3461
275 Ga0207689_10423688 3300025942 Bacteria 1111
276 Ga0207679_10000339 3300025945 Bacteria 34501
277 Ga0207679_10078325 3300025945 Bacteria 2517
278 Ga0207651_10008298 3300025960 Bacteria 5603
279 Ga0207651_10064540 3300025960 Bacteria 2563
280 Ga0207712_10035567 3300025961 Bacteria 3385
281 Ga0207712_10518260 3300025961 Bacteria 1021
282 Ga0207668_10081035 3300025972 Bacteria 2353
283 Ga0207668_10092283 3300025972 Bacteria 2228
284 Ga0207668_10099690 3300025972 Bacteria 2156
285 Ga0207640_10126527 3300025981 Bacteria 1840
286 Ga0207658_10006476 3300025986 Bacteria 7992
287 Ga0207658_10131102 3300025986 Bacteria 2014
288 Ga0207658_10598098 3300025986 Bacteria 991
289 Ga0207677_10075816 3300026023 Bacteria 2392
290 Ga0207677_10084359 3300026023 Bacteria 2290
291 Ga0207677_10259992 3300026023 Bacteria 1415
292 Ga0207703_10067755 3300026035 Bacteria 2938
293 Ga0207703_10498340 3300026035 Bacteria 1143
294 Ga0207639_10413635 3300026041 Bacteria 1218
295 Ga0207678_10144564 3300026067 Bacteria 2030
296 Ga0207678_10223615 3300026067 Bacteria 1611
297 Ga0207641_11217294 3300026088 Bacteria 753
298 Ga0207648_10000254 3300026089 Bacteria 57696
299 Ga0207648_10000419 3300026089 Bacteria 46680
300 Ga0207648_10024822 3300026089 Bacteria 5347
301 Ga0207648_10063438 3300026089 Bacteria 3220
302 Ga0207648_10066548 3300026089 Bacteria 3142
303 Ga0207648_10161244 3300026089 Bacteria 1980
304 Ga0207648_10178308 3300026089 Bacteria 1880
305 Ga0207648_10347594 3300026089 Bacteria 1336
306 Ga0207648_10908474 3300026089 Bacteria 823
307 Ga0207676_10019987 3300026095 Bacteria 4893
308 Ga0207676_10029853 3300026095 Bacteria 4086
309 Ga0207676_10332647 3300026095 Bacteria 1398
310 Ga0207675_100004240 3300026118 Bacteria 13863
311 Ga0207675_100032919 3300026118 Bacteria 4830
312 Ga0207675_100873252 3300026118 Bacteria 915
313 Ga0207683_10061301 3300026121 Bacteria 3310
314 Ga0207683_10153958 3300026121 Bacteria 2076
315 Ga0207683_10388700 3300026121 Bacteria 1283
316 Ga0207683_10516442 3300026121 Bacteria 1104
317 Ga0207698_10144531 3300026142 Bacteria 2055
318 Ga0207698_10448473 3300026142 Bacteria 1245
319 Ga0207698_10598438 3300026142 Bacteria 1087
320 Ga0209281_1000072 3300027111 Bacteria 273114
321 Ga0209281_1000098 3300027111 Bacteria 226641
322 Ga0209973_1000754 3300027252 Bacteria 2592
323 Ga0209996_1000743 3300027395 Bacteria 3875
324 Ga0209968_1000617 3300027526 Bacteria 5511
325 Ga0209970_1000134 3300027614 Bacteria 11104
326 Ga0209966_1000517 3300027695 Bacteria 9984
327 Ga0209974_10019124 3300027876 Bacteria 2271
328 Ga0209974_10020998 3300027876 Bacteria 2164
329 Ga0268265_10037721 3300028380 Bacteria 3549
330 Ga0268265_10111999 3300028380 Bacteria 2230
331 Ga0268264_10002884 3300028381 Bacteria 14955
332 Ga0307517_10173770 3300028786 Bacteria 1409
333 Ga0307515_10000921 3300028794 Bacteria 67536
334 Ga0307515_10001761 3300028794 Bacteria 48250
335 Ga0307515_10011753 3300028794 Bacteria 16566
336 Ga0307515_10014878 3300028794 Bacteria 14383
337 Ga0307515_10014984 3300028794 Bacteria 14322
338 Ga0307515_10179398 3300028794 Bacteria 2074
339 Ga0307515_10294004 3300028794 Bacteria 1317
340 Ga0307512_10062146 3300030522 Bacteria 2868
341 Ga0307512_10096586 3300030522 Bacteria 2025
342 Ga0307512_10216090 3300030522 Bacteria 1010
343 Ga0265328_10020766 3300031239 Bacteria 2512
344 Ga0265327_10000924 3300031251 Bacteria 42993
345 Ga0307513_10010837 3300031456 Bacteria 11385
346 Ga0307513_10038516 3300031456 Bacteria 5307
347 Ga0307513_10051191 3300031456 Bacteria 4457
348 Ga0307513_10052373 3300031456 Bacteria 4396
349 Ga0307513_10401501 3300031456 Bacteria 1105
350 Ga0307509_10015076 3300031507 Bacteria 9049
351 Ga0307509_10038943 3300031507 Bacteria 5181
352 Ga0307509_10065554 3300031507 Bacteria 3813
353 Ga0307509_10232962 3300031507 Bacteria 1642
354 Ga0307509_10290623 3300031507 Bacteria 1389
355 Ga0307509_10449407 3300031507 Bacteria 983
356 Ga0307408_100001205 3300031548 Bacteria 19516
357 Ga0307408_100086692 3300031548 Bacteria 2354
358 Ga0307408_100246376 3300031548 Bacteria 1471
359 Ga0307408_100257426 3300031548 Bacteria 1442
360 Ga0307408_100307508 3300031548 Bacteria 1330
361 Ga0307508_10000440 3300031616 Bacteria 49668
362 Ga0307508_10004752 3300031616 Bacteria 13130
363 Ga0307508_10015474 3300031616 Bacteria 6948
364 Ga0307508_10279184 3300031616 Bacteria 1264
365 Ga0307514_10066289 3300031649 Bacteria 2731
366 Ga0307514_10104622 3300031649 Bacteria 2024
367 Ga0307514_10146712 3300031649 Bacteria 1593
368 Ga0307516_10001028 3300031730 Bacteria 38713
369 Ga0307516_10004218 3300031730 Bacteria 17894
370 Ga0307516_10054856 3300031730 Bacteria 3893
371 Ga0307516_10074847 3300031730 Bacteria 3241
372 Ga0307405_10020862 3300031731 Bacteria 3670
373 Ga0307405_10042005 3300031731 Bacteria 2780
374 Ga0307413_10229807 3300031824 Bacteria 1361
375 Ga0307410_10057965 3300031852 Bacteria 2639
376 Ga0307406_10022265 3300031901 Bacteria 3757
377 Ga0307406_10035628 3300031901 Bacteria 3062
378 Ga0307406_10052853 3300031901 Bacteria 2586
379 Ga0307406_10882201 3300031901 Bacteria 760
380 Ga0307407_10026775 3300031903 Bacteria 3059
381 Ga0307412_10016042 3300031911 Bacteria 4452
382 Ga0307412_10128716 3300031911 Bacteria 1835
383 Ga0307412_10220062 3300031911 Bacteria 1455
384 Ga0307409_100087784 3300031995 Bacteria 2536
385 Ga0307416_100166662 3300032002 Bacteria 2044
386 Ga0307416_100415644 3300032002 Bacteria 1387
387 Ga0307416_100583780 3300032002 Bacteria 1195
388 Ga0307411_10043269 3300032005 Bacteria 2880
389 Ga0307411_10120508 3300032005 Bacteria 1897
390 Ga0307411_10171933 3300032005 Bacteria 1635
391 Ga0307411_10394400 3300032005 Bacteria 1142
392 Ga0307411_10681630 3300032005 Bacteria 893
393 Ga0307415_100029395 3300032126 Bacteria 3512
394 Ga0307507_10092918 3300033179 Bacteria 2572
395 Ga0307507_10096470 3300033179 Bacteria 2501
396 Ga0307507_10148153 3300033179 Bacteria 1776
397 Ga0307507_10186574 3300033179 Bacteria 1469
398 Ga0307510_10003419 3300033180 Bacteria 18519
399 Ga0307510_10033328 3300033180 Bacteria 5786
400 Ga0307510_10245266 3300033180 Bacteria 1283
401 Ga0373928_0014086 3300035084 Bacteria 1613
402 Ga0373931_0128594 3300035691 Bacteria 1455
403 Ga0373931_0246067 3300035691 Bacteria 1086
404 Ga0373937_0369994 3300036401 Bacteria 1359
405 Ga0373925_0039291 3300037068 Bacteria 3501
406 Ga0395899_0001736 3300037312 Bacteria 18130
407 Ga0395898_0261109 3300037466 Bacteria 1652
408 Ga0395905_0000390 3300037471 Bacteria 62192
409 Ga0395905_0000414 3300037471 Bacteria 59892
410 Ga0395905_0004449 3300037471 Bacteria 14565
411 Ga0395905_0005385 3300037471 Bacteria 13078
412 Ga0395905_0011763 3300037471 Bacteria 8448
413 Ga0395905_0026010 3300037471 Bacteria 5519
414 Ga0395905_0143744 3300037471 Bacteria 2244
415 Ga0395905_0205558 3300037471 Bacteria 1845
416 Ga0395901_0386443 3300038443 Bacteria 1440
417 Ga0395901_0709809 3300038443 Bacteria 1002
418 Ga0436361_0097160 3300039447 Bacteria 66004
419 Ga0439436_0001080 3300041404 Bacteria 7686
420 Ga0439438_030453 3300041405 Bacteria 1439
421 Ga0439439_0005108 3300041406 Bacteria 2985
422 Ga0439466_0027462 3300041411 Bacteria 1971
423 Ga0439465_0047787 3300041413 Bacteria 1396
424 Ga0451789_0850686 3300041443 Bacteria 2795
425 Ga0451793_0799789 3300041452 Bacteria 979
426 Ga0451795_0058901 3300041456 Bacteria 2049
427 Ga0451798_0442166 3300041458 Bacteria 982
428 Ga0451800_0280383 3300041459 Bacteria 1669
429 Ga0451800_0413036 3300041459 Bacteria 1043
430 Ga0451807_0609196 3300041486 Bacteria 917
431 Ga0451807_2394431 3300041486 Bacteria 930
432 Ga0451841_0330404 3300041498 Bacteria 957
433 Ga0451847_0358612 3300041503 Bacteria 959
434 Ga0439431_0013248 3300041997 Bacteria 1901
435 Ga0439433_0012758 3300041999 Bacteria 1844
436 Ga0439442_044501 3300042002 Bacteria 935
437 Ga0439445_0018507 3300042004 Bacteria 1730
438 Ga0439432_008065 3300042006 Bacteria 3709
439 Ga0439449_0003723 3300042007 Bacteria 5913
440 Ga0439452_005832 3300042010 Bacteria 3924
441 Ga0439462_0012837 3300042015 Bacteria 2143
442 Ga0439463_012439 3300042016 Bacteria 2092
443 Ga0450911_000958 3300042115 Bacteria 7525
444 Ga0450919_001362 3300042121 Bacteria 3191
445 Ga0450920_023976 3300042122 Bacteria 1184
446 Ga0450898_019034 3300042134 Bacteria 1194
447 Ga0450899_009776 3300042135 Bacteria 1059
448 Ga0450904_014619 3300042139 Bacteria 783
449 Ga0450906_006531 3300042145 Bacteria 2349
450 Ga0450910_029193 3300042147 Bacteria 861
451 Ga0450908_006357 3300042184 Bacteria 2247
452 Ga0439434_0018569 3300042435 Bacteria 2083
453 Ga0439434_0028567 3300042435 Bacteria 1689
454 Ga0439464_0002359 3300042439 Bacteria 4640
455 Ga0439460_0104476 3300042461 Bacteria 913
456 Ga0450918_000283 3300042531 Bacteria 11490
457 Ga0451577_0011181 3300042876 Bacteria 8514
458 Ga0451577_0012601 3300042876 Bacteria 7934
459 Ga0451577_0320259 3300042876 Bacteria 1406
460 Ga0439440_0033556 3300042993 Bacteria 1224
461 Ga0466969_0035601 3300044656 Bacteria 2517
462 Ga0466969_0046431 3300044656 Bacteria 2154
463 Ga0453683_0153151 3300044673 Bacteria 1457
464 Ga0466965_0132402 3300044683 Bacteria 1294
465 Ga0466966_0011393 3300044684 Bacteria 5897
466 Ga0466966_0185904 3300044684 Bacteria 1260
467 Ga0466966_0237819 3300044684 Bacteria 1098
468 Ga0466961_0005169 3300044693 Bacteria 8211
469 Ga0466961_0006669 3300044693 Bacteria 7342
470 Ga0466961_0031397 3300044693 Bacteria 3415
471 Ga0453684_0029228 3300044712 Bacteria 7838
472 Ga0453684_0286912 3300044712 Bacteria 1875
473 Ga0453684_0433910 3300044712 Bacteria 1465
474 Ga0466968_0014124 3300044735 Bacteria 3152
475 Ga0466970_0010244 3300044765 Bacteria 4754
476 Ga0466970_0222072 3300044765 Bacteria 1055
477 Ga0466957_0349773 3300044842 Bacteria 1002
478 Ga0466959_0028817 3300045049 Bacteria 4114
479 Ga0451576_0022025 3300045051 Bacteria 6915
480 Ga0451576_0609150 3300045051 Bacteria 1148
481 Ga0495592_0000528 3300046454 Bacteria 27565
482 Ga0495603_0397440 3300046455 Bacteria 790
483 Ga0495638_0195584 3300046460 Bacteria 1145
484 Ga0495650_0002706 3300046471 Bacteria 13746
485 Ga0495606_0046495 3300046507 Bacteria 2868
486 Ga0495606_0151581 3300046507 Bacteria 1360
487 Ga0495610_0061187 3300046512 Bacteria 1790
488 Ga0495620_0042763 3300046515 Bacteria 1977
489 Ga0495628_0499329 3300046516 Bacteria 879
490 Ga0495630_0132527 3300046517 Bacteria 1893
491 Ga0495632_0001689 3300046519 Bacteria 18062
492 Ga0495632_0027029 3300046519 Bacteria 3011
493 Ga0495632_0034016 3300046519 Bacteria 2611
494 Ga0495632_0157544 3300046519 Bacteria 1047
495 Ga0495663_0056259 3300046525 Bacteria 1228
496 Ga0495663_0072460 3300046525 Bacteria 1099
497 Ga0495621_0013170 3300046539 Bacteria 2594
498 Ga0495597_0001717 3300046542 Bacteria 15163
499 Ga0495597_0042908 3300046542 Bacteria 2015
500 Ga0495633_0010434 3300046558 Bacteria 5067
501 Ga0495656_0000645 3300046615 Bacteria 11174
502 Ga0495668_0259086 3300046616 Bacteria 952
503 Ga0495625_0027381 3300046660 Bacteria 4293
504 Ga0495625_0138927 3300046660 Bacteria 1640
505 Ga0495625_0280749 3300046660 Bacteria 1071
506 Ga0495659_0146519 3300046664 Bacteria 945
507 Ga0495658_0373100 3300046683 Bacteria 908
508 Ga0495624_0168579 3300046690 Bacteria 1336
509 Ga0495649_0003993 3300046694 Bacteria 9723
510 Ga0495649_0226441 3300046694 Bacteria 966
511 Ga0495660_0035588 3300046810 Bacteria 2781
512 Ga0495676_0019792 3300047321 Bacteria 5917
513 Ga0495687_001797 3300047443 Bacteria 18906
514 Ga0495685_057770 3300047447 Bacteria 1310
515 Ga0495686_0115238 3300047472 Bacteria 1607
516 Ga0495686_0171187 3300047472 Bacteria 1263
517 Ga0495615_0030988 3300048090 Bacteria 1280
518 Ga0495626_0045695 3300048091 Bacteria 2043
519 Ga0496102_0019151 3300048905 Bacteria 6025
520 Ga0496105_0349373 3300048908 Bacteria 1181
521 Ga0496105_0611312 3300048908 Bacteria 845
522 Ga0496106_0013343 3300048909 Bacteria 6065
523 Ga0496109_0588972 3300048912 Bacteria 1048
524 Ga0496109_0709054 3300048912 Bacteria 944
525 Ga0496109_0725556 3300048912 Bacteria 931
526 Ga0496112_0109655 3300048915 Bacteria 2730
527 Ga0496112_0435218 3300048915 Bacteria 1250
528 Ga0496113_0040369 3300048916 Bacteria 3439
529 Ga0496114_0012810 3300048917 Bacteria 6714
530 Ga0496114_0579285 3300048917 Bacteria 990
531 Ga0496114_0611837 3300048917 Bacteria 960
532 Ga0496121_0007296 3300048924 Bacteria 13370
533 Ga0496121_0407793 3300048924 Bacteria 888
534 Ga0496122_0147468 3300048925 Bacteria 1459
535 Ga0496123_0067285 3300048926 Bacteria 2263
536 Ga0496123_0193140 3300048926 Bacteria 1051
537 Ga0496124_0072578 3300048927 Bacteria 2850
538 Ga0496125_0070525 3300048928 Bacteria 2735
539 Ga0496125_0167490 3300048928 Bacteria 1482
540 Ga0496126_0120194 3300048929 Bacteria 2279
541 Ga0496126_0352000 3300048929 Bacteria 1204
542 Ga0496126_0507940 3300048929 Bacteria 962
543 Ga0495682_0137470 3300049460 Bacteria 873
544 Ga0501031_0017890 3300049568 Bacteria 4610
545 Ga0501033_0091106 3300049570 Bacteria 2230
546 Ga0501034_0192758 3300049571 Bacteria 1999
547 Ga0501043_0000277 3300049579 Bacteria 46284
548 Ga0501046_0000345 3300049580 Bacteria 46730
549 Ga0501047_0000395 3300049581 Bacteria 48969
550 Ga0501047_0264303 3300049581 Bacteria 1568
551 Ga0501048_0000111 3300049582 Bacteria 46009
552 Ga0501198_000023 3300049649 Bacteria 69100
553 Ga0501222_000031 3300049662 Bacteria 56867
554 Ga0501233_011743 3300049668 Bacteria 1748
555 Ga0501249_018719 3300049679 Bacteria 1499
556 Ga0501253_024256 3300049683 Bacteria 1099
557 Ga0501257_039041 3300049686 Bacteria 1162
558 Ga0501265_005711 3300049762 Bacteria 1439
559 Ga0501044_0201191 3300049823 Bacteria 1950
560 nmdc:mga03683_183520_c1 3300050489 Bacteria 955
561 nmdc:mga03683_193631_c1 3300050489 Bacteria 931
562 nmdc:mga03683_41757_c1 3300050489 Bacteria 1885
563 nmdc:mga03n38_128795_c1 3300050490 Bacteria 1252
564 nmdc:mga03n38_19557_c1 3300050490 Bacteria 2693
565 nmdc:mga03n38_345959_c1 3300050490 Bacteria 808
566 nmdc:mga03n38_4126_c1 3300050490 Bacteria 4771
567 nmdc:mga00v17_27516_c1 3300050491 Bacteria 3320
568 nmdc:mga00v17_8528_c1 3300050491 Bacteria 5517
569 nmdc:mga0yw44_156222_c1 3300050492 Bacteria 1491
570 nmdc:mga0yw44_69791_c1 3300050492 Bacteria 2177
571 nmdc:mga0k408_108211_c1 3300050493 Bacteria 1642
572 nmdc:mga0k408_11041_c1 3300050493 Bacteria 4906
573 nmdc:mga0k408_114280_c1 3300050493 Bacteria 1596
574 nmdc:mga0k408_13795_c1 3300050493 Bacteria 4438
575 nmdc:mga0k408_1405_c1 3300050493 Bacteria 13025
576 nmdc:mga0k408_1412_c1 3300050493 Bacteria 12975
577 nmdc:mga0k408_185650_c1 3300050493 Bacteria 1240
578 nmdc:mga0k408_21052_c1 3300050493 Bacteria 3660
579 nmdc:mga0k408_2400_c1 3300050493 Bacteria 9965
580 nmdc:mga0k408_253426_c1 3300050493 Bacteria 1051
581 nmdc:mga0k408_2728_c1 3300050493 Bacteria 4496
582 nmdc:mga0k408_322552_c1 3300050493 Bacteria 922
583 nmdc:mga0k408_4980_c1 3300050493 Bacteria 7039
584 nmdc:mga0k408_5321_c1 3300050493 Bacteria 6838
585 nmdc:mga0k408_5383_c1 3300050493 Bacteria 6807
586 nmdc:mga0k408_74914_c1 3300050493 Bacteria 1977
587 nmdc:mga0k408_76377_c1 3300050493 Bacteria 1958
588 nmdc:mga06z11_121291_c1 3300050494 Bacteria 1459
589 nmdc:mga06z11_229286_c1 3300050494 Bacteria 1088
590 nmdc:mga06z11_3034_c1 3300050494 Bacteria 6460
591 nmdc:mga06z11_70879_c1 3300050494 Bacteria 1844
592 nmdc:mga04h51_5190_c1 3300050495 Bacteria 3305
593 nmdc:mga07m45_1136_c1 3300050496 Bacteria 11938
594 nmdc:mga07m45_142595_c1 3300050496 Bacteria 1388
595 nmdc:mga07m45_149947_c1 3300050496 Bacteria 1352
596 nmdc:mga07m45_17485_c1 3300050496 Bacteria 3852
597 nmdc:mga07m45_179112_c1 3300050496 Bacteria 1233
598 nmdc:mga07m45_179352_c1 3300050496 Bacteria 1232
599 nmdc:mga07m45_1876_c1 3300050496 Bacteria 9712
600 nmdc:mga07m45_27001_c1 3300050496 Bacteria 3159
601 nmdc:mga07m45_369984_c1 3300050496 Bacteria 833
602 nmdc:mga07m45_47236_c1 3300050496 Bacteria 2420
603 nmdc:mga07m45_476129_c1 3300050496 Bacteria 724
604 nmdc:mga07m45_50139_c1 3300050496 Bacteria 2351
605 nmdc:mga07m45_59872_c1 3300050496 Bacteria 2155
606 nmdc:mga07m45_82398_c1 3300050496 Bacteria 1837
607 nmdc:mga07m45_8856_c1 3300050496 Bacteria 5193
608 nmdc:mga09592_9369_c1 3300050508 Bacteria 7965
609 nmdc:mga0sz30_123419_c1 3300050516 Bacteria 1139
610 nmdc:mga0sz30_12980_c1 3300050516 Bacteria 3253
611 nmdc:mga0sz30_139147_c1 3300050516 Bacteria 1072
612 Ga0500578_0000406 3300053086 Bacteria 52894
613 Ga0500644_0095571 3300053088 Bacteria 1120
614 Ga0500644_0220080 3300053088 Bacteria 791
615 Ga0500646_0005193 3300053090 Bacteria 3296
616 Ga0500651_0000877 3300053093 Bacteria 14753
617 Ga0500651_0251269 3300053093 Bacteria 1028
618 Ga0500566_0132409 3300053094 Bacteria 1332
619 Ga0500557_025453 3300053105 Bacteria 1741
620 Ga0500592_010373 3300053116 Bacteria 1484
621 Ga0500628_003477 3300053129 Bacteria 2600
622 Ga0500652_000420 3300053131 Bacteria 15148
623 Ga0500655_007928 3300053133 Bacteria 1912
624 Ga0500658_0016399 3300053134 Bacteria 2760
625 Ga0500658_0246243 3300053134 Bacteria 821
626 Ga0500559_0000265 3300053136 Bacteria 40939
627 Ga0500559_0017226 3300053136 Bacteria 3050
628 Ga0500561_0128650 3300053137 Bacteria 778
629 Ga0500568_0005916 3300053139 Bacteria 6227
630 Ga0500568_0105393 3300053139 Bacteria 1056
631 Ga0500586_119185 3300053145 Bacteria 919
632 Ga0500590_014765 3300053148 Bacteria 4028
633 Ga0500604_0018531 3300053151 Bacteria 1940
634 Ga0500622_0001047 3300053156 Bacteria 23044
635 Ga0500622_0002039 3300053156 Bacteria 15066
636 Ga0500570_142560 3300053724 Bacteria 876
637 Ga0500645_003124 3300053730 Bacteria 6902
638 Ga0500587_000568 3300053739 Bacteria 4573
639 Ga0500587_005322 3300053739 Bacteria 1735
640 Ga0466962_0027267 3300061719 Bacteria 2742

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037466 Ga0395898_0261109 Ga0395898_0261109_24_566 178
2 3300041486 Ga0451807_2394431 Ga0451807_2394431_36_587 178
3 3300026089 Ga0207648_10908474 Ga0207648_109084742 200
4 3300046664 Ga0495659_0146519 Ga0495659_0146519_317_928 200
5 3300003784 Ga0055534_1005477 Ga0055534_10054772 201
6 3300003792 Ga0055540_1016995 Ga0055540_10169953 201
7 3300005333 Ga0070677_10128246 Ga0070677_101282462 201
8 3300005347 Ga0070668_100135312 Ga0070668_1001353123 201
9 3300017792 Ga0163161_10459987 Ga0163161_104599872 201
10 3300025284 Ga0209130_1001737 Ga0209130_10017379 201
11 3300025291 Ga0209675_1000571 Ga0209675_100057126 201
12 3300025292 Ga0209676_1057233 Ga0209676_10572332 201
13 3300025298 Ga0209050_1012062 Ga0209050_10120622 201
14 3300025303 Ga0209051_1013307 Ga0209051_10133072 201
15 3300025304 Ga0209257_1026537 Ga0209257_10265373 201
16 3300025893 Ga0207682_10092010 Ga0207682_100920102 201
17 3300025926 Ga0207659_10400758 Ga0207659_104007582 201
18 3300025972 Ga0207668_10099690 Ga0207668_100996902 201
19 3300038443 Ga0395901_0709809 Ga0395901_0709809_353_964 201
20 3300046539 Ga0495621_0013170 Ga0495621_0013170_1241_1858 201
21 3300046615 Ga0495656_0000645 Ga0495656_0000645_5941_6558 201
22 3300048090 Ga0495615_0030988 Ga0495615_0030988_133_750 201
23 3300048917 Ga0496114_0579285 Ga0496114_0579285_193_810 201
24 3300048917 Ga0496114_0611837 Ga0496114_0611837_279_896 201
25 3300048929 Ga0496126_0507940 Ga0496126_0507940_50_670 201
26 3300005367 Ga0070667_100264966 Ga0070667_1002649661 203
27 3300006195 Ga0075366_10283274 Ga0075366_102832742 203
28 3300009148 Ga0105243_10000649 Ga0105243_100006492 203
29 3300014745 Ga0157377_10000006 Ga0157377_10000006408 203
30 3300031456 Ga0307513_10051191 Ga0307513_100511915 203
31 3300031507 Ga0307509_10015076 Ga0307509_1001507610 203
32 3300031507 Ga0307509_10232962 Ga0307509_102329622 203
33 3300031616 Ga0307508_10015474 Ga0307508_100154746 203
34 3300033179 Ga0307507_10148153 Ga0307507_101481532 203
35 3300033179 Ga0307507_10186574 Ga0307507_101865742 203
36 3300042134 Ga0450898_019034 Ga0450898_019034_540_1157 203
37 3300044765 Ga0466970_0222072 Ga0466970_0222072_416_1033 203
38 3300048908 Ga0496105_0611312 Ga0496105_0611312_36_647 203
39 3300050493 nmdc:mga0k408_253426_c1 nmdc:mga0k408_253426_c1_241_852 203
40 3300050493 nmdc:mga0k408_185650_c1 nmdc:mga0k408_185650_c1_292_954 207
41 3300037471 Ga0395905_0000414 Ga0395905_0000414_21577_22263 208
42 3300038443 Ga0395901_0386443 Ga0395901_0386443_179_865 208
43 iso_pu_bacteria 2721755763 2723876183 208
44 3300025297 Ga0209758_1000769 Ga0209758_100076940 209
45 3300053093 Ga0500651_0251269 Ga0500651_0251269_119_781 209
46 3300053134 Ga0500658_0246243 Ga0500658_0246243_62_697 211
47 3300014968 Ga0157379_10015125 Ga0157379_100151252 213
48 3300049568 Ga0501031_0017890 Ga0501031_0017890_3200_3880 214
49 3300028794 Ga0307515_10000921 Ga0307515_1000092113 215
50 3300028794 Ga0307515_10014878 Ga0307515_100148785 215
51 3300028794 Ga0307515_10014984 Ga0307515_1001498411 215
52 3300030522 Ga0307512_10062146 Ga0307512_100621461 215
53 3300030522 Ga0307512_10216090 Ga0307512_102160902 215
54 3300031616 Ga0307508_10000440 Ga0307508_1000044038 215
55 3300031649 Ga0307514_10104622 Ga0307514_101046223 215
56 3300033179 Ga0307507_10096470 Ga0307507_100964702 215
57 3300041486 Ga0451807_0609196 Ga0451807_0609196_25_672 215
58 3300048917 Ga0496114_0012810 Ga0496114_0012810_5739_6386 215
59 3300053088 Ga0500644_0220080 Ga0500644_0220080_44_691 215
60 3300053724 Ga0500570_142560 Ga0500570_142560_14_661 215
61 iso_pu_bacteria 2842718218 2842722348 215
62 3300032002 Ga0307416_100583780 Ga0307416_1005837802 216
63 3300037471 Ga0395905_0205558 Ga0395905_0205558_927_1604 216
64 3300042876 Ga0451577_0320259 Ga0451577_0320259_666_1316 216
65 3300044712 Ga0453684_0433910 Ga0453684_0433910_175_825 216
66 3300049571 Ga0501034_0192758 Ga0501034_0192758_1255_1947 216
67 3300049579 Ga0501043_0000277 Ga0501043_0000277_35164_35847 216
68 3300049580 Ga0501046_0000345 Ga0501046_0000345_10884_11567 216
69 3300049581 Ga0501047_0000395 Ga0501047_0000395_35164_35847 216
70 3300049582 Ga0501048_0000111 Ga0501048_0000111_35114_35797 216
71 3300049649 Ga0501198_000023 Ga0501198_000023_63189_63872 216
72 3300049662 Ga0501222_000031 Ga0501222_000031_5245_5928 216
73 3300049823 Ga0501044_0201191 Ga0501044_0201191_1089_1772 216
74 3300050493 nmdc:mga0k408_1412_c1 nmdc:mga0k408_1412_c1_8669_9346 216
75 iso_pu_bacteria 2919704043 2919708974 216
76 iso_pu_bacteria 2932422444 2932426529 216
77 iso_pu_bacteria 2974320154 2974321082 216
78 3300005331 Ga0070670_100424284 Ga0070670_1004242841 217
79 3300005353 Ga0070669_100065654 Ga0070669_1000656541 217
80 3300005356 Ga0070674_100474844 Ga0070674_1004748441 217
81 3300005563 Ga0068855_100048111 Ga0068855_1000481112 217
82 3300005844 Ga0068862_100056270 Ga0068862_1000562702 217
83 3300005844 Ga0068862_100088642 Ga0068862_1000886423 217
84 3300025925 Ga0207650_10400213 Ga0207650_104002133 217
85 3300026118 Ga0207675_100873252 Ga0207675_1008732522 217
86 3300028380 Ga0268265_10111999 Ga0268265_101119993 217
87 3300028794 Ga0307515_10294004 Ga0307515_102940042 217
88 3300031548 Ga0307408_100086692 Ga0307408_1000866922 217
89 3300032005 Ga0307411_10394400 Ga0307411_103944001 217
90 3300037312 Ga0395899_0001736 Ga0395899_0001736_229_888 217
91 3300037471 Ga0395905_0011763 Ga0395905_0011763_4149_4808 217
92 3300037471 Ga0395905_0143744 Ga0395905_0143744_226_894 217
93 3300044656 Ga0466969_0046431 Ga0466969_0046431_933_1592 217
94 3300044684 Ga0466966_0011393 Ga0466966_0011393_3029_3688 217
95 3300044693 Ga0466961_0006669 Ga0466961_0006669_2321_2980 217
96 3300044693 Ga0466961_0031397 Ga0466961_0031397_249_908 217
97 3300044765 Ga0466970_0010244 Ga0466970_0010244_4057_4716 217
98 3300044842 Ga0466957_0349773 Ga0466957_0349773_136_795 217
99 3300046525 Ga0495663_0056259 Ga0495663_0056259_195_857 217
100 3300047447 Ga0495685_057770 Ga0495685_057770_523_1185 217
101 3300049570 Ga0501033_0091106 Ga0501033_0091106_1176_1844 217
102 3300049581 Ga0501047_0264303 Ga0501047_0264303_777_1445 217
103 iso_pu_bacteria 2585428057 2587730575 217
104 iso_pu_bacteria 2585428058 2587736803 217
105 iso_pu_bacteria 2588253510 2588294950 217
106 iso_pu_bacteria 2643221592 2643967809 217
107 iso_pu_bacteria 2643221625 2644140631 217
108 iso_pu_bacteria 2643221648 2644273598 217
109 3300005347 Ga0070668_100131409 Ga0070668_1001314093 218
110 3300005459 Ga0068867_100005331 Ga0068867_1000053312 218
111 3300005616 Ga0068852_100006370 Ga0068852_1000063704 218
112 3300006195 Ga0075366_10001974 Ga0075366_1000197411 218
113 3300006195 Ga0075366_10007032 Ga0075366_100070328 218
114 3300006880 Ga0075429_100038607 Ga0075429_1000386076 218
115 3300013297 Ga0157378_10315291 Ga0157378_103152912 218
116 3300025935 Ga0207709_10001139 Ga0207709_100011392 218
117 3300026089 Ga0207648_10000254 Ga0207648_1000025456 218
118 3300026142 Ga0207698_10598438 Ga0207698_105984382 218
119 3300037471 Ga0395905_0000390 Ga0395905_0000390_45952_46638 218
120 3300037471 Ga0395905_0026010 Ga0395905_0026010_509_1177 218
121 3300041443 Ga0451789_0850686 Ga0451789_0850686_1969_2625 218
122 3300046660 Ga0495625_0138927 Ga0495625_0138927_776_1468 218
123 3300050493 nmdc:mga0k408_114280_c1 nmdc:mga0k408_114280_c1_151_837 218
124 3300050493 nmdc:mga0k408_1405_c1 nmdc:mga0k408_1405_c1_10519_11184 218
125 3300050493 nmdc:mga0k408_2400_c1 nmdc:mga0k408_2400_c1_4913_5602 218
126 3300050493 nmdc:mga0k408_2728_c1 nmdc:mga0k408_2728_c1_1109_1765 218
127 3300053116 Ga0500592_010373 Ga0500592_010373_313_969 218
128 3300053129 Ga0500628_003477 Ga0500628_003477_44_700 218
129 3300053156 Ga0500622_0001047 Ga0500622_0001047_15237_15893 218
130 iso_pu_bacteria 2643221654 2644303488 218
131 iso_pu_bacteria 2643221660 2644339838 218
132 3300003215 JGI25153J46596_10006137 JGI25153J46596_100061372 219
133 3300005331 Ga0070670_100022340 Ga0070670_1000223403 219
134 3300005459 Ga0068867_100300177 Ga0068867_1003001772 219
135 3300005618 Ga0068864_100134250 Ga0068864_1001342502 219
136 3300006195 Ga0075366_10016069 Ga0075366_100160692 219
137 3300013296 Ga0157374_10083470 Ga0157374_100834703 219
138 3300025925 Ga0207650_10032388 Ga0207650_100323883 219
139 3300026088 Ga0207641_11217294 Ga0207641_112172941 219
140 3300026089 Ga0207648_10347594 Ga0207648_103475942 219
141 3300026095 Ga0207676_10332647 Ga0207676_103326471 219
142 3300031548 Ga0307408_100257426 Ga0307408_1002574262 219
143 3300031731 Ga0307405_10042005 Ga0307405_100420053 219
144 3300031911 Ga0307412_10128716 Ga0307412_101287163 219
145 3300032005 Ga0307411_10681630 Ga0307411_106816302 219
146 3300041404 Ga0439436_0001080 Ga0439436_0001080_1726_2391 219
147 3300041405 Ga0439438_030453 Ga0439438_030453_249_914 219
148 3300041406 Ga0439439_0005108 Ga0439439_0005108_2261_2926 219
149 3300041411 Ga0439466_0027462 Ga0439466_0027462_444_1109 219
150 3300041997 Ga0439431_0013248 Ga0439431_0013248_288_953 219
151 3300041999 Ga0439433_0012758 Ga0439433_0012758_236_901 219
152 3300042002 Ga0439442_044501 Ga0439442_044501_101_766 219
153 3300042004 Ga0439445_0018507 Ga0439445_0018507_740_1414 219
154 3300042006 Ga0439432_008065 Ga0439432_008065_2935_3600 219
155 3300042007 Ga0439449_0003723 Ga0439449_0003723_724_1389 219
156 3300042010 Ga0439452_005832 Ga0439452_005832_3040_3705 219
157 3300042015 Ga0439462_0012837 Ga0439462_0012837_684_1349 219
158 3300042016 Ga0439463_012439 Ga0439463_012439_1110_1784 219
159 3300042115 Ga0450911_000958 Ga0450911_000958_4704_5378 219
160 3300042135 Ga0450899_009776 Ga0450899_009776_351_1016 219
161 3300042139 Ga0450904_014619 Ga0450904_014619_29_703 219
162 3300042145 Ga0450906_006531 Ga0450906_006531_1632_2297 219
163 3300042147 Ga0450910_029193 Ga0450910_029193_132_797 219
164 3300042184 Ga0450908_006357 Ga0450908_006357_1419_2084 219
165 3300042435 Ga0439434_0028567 Ga0439434_0028567_109_774 219
166 3300042876 Ga0451577_0012601 Ga0451577_0012601_7085_7756 219
167 3300044684 Ga0466966_0185904 Ga0466966_0185904_297_968 219
168 3300044712 Ga0453684_0029228 Ga0453684_0029228_3898_4566 219
169 3300044712 Ga0453684_0286912 Ga0453684_0286912_509_1180 219
170 3300048927 Ga0496124_0072578 Ga0496124_0072578_2083_2757 219
171 3300048929 Ga0496126_0352000 Ga0496126_0352000_63_737 219
172 3300050508 nmdc:mga09592_9369_c1 nmdc:mga09592_9369_c1_7118_7807 219
173 3300053145 Ga0500586_119185 Ga0500586_119185_216_887 219
174 3300053148 Ga0500590_014765 Ga0500590_014765_3127_3801 219
175 3300002773 JGI25152J39213_1001430 JGI25152J39213_10014303 220
176 3300003322 rootL2_10000529 rootL2_100005292 220
177 3300003323 rootH1_10046360 rootH1_100463604 220
178 3300003771 Ga0055526_1012878 Ga0055526_10128783 220
179 3300003771 Ga0055526_1019644 Ga0055526_10196443 220
180 3300004625 Ga0055543_1003590 Ga0055543_10035904 220
181 3300005262 Ga0065165_1000275 Ga0065165_100027518 220
182 3300005328 Ga0070676_10029595 Ga0070676_100295952 220
183 3300005354 Ga0070675_100708301 Ga0070675_1007083011 220
184 3300005355 Ga0070671_100157340 Ga0070671_1001573403 220
185 3300005356 Ga0070674_100004643 Ga0070674_1000046433 220
186 3300005367 Ga0070667_100168601 Ga0070667_1001686012 220
187 3300005459 Ga0068867_100005133 Ga0068867_10000513310 220
188 3300005544 Ga0070686_100257253 Ga0070686_1002572532 220
189 3300005718 Ga0068866_10043103 Ga0068866_100431033 220
190 3300005719 Ga0068861_100011019 Ga0068861_1000110192 220
191 3300005842 Ga0068858_100084797 Ga0068858_1000847971 220
192 3300005843 Ga0068860_100001559 Ga0068860_1000015599 220
193 3300005844 Ga0068862_100096490 Ga0068862_1000964903 220
194 3300006038 Ga0075365_10029216 Ga0075365_100292162 220
195 3300006195 Ga0075366_10035558 Ga0075366_100355583 220
196 3300006353 Ga0075370_10082740 Ga0075370_100827402 220
197 3300006881 Ga0068865_100003673 Ga0068865_10000367310 220
198 3300009098 Ga0105245_11495013 Ga0105245_114950131 220
199 3300009176 Ga0105242_11138166 Ga0105242_111381661 220
200 3300013297 Ga0157378_10001811 Ga0157378_1000181113 220
201 3300013306 Ga0163162_10146340 Ga0163162_101463403 220
202 3300014326 Ga0157380_10418128 Ga0157380_104181281 220
203 3300014968 Ga0157379_10181660 Ga0157379_101816602 220
204 3300014969 Ga0157376_10179771 Ga0157376_101797712 220
205 3300017792 Ga0163161_10185321 Ga0163161_101853213 220
206 3300021361 Ga0213872_10000120 Ga0213872_1000012042 220
207 3300025245 Ga0207425_1000703 Ga0207425_100070312 220
208 3300025258 Ga0209129_1000933 Ga0209129_100093311 220
209 3300025273 Ga0209673_1011570 Ga0209673_10115702 220
210 3300025273 Ga0209673_1022805 Ga0209673_10228051 220
211 3300025295 Ga0209564_1000131 Ga0209564_100013118 220
212 3300025295 Ga0209564_1000627 Ga0209564_100062749 220
213 3300025297 Ga0209758_1000593 Ga0209758_100059351 220
214 3300025298 Ga0209050_1006185 Ga0209050_10061855 220
215 3300025299 Ga0209256_1012880 Ga0209256_10128804 220
216 3300025893 Ga0207682_10014895 Ga0207682_100148953 220
217 3300025899 Ga0207642_10363024 Ga0207642_103630242 220
218 3300025907 Ga0207645_10038735 Ga0207645_100387352 220
219 3300025907 Ga0207645_10309475 Ga0207645_103094752 220
220 3300025923 Ga0207681_10315989 Ga0207681_103159892 220
221 3300025926 Ga0207659_10553826 Ga0207659_105538262 220
222 3300025931 Ga0207644_10211412 Ga0207644_102114123 220
223 3300025937 Ga0207669_10107865 Ga0207669_101078653 220
224 3300025961 Ga0207712_10035567 Ga0207712_100355671 220
225 3300025961 Ga0207712_10518260 Ga0207712_105182602 220
226 3300025972 Ga0207668_10092283 Ga0207668_100922832 220
227 3300025986 Ga0207658_10131102 Ga0207658_101311023 220
228 3300026067 Ga0207678_10223615 Ga0207678_102236152 220
229 3300026089 Ga0207648_10000419 Ga0207648_1000041910 220
230 3300026118 Ga0207675_100004240 Ga0207675_1000042408 220
231 3300027252 Ga0209973_1000754 Ga0209973_10007542 220
232 3300027395 Ga0209996_1000743 Ga0209996_10007433 220
233 3300027526 Ga0209968_1000617 Ga0209968_10006177 220
234 3300027614 Ga0209970_1000134 Ga0209970_100013415 220
235 3300027695 Ga0209966_1000517 Ga0209966_10005172 220
236 3300027876 Ga0209974_10020998 Ga0209974_100209984 220
237 3300028380 Ga0268265_10037721 Ga0268265_100377212 220
238 3300028381 Ga0268264_10002884 Ga0268264_100028849 220
239 3300028794 Ga0307515_10001761 Ga0307515_1000176112 220
240 3300031456 Ga0307513_10038516 Ga0307513_100385168 220
241 3300031548 Ga0307408_100001205 Ga0307408_10000120518 220
242 3300031548 Ga0307408_100307508 Ga0307408_1003075082 220
243 3300031730 Ga0307516_10074847 Ga0307516_100748472 220
244 3300031901 Ga0307406_10022265 Ga0307406_100222655 220
245 3300031901 Ga0307406_10052853 Ga0307406_100528534 220
246 3300031901 Ga0307406_10882201 Ga0307406_108822011 220
247 3300031911 Ga0307412_10220062 Ga0307412_102200622 220
248 3300032005 Ga0307411_10120508 Ga0307411_101205082 220
249 3300032005 Ga0307411_10171933 Ga0307411_101719331 220
250 3300035691 Ga0373931_0246067 Ga0373931_0246067_91_789 220
251 3300039447 Ga0436361_0097160 Ga0436361_0097160_42185_42847 220
252 3300044735 Ga0466968_0014124 Ga0466968_0014124_1858_2526 220
253 3300046471 Ga0495650_0002706 Ga0495650_0002706_9310_9978 220
254 3300049679 Ga0501249_018719 Ga0501249_018719_415_1113 220
255 3300050492 nmdc:mga0yw44_156222_c1 nmdc:mga0yw44_156222_c1_776_1480 220
256 3300050493 nmdc:mga0k408_108211_c1 nmdc:mga0k408_108211_c1_391_1059 220
257 3300053094 Ga0500566_0132409 Ga0500566_0132409_356_1144 220
258 iso_pu_bacteria 2643221644 2644247307 220
259 3300003322 rootL2_10110021 rootL2_101100212 221
260 3300005262 Ga0065165_1000910 Ga0065165_10009103 221
261 3300005331 Ga0070670_100243643 Ga0070670_1002436433 221
262 3300005335 Ga0070666_10019439 Ga0070666_100194393 221
263 3300005340 Ga0070689_100371424 Ga0070689_1003714242 221
264 3300005353 Ga0070669_100350380 Ga0070669_1003503801 221
265 3300005354 Ga0070675_100173489 Ga0070675_1001734892 221
266 3300005355 Ga0070671_100055566 Ga0070671_1000555664 221
267 3300005364 Ga0070673_100044736 Ga0070673_1000447362 221
268 3300005617 Ga0068859_100035247 Ga0068859_1000352475 221
269 3300005618 Ga0068864_100011131 Ga0068864_1000111314 221
270 3300005841 Ga0068863_100010999 Ga0068863_1000109994 221
271 3300006048 Ga0075363_100038891 Ga0075363_1000388912 221
272 3300006178 Ga0075367_10024628 Ga0075367_100246284 221
273 3300006186 Ga0075369_10174554 Ga0075369_101745542 221
274 3300006195 Ga0075366_10007235 Ga0075366_100072352 221
275 3300006353 Ga0075370_10001171 Ga0075370_1000117110 221
276 3300006931 Ga0097620_100035247 Ga0097620_1000352475 221
277 3300009101 Ga0105247_10236614 Ga0105247_102366142 221
278 3300009176 Ga0105242_10212059 Ga0105242_102120592 221
279 3300009177 Ga0105248_10063363 Ga0105248_100633633 221
280 3300013296 Ga0157374_10143755 Ga0157374_101437552 221
281 3300013297 Ga0157378_10186138 Ga0157378_101861383 221
282 3300013308 Ga0157375_10090733 Ga0157375_100907332 221
283 3300014325 Ga0163163_10011394 Ga0163163_100113942 221
284 3300014968 Ga0157379_10016325 Ga0157379_100163252 221
285 3300025273 Ga0209673_1008819 Ga0209673_10088196 221
286 3300025321 Ga0207656_10151086 Ga0207656_101510862 221
287 3300025903 Ga0207680_10027060 Ga0207680_100270603 221
288 3300025907 Ga0207645_10117487 Ga0207645_101174872 221
289 3300025908 Ga0207643_10032633 Ga0207643_100326331 221
290 3300025926 Ga0207659_10135532 Ga0207659_101355322 221
291 3300025931 Ga0207644_10048247 Ga0207644_100482474 221
292 3300025940 Ga0207691_10058049 Ga0207691_100580493 221
293 3300025941 Ga0207711_10189790 Ga0207711_101897902 221
294 3300025942 Ga0207689_10049644 Ga0207689_100496444 221
295 3300025972 Ga0207668_10081035 Ga0207668_100810352 221
296 3300025986 Ga0207658_10598098 Ga0207658_105980981 221
297 3300026035 Ga0207703_10067755 Ga0207703_100677553 221
298 3300026035 Ga0207703_10498340 Ga0207703_104983402 221
299 3300026089 Ga0207648_10024822 Ga0207648_100248222 221
300 3300026118 Ga0207675_100032919 Ga0207675_1000329196 221
301 3300026121 Ga0207683_10153958 Ga0207683_101539583 221
302 3300026121 Ga0207683_10388700 Ga0207683_103887002 221
303 3300031456 Ga0307513_10401501 Ga0307513_104015012 221
304 3300031649 Ga0307514_10066289 Ga0307514_100662893 221
305 3300031730 Ga0307516_10004218 Ga0307516_1000421812 221
306 3300041413 Ga0439465_0047787 Ga0439465_0047787_33_704 221
307 3300041452 Ga0451793_0799789 Ga0451793_0799789_255_920 221
308 3300041458 Ga0451798_0442166 Ga0451798_0442166_277_942 221
309 3300041459 Ga0451800_0413036 Ga0451800_0413036_165_830 221
310 3300041503 Ga0451847_0358612 Ga0451847_0358612_64_729 221
311 3300042439 Ga0439464_0002359 Ga0439464_0002359_3708_4379 221
312 3300042461 Ga0439460_0104476 Ga0439460_0104476_217_888 221
313 3300042993 Ga0439440_0033556 Ga0439440_0033556_505_1176 221
314 3300045051 Ga0451576_0609150 Ga0451576_0609150_294_977 221
315 3300046455 Ga0495603_0397440 Ga0495603_0397440_16_687 221
316 3300046515 Ga0495620_0042763 Ga0495620_0042763_320_985 221
317 3300046519 Ga0495632_0001689 Ga0495632_0001689_24_689 221
318 3300048912 Ga0496109_0588972 Ga0496109_0588972_150_821 221
319 3300048924 Ga0496121_0007296 Ga0496121_0007296_7946_8626 221
320 3300048928 Ga0496125_0167490 Ga0496125_0167490_82_762 221
321 3300050489 nmdc:mga03683_183520_c1 nmdc:mga03683_183520_c1_216_881 221
322 3300050490 nmdc:mga03n38_19557_c1 nmdc:mga03n38_19557_c1_1065_1730 221
323 3300050494 nmdc:mga06z11_229286_c1 nmdc:mga06z11_229286_c1_407_1072 221
324 3300050496 nmdc:mga07m45_8856_c1 nmdc:mga07m45_8856_c1_2808_3473 221
325 3300050516 nmdc:mga0sz30_123419_c1 nmdc:mga0sz30_123419_c1_217_882 221
326 3300053086 Ga0500578_0000406 Ga0500578_0000406_42817_43482 221
327 3300053088 Ga0500644_0095571 Ga0500644_0095571_404_1069 221
328 3300053090 Ga0500646_0005193 Ga0500646_0005193_1360_2025 221
329 3300053093 Ga0500651_0000877 Ga0500651_0000877_9240_9905 221
330 3300053105 Ga0500557_025453 Ga0500557_025453_159_824 221
331 3300053131 Ga0500652_000420 Ga0500652_000420_1781_2446 221
332 3300053133 Ga0500655_007928 Ga0500655_007928_471_1136 221
333 3300053137 Ga0500561_0128650 Ga0500561_0128650_48_725 221
334 3300053139 Ga0500568_0005916 Ga0500568_0005916_5414_6088 221
335 3300053151 Ga0500604_0018531 Ga0500604_0018531_106_771 221
336 3300005331 Ga0070670_100019018 Ga0070670_1000190181 222
337 3300005333 Ga0070677_10080025 Ga0070677_100800252 222
338 3300005334 Ga0068869_100485834 Ga0068869_1004858342 222
339 3300005338 Ga0068868_100084774 Ga0068868_1000847742 222
340 3300005354 Ga0070675_100034226 Ga0070675_1000342261 222
341 3300005364 Ga0070673_100003372 Ga0070673_10000337210 222
342 3300005457 Ga0070662_100177261 Ga0070662_1001772613 222
343 3300005459 Ga0068867_100015928 Ga0068867_1000159286 222
344 3300005543 Ga0070672_100050694 Ga0070672_1000506942 222
345 3300006195 Ga0075366_10036429 Ga0075366_100364294 222
346 3300006195 Ga0075366_10160212 Ga0075366_101602121 222
347 3300006353 Ga0075370_10000142 Ga0075370_1000014222 222
348 3300006353 Ga0075370_10143256 Ga0075370_101432562 222
349 3300009148 Ga0105243_10099669 Ga0105243_100996692 222
350 3300009176 Ga0105242_10001267 Ga0105242_1000126710 222
351 3300013308 Ga0157375_10168125 Ga0157375_101681255 222
352 3300014325 Ga0163163_10519715 Ga0163163_105197152 222
353 3300014745 Ga0157377_10195360 Ga0157377_101953601 222
354 3300025298 Ga0209050_1000799 Ga0209050_100079937 222
355 3300025303 Ga0209051_1030024 Ga0209051_10300242 222
356 3300025907 Ga0207645_10060630 Ga0207645_100606302 222
357 3300025925 Ga0207650_10076434 Ga0207650_100764344 222
358 3300025926 Ga0207659_10098310 Ga0207659_100983103 222
359 3300025931 Ga0207644_10061537 Ga0207644_100615372 222
360 3300025933 Ga0207706_10230598 Ga0207706_102305983 222
361 3300025934 Ga0207686_10018660 Ga0207686_100186603 222
362 3300025940 Ga0207691_10080650 Ga0207691_100806503 222
363 3300025942 Ga0207689_10423688 Ga0207689_104236882 222
364 3300025960 Ga0207651_10064540 Ga0207651_100645403 222
365 3300026023 Ga0207677_10075816 Ga0207677_100758163 222
366 3300026089 Ga0207648_10161244 Ga0207648_101612443 222
367 3300028794 Ga0307515_10011753 Ga0307515_100117538 222
368 3300028794 Ga0307515_10179398 Ga0307515_101793982 222
369 3300030522 Ga0307512_10096586 Ga0307512_100965862 222
370 3300031239 Ga0265328_10020766 Ga0265328_100207662 222
371 3300031251 Ga0265327_10000924 Ga0265327_1000092428 222
372 3300031456 Ga0307513_10010837 Ga0307513_100108372 222
373 3300031507 Ga0307509_10038943 Ga0307509_100389436 222
374 3300031507 Ga0307509_10065554 Ga0307509_100655542 222
375 3300031507 Ga0307509_10290623 Ga0307509_102906233 222
376 3300031616 Ga0307508_10004752 Ga0307508_1000475214 222
377 3300031649 Ga0307514_10146712 Ga0307514_101467121 222
378 3300033179 Ga0307507_10092918 Ga0307507_100929182 222
379 3300033180 Ga0307510_10003419 Ga0307510_1000341910 222
380 3300033180 Ga0307510_10033328 Ga0307510_100333286 222
381 3300035084 Ga0373928_0014086 Ga0373928_0014086_783_1451 222
382 3300035691 Ga0373931_0128594 Ga0373931_0128594_739_1407 222
383 3300042876 Ga0451577_0011181 Ga0451577_0011181_3994_4716 222
384 3300044673 Ga0453683_0153151 Ga0453683_0153151_322_1044 222
385 3300045051 Ga0451576_0022025 Ga0451576_0022025_6136_6858 222
386 3300046454 Ga0495592_0000528 Ga0495592_0000528_11179_11847 222
387 3300046460 Ga0495638_0195584 Ga0495638_0195584_130_798 222
388 3300046507 Ga0495606_0046495 Ga0495606_0046495_544_1212 222
389 3300046507 Ga0495606_0151581 Ga0495606_0151581_454_1122 222
390 3300046512 Ga0495610_0061187 Ga0495610_0061187_359_1027 222
391 3300046516 Ga0495628_0499329 Ga0495628_0499329_120_788 222
392 3300046517 Ga0495630_0132527 Ga0495630_0132527_153_821 222
393 3300046519 Ga0495632_0157544 Ga0495632_0157544_94_762 222
394 3300046660 Ga0495625_0280749 Ga0495625_0280749_299_967 222
395 3300046683 Ga0495658_0373100 Ga0495658_0373100_31_699 222
396 3300046690 Ga0495624_0168579 Ga0495624_0168579_468_1136 222
397 3300046694 Ga0495649_0226441 Ga0495649_0226441_52_720 222
398 3300047321 Ga0495676_0019792 Ga0495676_0019792_586_1254 222
399 3300047472 Ga0495686_0115238 Ga0495686_0115238_649_1320 222
400 3300048915 Ga0496112_0435218 Ga0496112_0435218_356_1024 222
401 3300049460 Ga0495682_0137470 Ga0495682_0137470_183_851 222
402 3300050496 nmdc:mga07m45_142595_c1 nmdc:mga07m45_142595_c1_354_1055 222
403 3300050496 nmdc:mga07m45_82398_c1 nmdc:mga07m45_82398_c1_729_1397 222
404 3300053136 Ga0500559_0000265 Ga0500559_0000265_28271_28939 222
405 3300053139 Ga0500568_0105393 Ga0500568_0105393_347_1015 222
406 3300053156 Ga0500622_0002039 Ga0500622_0002039_2118_2786 222
407 3300053730 Ga0500645_003124 Ga0500645_003124_246_914 222
408 3300053739 Ga0500587_005322 Ga0500587_005322_588_1256 222
409 3300003775 Ga0055524_1000139 Ga0055524_100013926 223
410 3300003791 Ga0055530_10004180 Ga0055530_100041805 223
411 3300003792 Ga0055540_1000090 Ga0055540_100009027 223
412 3300003792 Ga0055540_1000091 Ga0055540_100009125 223
413 3300003794 Ga0055531_10004796 Ga0055531_100047968 223
414 3300005355 Ga0070671_100042415 Ga0070671_1000424152 223
415 3300005356 Ga0070674_100035498 Ga0070674_1000354984 223
416 3300005364 Ga0070673_100597514 Ga0070673_1005975142 223
417 3300005543 Ga0070672_100652605 Ga0070672_1006526052 223
418 3300005548 Ga0070665_100058116 Ga0070665_1000581164 223
419 3300005617 Ga0068859_100286744 Ga0068859_1002867442 223
420 3300005618 Ga0068864_100035355 Ga0068864_1000353555 223
421 3300006048 Ga0075363_100186555 Ga0075363_1001865552 223
422 3300006195 Ga0075366_10000582 Ga0075366_1000058213 223
423 3300006353 Ga0075370_10002800 Ga0075370_100028005 223
424 3300006353 Ga0075370_10057297 Ga0075370_100572972 223
425 3300006931 Ga0097620_100286764 Ga0097620_1002867642 223
426 3300009098 Ga0105245_10111121 Ga0105245_101111212 223
427 3300013306 Ga0163162_10457890 Ga0163162_104578902 223
428 3300025298 Ga0209050_1000326 Ga0209050_100032663 223
429 3300025299 Ga0209256_1000019 Ga0209256_1000019496 223
430 3300025303 Ga0209051_1000133 Ga0209051_100013328 223
431 3300025304 Ga0209257_1000038 Ga0209257_100003828 223
432 3300025927 Ga0207687_10275771 Ga0207687_102757713 223
433 3300025937 Ga0207669_10034388 Ga0207669_100343883 223
434 3300025937 Ga0207669_10470736 Ga0207669_104707361 223
435 3300025940 Ga0207691_10481919 Ga0207691_104819192 223
436 3300026023 Ga0207677_10259992 Ga0207677_102599922 223
437 3300026121 Ga0207683_10516442 Ga0207683_105164422 223
438 3300027111 Ga0209281_1000098 Ga0209281_100009822 223
439 3300028786 Ga0307517_10173770 Ga0307517_101737702 223
440 3300031507 Ga0307509_10449407 Ga0307509_104494072 223
441 3300032002 Ga0307416_100415644 Ga0307416_1004156443 223
442 3300037471 Ga0395905_0005385 Ga0395905_0005385_10428_11105 223
443 3300048905 Ga0496102_0019151 Ga0496102_0019151_3749_4420 223
444 3300049668 Ga0501233_011743 Ga0501233_011743_214_915 223
445 3300049683 Ga0501253_024256 Ga0501253_024256_16_717 223
446 3300049686 Ga0501257_039041 Ga0501257_039041_114_815 223
447 3300049762 Ga0501265_005711 Ga0501265_005711_479_1180 223
448 3300050493 nmdc:mga0k408_21052_c1 nmdc:mga0k408_21052_c1_2674_3378 223
449 3300050493 nmdc:mga0k408_5321_c1 nmdc:mga0k408_5321_c1_437_1108 223
450 3300050496 nmdc:mga07m45_1876_c1 nmdc:mga07m45_1876_c1_3412_4083 223
451 3300050496 nmdc:mga07m45_50139_c1 nmdc:mga07m45_50139_c1_308_979 223
452 iso_pu_bacteria 2585428062 2587758925 223
453 3300003759 Ga0055525_1000056 Ga0055525_1000056176 224
454 3300005328 Ga0070676_10068154 Ga0070676_100681543 224
455 3300005355 Ga0070671_100082453 Ga0070671_1000824532 224
456 3300005455 Ga0070663_100127553 Ga0070663_1001275532 224
457 3300005459 Ga0068867_100046359 Ga0068867_1000463592 224
458 3300005459 Ga0068867_100211512 Ga0068867_1002115123 224
459 3300005578 Ga0068854_100057248 Ga0068854_1000572482 224
460 3300005616 Ga0068852_100048807 Ga0068852_1000488072 224
461 3300006038 Ga0075365_10082684 Ga0075365_100826844 224
462 3300006042 Ga0075368_10003231 Ga0075368_100032317 224
463 3300006048 Ga0075363_100000145 Ga0075363_1000001459 224
464 3300006048 Ga0075363_100159152 Ga0075363_1001591523 224
465 3300006051 Ga0075364_10034817 Ga0075364_100348172 224
466 3300006051 Ga0075364_10097895 Ga0075364_100978953 224
467 3300006177 Ga0075362_10000580 Ga0075362_1000058012 224
468 3300006177 Ga0075362_10003899 Ga0075362_100038992 224
469 3300006178 Ga0075367_10004330 Ga0075367_100043302 224
470 3300006178 Ga0075367_10012127 Ga0075367_100121275 224
471 3300006178 Ga0075367_10076032 Ga0075367_100760322 224
472 3300006186 Ga0075369_10018407 Ga0075369_100184072 224
473 3300006186 Ga0075369_10082969 Ga0075369_100829692 224
474 3300006195 Ga0075366_10022472 Ga0075366_100224722 224
475 3300006195 Ga0075366_10062429 Ga0075366_100624292 224
476 3300006195 Ga0075366_10305605 Ga0075366_103056052 224
477 3300006195 Ga0075366_10381676 Ga0075366_103816761 224
478 3300006353 Ga0075370_10000854 Ga0075370_100008547 224
479 3300006353 Ga0075370_10010740 Ga0075370_100107406 224
480 3300006353 Ga0075370_10129241 Ga0075370_101292412 224
481 3300009093 Ga0105240_10628568 Ga0105240_106285682 224
482 3300009098 Ga0105245_10707779 Ga0105245_107077792 224
483 3300009148 Ga0105243_10169051 Ga0105243_101690512 224
484 3300009545 Ga0105237_10044846 Ga0105237_100448466 224
485 3300010375 Ga0105239_10466380 Ga0105239_104663802 224
486 3300025230 Ga0209563_100014 Ga0209563_10001418 224
487 3300025907 Ga0207645_10215254 Ga0207645_102152542 224
488 3300025907 Ga0207645_10281229 Ga0207645_102812292 224
489 3300025914 Ga0207671_10031240 Ga0207671_100312403 224
490 3300025931 Ga0207644_10160485 Ga0207644_101604853 224
491 3300025981 Ga0207640_10126527 Ga0207640_101265272 224
492 3300026067 Ga0207678_10144564 Ga0207678_101445642 224
493 3300026089 Ga0207648_10066548 Ga0207648_100665482 224
494 3300026089 Ga0207648_10178308 Ga0207648_101783083 224
495 3300026142 Ga0207698_10144531 Ga0207698_101445312 224
496 3300026142 Ga0207698_10448473 Ga0207698_104484732 224
497 3300031456 Ga0307513_10052373 Ga0307513_100523733 224
498 3300031616 Ga0307508_10279184 Ga0307508_102791842 224
499 3300031730 Ga0307516_10054856 Ga0307516_100548563 224
500 3300033180 Ga0307510_10245266 Ga0307510_102452662 224
501 3300041498 Ga0451841_0330404 Ga0451841_0330404_153_827 224
502 3300042121 Ga0450919_001362 Ga0450919_001362_518_1192 224
503 3300042122 Ga0450920_023976 Ga0450920_023976_417_1091 224
504 3300042435 Ga0439434_0018569 Ga0439434_0018569_832_1518 224
505 3300042531 Ga0450918_000283 Ga0450918_000283_2373_3047 224
506 3300046519 Ga0495632_0027029 Ga0495632_0027029_1602_2276 224
507 3300046525 Ga0495663_0072460 Ga0495663_0072460_97_801 224
508 3300046542 Ga0495597_0042908 Ga0495597_0042908_287_961 224
509 3300046558 Ga0495633_0010434 Ga0495633_0010434_3774_4478 224
510 3300046694 Ga0495649_0003993 Ga0495649_0003993_8675_9349 224
511 3300046810 Ga0495660_0035588 Ga0495660_0035588_1547_2221 224
512 3300047443 Ga0495687_001797 Ga0495687_001797_5385_6059 224
513 3300048091 Ga0495626_0045695 Ga0495626_0045695_116_790 224
514 3300048912 Ga0496109_0709054 Ga0496109_0709054_203_901 224
515 3300048926 Ga0496123_0193140 Ga0496123_0193140_295_999 224
516 3300050489 nmdc:mga03683_193631_c1 nmdc:mga03683_193631_c1_30_704 224
517 3300050489 nmdc:mga03683_41757_c1 nmdc:mga03683_41757_c1_271_945 224
518 3300050490 nmdc:mga03n38_128795_c1 nmdc:mga03n38_128795_c1_440_1114 224
519 3300050490 nmdc:mga03n38_345959_c1 nmdc:mga03n38_345959_c1_68_742 224
520 3300050490 nmdc:mga03n38_4126_c1 nmdc:mga03n38_4126_c1_2997_3671 224
521 3300050491 nmdc:mga00v17_27516_c1 nmdc:mga00v17_27516_c1_2456_3130 224
522 3300050491 nmdc:mga00v17_8528_c1 nmdc:mga00v17_8528_c1_2890_3564 224
523 3300050492 nmdc:mga0yw44_69791_c1 nmdc:mga0yw44_69791_c1_825_1499 224
524 3300050493 nmdc:mga0k408_11041_c1 nmdc:mga0k408_11041_c1_968_1642 224
525 3300050493 nmdc:mga0k408_13795_c1 nmdc:mga0k408_13795_c1_2741_3415 224
526 3300050493 nmdc:mga0k408_4980_c1 nmdc:mga0k408_4980_c1_4743_5417 224
527 3300050493 nmdc:mga0k408_5383_c1 nmdc:mga0k408_5383_c1_1468_2142 224
528 3300050493 nmdc:mga0k408_74914_c1 nmdc:mga0k408_74914_c1_880_1554 224
529 3300050493 nmdc:mga0k408_76377_c1 nmdc:mga0k408_76377_c1_411_1085 224
530 3300050494 nmdc:mga06z11_121291_c1 nmdc:mga06z11_121291_c1_499_1173 224
531 3300050494 nmdc:mga06z11_3034_c1 nmdc:mga06z11_3034_c1_3478_4152 224
532 3300050494 nmdc:mga06z11_70879_c1 nmdc:mga06z11_70879_c1_588_1262 224
533 3300050495 nmdc:mga04h51_5190_c1 nmdc:mga04h51_5190_c1_2404_3078 224
534 3300050496 nmdc:mga07m45_1136_c1 nmdc:mga07m45_1136_c1_8007_8681 224
535 3300050496 nmdc:mga07m45_149947_c1 nmdc:mga07m45_149947_c1_650_1324 224
536 3300050496 nmdc:mga07m45_17485_c1 nmdc:mga07m45_17485_c1_2620_3294 224
537 3300050496 nmdc:mga07m45_27001_c1 nmdc:mga07m45_27001_c1_1441_2115 224
538 3300050496 nmdc:mga07m45_369984_c1 nmdc:mga07m45_369984_c1_125_799 224
539 3300050496 nmdc:mga07m45_476129_c1 nmdc:mga07m45_476129_c1_16_690 224
540 3300050496 nmdc:mga07m45_59872_c1 nmdc:mga07m45_59872_c1_868_1542 224
541 3300050516 nmdc:mga0sz30_12980_c1 nmdc:mga0sz30_12980_c1_824_1498 224
542 3300050516 nmdc:mga0sz30_139147_c1 nmdc:mga0sz30_139147_c1_114_788 224
543 3300053134 Ga0500658_0016399 Ga0500658_0016399_2057_2731 224
544 3300005367 Ga0070667_100006649 Ga0070667_10000664911 225
545 3300005548 Ga0070665_100901408 Ga0070665_1009014082 225
546 3300014968 Ga0157379_10500916 Ga0157379_105009162 225
547 3300025986 Ga0207658_10006476 Ga0207658_100064765 225
548 3300031548 Ga0307408_100246376 Ga0307408_1002463761 225
549 3300031731 Ga0307405_10020862 Ga0307405_100208624 225
550 3300031824 Ga0307413_10229807 Ga0307413_102298072 225
551 3300031852 Ga0307410_10057965 Ga0307410_100579653 225
552 3300031901 Ga0307406_10035628 Ga0307406_100356282 225
553 3300031903 Ga0307407_10026775 Ga0307407_100267754 225
554 3300031911 Ga0307412_10016042 Ga0307412_100160422 225
555 3300031995 Ga0307409_100087784 Ga0307409_1000877843 225
556 3300032002 Ga0307416_100166662 Ga0307416_1001666623 225
557 3300032005 Ga0307411_10043269 Ga0307411_100432694 225
558 3300032126 Ga0307415_100029395 Ga0307415_1000293952 225
559 3300037068 Ga0373925_0039291 Ga0373925_0039291_1191_1868 225
560 3300048924 Ga0496121_0407793 Ga0496121_0407793_53_730 225
561 3300005344 Ga0070661_100000229 Ga0070661_1000002294 226
562 3300005366 Ga0070659_100009239 Ga0070659_1000092397 226
563 3300005445 Ga0070708_100769021 Ga0070708_1007690211 226
564 3300005467 Ga0070706_100000367 Ga0070706_10000036714 226
565 3300005468 Ga0070707_100386312 Ga0070707_1003863122 226
566 3300005468 Ga0070707_100564759 Ga0070707_1005647591 226
567 3300005518 Ga0070699_100219331 Ga0070699_1002193313 226
568 3300005564 Ga0070664_100002915 Ga0070664_1000029152 226
569 3300005564 Ga0070664_100071927 Ga0070664_1000719272 226
570 3300005844 Ga0068862_100436574 Ga0068862_1004365742 226
571 3300006178 Ga0075367_10002249 Ga0075367_100022497 226
572 3300006946 Ga0079104_1000623 Ga0079104_100062329 226
573 3300009092 Ga0105250_10000388 Ga0105250_1000038823 226
574 3300009148 Ga0105243_10007502 Ga0105243_100075023 226
575 3300025711 Ga0207696_1002807 Ga0207696_10028075 226
576 3300025922 Ga0207646_10403551 Ga0207646_104035512 226
577 3300025933 Ga0207706_10091751 Ga0207706_100917512 226
578 3300025935 Ga0207709_10000696 Ga0207709_100006968 226
579 3300025945 Ga0207679_10000339 Ga0207679_1000033911 226
580 3300027111 Ga0209281_1000072 Ga0209281_1000072139 226
581 iso_pu_bacteria 2721755523 2722881241 226
582 iso_pu_bacteria 2839138175 2839142963 226
583 3300005290 Ga0065712_10112866 Ga0065712_101128661 227
584 3300005331 Ga0070670_100000775 Ga0070670_10000077514 227
585 3300005333 Ga0070677_10075135 Ga0070677_100751352 227
586 3300005338 Ga0068868_100235045 Ga0068868_1002350452 227
587 3300005347 Ga0070668_100442393 Ga0070668_1004423931 227
588 3300005353 Ga0070669_100020944 Ga0070669_1000209445 227
589 3300005354 Ga0070675_100001482 Ga0070675_10000148215 227
590 3300005355 Ga0070671_100020586 Ga0070671_1000205865 227
591 3300005456 Ga0070678_100196618 Ga0070678_1001966182 227
592 3300005459 Ga0068867_100002317 Ga0068867_1000023179 227
593 3300005543 Ga0070672_100000485 Ga0070672_10000048514 227
594 3300005548 Ga0070665_100190031 Ga0070665_1001900312 227
595 3300005564 Ga0070664_100091085 Ga0070664_1000910854 227
596 3300005618 Ga0068864_100456503 Ga0068864_1004565032 227
597 3300006237 Ga0097621_100134922 Ga0097621_1001349222 227
598 3300006881 Ga0068865_100160693 Ga0068865_1001606932 227
599 3300013308 Ga0157375_10411959 Ga0157375_104119592 227
600 3300014969 Ga0157376_10101365 Ga0157376_101013652 227
601 3300017792 Ga0163161_10092954 Ga0163161_100929543 227
602 3300025321 Ga0207656_10113634 Ga0207656_101136342 227
603 3300025893 Ga0207682_10004387 Ga0207682_100043874 227
604 3300025923 Ga0207681_10060602 Ga0207681_100606023 227
605 3300025925 Ga0207650_10000275 Ga0207650_1000027547 227
606 3300025926 Ga0207659_10003305 Ga0207659_100033059 227
607 3300025931 Ga0207644_10005477 Ga0207644_100054774 227
608 3300025937 Ga0207669_10342375 Ga0207669_103423752 227
609 3300025938 Ga0207704_10120769 Ga0207704_101207693 227
610 3300025940 Ga0207691_10001335 Ga0207691_1000133522 227
611 3300025945 Ga0207679_10078325 Ga0207679_100783254 227
612 3300025960 Ga0207651_10008298 Ga0207651_100082987 227
613 3300026023 Ga0207677_10084359 Ga0207677_100843592 227
614 3300026041 Ga0207639_10413635 Ga0207639_104136352 227
615 3300026089 Ga0207648_10063438 Ga0207648_100634382 227
616 3300026095 Ga0207676_10029853 Ga0207676_100298532 227
617 3300026121 Ga0207683_10061301 Ga0207683_100613012 227
618 3300027876 Ga0209974_10019124 Ga0209974_100191241 227
619 3300031730 Ga0307516_10001028 Ga0307516_1000102813 227
620 3300037471 Ga0395905_0004449 Ga0395905_0004449_12865_13587 227
621 3300041456 Ga0451795_0058901 Ga0451795_0058901_650_1420 227
622 3300041459 Ga0451800_0280383 Ga0451800_0280383_539_1309 227
623 3300044656 Ga0466969_0035601 Ga0466969_0035601_1297_1992 227
624 3300044683 Ga0466965_0132402 Ga0466965_0132402_221_916 227
625 3300044684 Ga0466966_0237819 Ga0466966_0237819_87_782 227
626 3300044693 Ga0466961_0005169 Ga0466961_0005169_160_855 227
627 3300045049 Ga0466959_0028817 Ga0466959_0028817_2290_2985 227
628 3300046519 Ga0495632_0034016 Ga0495632_0034016_307_1077 227
629 3300046542 Ga0495597_0001717 Ga0495597_0001717_8992_9726 227
630 3300046660 Ga0495625_0027381 Ga0495625_0027381_582_1352 227
631 3300050493 nmdc:mga0k408_322552_c1 nmdc:mga0k408_322552_c1_126_896 227
632 3300050496 nmdc:mga07m45_179112_c1 nmdc:mga07m45_179112_c1_360_1130 227
633 3300050496 nmdc:mga07m45_179352_c1 nmdc:mga07m45_179352_c1_104_874 227
634 3300050496 nmdc:mga07m45_47236_c1 nmdc:mga07m45_47236_c1_934_1704 227
635 3300053739 Ga0500587_000568 Ga0500587_000568_357_1127 227
636 3300061719 Ga0466962_0027267 Ga0466962_0027267_1632_2327 227
637 3300005353 Ga0070669_100255740 Ga0070669_1002557402 228
638 3300005355 Ga0070671_100285619 Ga0070671_1002856192 228
639 3300005618 Ga0068864_100018209 Ga0068864_1000182093 228
640 3300009177 Ga0105248_10112249 Ga0105248_101122492 228
641 3300009553 Ga0105249_10062676 Ga0105249_100626764 228
642 3300026095 Ga0207676_10019987 Ga0207676_100199874 228
643 3300036401 Ga0373937_0369994 Ga0373937_0369994_385_1077 228
644 3300047472 Ga0495686_0171187 Ga0495686_0171187_427_1119 228
645 3300048908 Ga0496105_0349373 Ga0496105_0349373_437_1138 228
646 3300048909 Ga0496106_0013343 Ga0496106_0013343_4343_5035 228
647 3300048912 Ga0496109_0725556 Ga0496109_0725556_28_729 228
648 3300048915 Ga0496112_0109655 Ga0496112_0109655_613_1314 228
649 3300048916 Ga0496113_0040369 Ga0496113_0040369_793_1494 228
650 3300053136 Ga0500559_0017226 Ga0500559_0017226_414_1115 228
651 3300013105 Ga0157369_10588827 Ga0157369_105888272 229
652 3300046616 Ga0495668_0259086 Ga0495668_0259086_97_804 229
653 3300048925 Ga0496122_0147468 Ga0496122_0147468_313_1050 230
654 3300048926 Ga0496123_0067285 Ga0496123_0067285_1268_2005 230
655 3300048928 Ga0496125_0070525 Ga0496125_0070525_1260_1997 230
656 3300048929 Ga0496126_0120194 Ga0496126_0120194_233_970 230
657 3300001979 JGI24740J21852_10004370 JGI24740J21852_100043704 235

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21948

LplA-B_cat

Lipoyl protein ligase A/B catalytic domain

46

262

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
1w66-assembly1.cif.gz_A structure of a lipoate-protein ligase b from mycobacterium tuberculosis 0.9172 9 230
2qhv-assembly1.cif.gz_A structural basis of octanoic acid recognition by lipoate-protein ligase b 0.8909 9 227
2qhv-assembly1.cif.gz_A structural basis of octanoic acid recognition by lipoate-protein ligase b 0.8626 9 227
1w66-assembly1.cif.gz_A structure of a lipoate-protein ligase b from mycobacterium tuberculosis 0.8569 9 230
2c7i-assembly2.cif.gz_B structure of protein ta0514, putative lipoate protein ligase from t. acidophilum. 0.7635 9 228
ID Description Score Start End Superfamily
af_P60720_2_203_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.9778 8 228 3.30.930.10
af_P60720_2_203_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.9683 8 228 3.30.930.10
1w66A01 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.9208 9 228 3.30.930.10
af_Q9SXP7_6_215_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.9004 11 228 3.30.930.10
2qhuA01 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.8926 9 227 3.30.930.10
ID Description Score Start End GO Terms
AF-A0A3D3D3L3-F1-model_v4 deleted 0.9953 11 89
AF-A0A2W5KUB8-F1-model_v4 deleted 0.9927 29 118
AF-A0A1T2L6V6-F1-model_v4 lipoyl(octanoyl) transferase (EC 2.3.1.181) 0.9922 19 216 GO:0033819
AF-A0A1P8FGQ7-F1-model_v4 Octanoyltransferase (EC 2.3.1.181) (Lipoate-protein ligase B) (Lipoyl/octanoyl transferase) (Octanoyl-[acyl-carrier-protein]-protein N-octanoyltransferase) 0.992 13 228 GO:0005737
GO:0033819
AF-A0A7Y2HUV1-F1-model_v4 lipoyl(octanoyl) transferase (EC 2.3.1.181) 0.99 11 136 GO:0033819

Feature Viewer

pLDDT pTM Quality
91.54 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map