F473018

General Info

Members Datasets Scaffolds Average Seq Length
656 380 636 87

Family's Representative Sequence

Representative Sequence 3300009553|Ga0105249_11257901|Ga0105249_112579012
Length 101
Sequence LDVKKRFSEEQIIGFLKEAEAGVPVKELARKQGFSDASFYLWRSKFGGMDVPDAKRLKSLETENARLKKLLAESMLENEVTREALRKKFQPHRLDESWCGG

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 2687453129 Halotalea alkalilenta IHB B 13600 Isolate Unclassified
3 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere
4 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
5 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
6 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
7 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
8 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
9 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
10 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
11 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
12 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
13 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
14 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
15 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
16 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
17 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
18 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
19 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
20 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
21 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
22 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
25 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
26 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
27 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
28 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
29 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
30 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
31 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
32 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
33 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
34 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
35 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
36 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
37 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
38 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
39 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
40 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
41 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
42 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
43 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
44 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
45 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
46 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
47 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
48 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
49 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
50 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
51 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
52 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
53 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
54 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
55 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
56 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
57 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
58 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
59 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
60 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
61 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
62 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
63 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
64 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
65 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
66 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
67 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
68 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
69 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
70 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
71 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
72 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
73 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
74 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
75 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
76 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
77 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
78 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
79 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
80 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
81 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
82 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
83 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
84 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
85 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
86 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
87 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
88 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
89 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
90 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
91 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
92 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
93 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
94 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
95 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
96 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
97 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
98 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
99 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
100 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
101 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
102 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
103 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
104 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
105 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
106 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
107 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
108 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
109 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
110 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
111 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
112 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
113 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
114 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
115 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
116 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
117 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
118 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
119 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
120 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
121 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
122 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
123 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
124 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
125 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
126 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
127 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
128 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
129 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
130 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
131 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
132 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
133 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
134 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
135 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
136 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
137 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
138 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
139 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
140 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
141 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
142 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
143 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
144 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
145 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
148 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
217 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
218 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
219 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
220 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
221 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
225 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
228 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
229 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
230 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
231 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
232 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
233 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
234 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
235 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
236 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
237 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
238 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
239 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
240 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
241 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
242 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
243 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
244 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
245 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
246 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
247 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
248 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
249 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
250 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
251 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
252 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
253 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
254 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
255 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
256 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
257 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
258 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
259 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
260 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
261 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
262 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
263 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
264 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
265 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
266 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
267 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
268 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
269 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
270 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
271 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
272 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
273 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
274 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
275 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
276 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
277 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
278 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
279 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
280 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
281 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
282 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
283 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
284 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
285 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
286 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
287 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
288 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
289 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
290 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
291 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
292 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
293 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
294 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
295 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
296 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
297 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
298 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
299 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
300 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
301 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
302 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
303 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
304 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
305 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
306 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
307 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
308 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
309 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
310 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
311 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
312 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
313 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
314 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
315 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
316 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
317 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
318 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
319 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
320 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
321 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
322 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
323 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
324 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
325 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
326 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
327 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
328 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
329 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
330 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
331 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
332 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
333 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
334 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
335 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
336 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
337 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
338 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
339 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
340 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
341 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
342 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
343 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
344 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
345 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
346 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
347 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
348 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
349 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
350 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
351 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
352 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
353 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
354 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
355 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
356 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
357 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
358 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
359 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
360 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
361 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
362 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
363 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
364 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
365 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
366 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
367 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
368 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
369 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
370 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
371 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
372 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
373 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
374 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
375 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
376 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
377 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
378 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
379 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
380 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.65
Metatranscriptomes 0.3
Isolates 3.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.9
Nodule 0
Rhizoplane 4.42
Rhizosphere 87.2
Stem 0
Stem Tuber 0
Unclassified 5.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_11849766 2162886012 Bacteria 1306
2 JGI24746J21847_1012034 3300001977 Bacteria 1267
3 JGI24747J21853_1001936 3300001978 Bacteria 1621
4 JGI24740J21852_10046349 3300001979 Bacteria 1277
5 JGI24739J22299_10035733 3300001989 Bacteria 1681
6 JGI24743J22301_10012264 3300001991 Bacteria 1557
7 JGI24745J21846_1007289 3300002073 Bacteria 1236
8 JGI24748J21848_1008636 3300002074 Bacteria 1198
9 JGI24738J21930_10026210 3300002075 Bacteria 1197
10 JGI24749J21850_1037074 3300002076 Bacteria 709
11 JGI24744J21845_10019838 3300002077 Bacteria 1328
12 JGI24033J26618_1008189 3300002155 Bacteria 1200
13 JGI24034J26672_10013196 3300002239 Bacteria 1253
14 JGI24742J22300_10011464 3300002244 Bacteria 1472
15 JGI24751J29686_10024753 3300002459 Bacteria 1245
16 Ga0055533_1017227 3300003756 Bacteria 687
17 Ga0065714_10282349 3300005288 Unclassified 694
18 Ga0065712_10101423 3300005290 Bacteria 2035
19 Ga0065715_10413210 3300005293 Bacteria 867
20 Ga0065707_11077741 3300005295 Bacteria 520
21 Ga0070658_10011175 3300005327 Bacteria 7196
22 Ga0070676_10024966 3300005328 Bacteria 3373
23 Ga0070676_10053634 3300005328 Bacteria 2375
24 Ga0070683_100363089 3300005329 Bacteria 1379
25 Ga0070683_100471640 3300005329 Bacteria 1198
26 Ga0070690_100129153 3300005330 Bacteria 1705
27 Ga0070670_100000010 3300005331 Bacteria 277365
28 Ga0070670_100175745 3300005331 Bacteria 1858
29 Ga0070670_100369755 3300005331 Bacteria 1262
30 Ga0070677_10003290 3300005333 Bacteria 5203
31 Ga0068869_100108552 3300005334 Bacteria 2108
32 Ga0070666_10000434 3300005335 Bacteria 25623
33 Ga0070666_10011606 3300005335 Bacteria 5534
34 Ga0070666_11087189 3300005335 Bacteria 594
35 Ga0070680_100130992 3300005336 Bacteria 2098
36 Ga0070680_100515795 3300005336 Bacteria 1023
37 Ga0070680_100665778 3300005336 Bacteria 895
38 Ga0070680_101054829 3300005336 Bacteria 702
39 Ga0070682_100043208 3300005337 Bacteria 2786
40 Ga0070682_100184869 3300005337 Bacteria 1459
41 Ga0070682_100492970 3300005337 Bacteria 948
42 Ga0068868_100000731 3300005338 Bacteria 22214
43 Ga0070660_100201660 3300005339 Bacteria 1614
44 Ga0070689_100282769 3300005340 Bacteria 1376
45 Ga0070691_10688627 3300005341 Unclassified 612
46 Ga0070687_100138766 3300005343 Bacteria 1413
47 Ga0070692_10038212 3300005345 Bacteria 2445
48 Ga0070692_10145666 3300005345 Bacteria 1345
49 Ga0070668_100184870 3300005347 Bacteria 1704
50 Ga0070668_100313726 3300005347 Bacteria 1318
51 Ga0070669_100002038 3300005353 Bacteria 14615
52 Ga0070669_100002915 3300005353 Bacteria 12321
53 Ga0070669_100159865 3300005353 Bacteria 1750
54 Ga0070675_100000142 3300005354 Bacteria 42794
55 Ga0070675_100212151 3300005354 Bacteria 1683
56 Ga0070675_100552825 3300005354 Bacteria 1041
57 Ga0070671_100019810 3300005355 Bacteria 5480
58 Ga0070674_100062122 3300005356 Bacteria 2609
59 Ga0070673_100044911 3300005364 Bacteria 3423
60 Ga0070673_100151331 3300005364 Bacteria 1965
61 Ga0070673_100788185 3300005364 Bacteria 877
62 Ga0070688_100010706 3300005365 Bacteria 5067
63 Ga0070688_100012276 3300005365 Bacteria 4795
64 Ga0070688_100229611 3300005365 Bacteria 1312
65 Ga0070659_100118073 3300005366 Bacteria 2145
66 Ga0070667_100000097 3300005367 Bacteria 108709
67 Ga0070667_100050742 3300005367 Bacteria 3497
68 Ga0070667_100218224 3300005367 Bacteria 1697
69 Ga0070667_102233172 3300005367 Bacteria 515
70 Ga0070709_10160141 3300005434 Bacteria 1564
71 Ga0070709_10206878 3300005434 Bacteria 1393
72 Ga0070709_10779002 3300005434 Unclassified 749
73 Ga0070714_100365933 3300005435 Bacteria 1357
74 Ga0070713_100122073 3300005436 Bacteria 2286
75 Ga0070710_10804279 3300005437 Bacteria 672
76 Ga0070701_10076196 3300005438 Bacteria 1805
77 Ga0070701_10128378 3300005438 Bacteria 1438
78 Ga0070711_100219576 3300005439 Bacteria 1477
79 Ga0070711_101158306 3300005439 Bacteria 668
80 Ga0070711_101413076 3300005439 Bacteria 606
81 Ga0070705_100205971 3300005440 Bacteria 1352
82 Ga0070705_100828802 3300005440 Bacteria 738
83 Ga0070705_101417797 3300005440 Unclassified 579
84 Ga0070700_100184620 3300005441 Bacteria 1454
85 Ga0070700_100763939 3300005441 Unclassified 775
86 Ga0070700_100877569 3300005441 Unclassified 729
87 Ga0070700_101529816 3300005441 Bacteria 568
88 Ga0070708_101984769 3300005445 Bacteria 539
89 Ga0070663_100251970 3300005455 Bacteria 1398
90 Ga0070663_102123513 3300005455 Bacteria 506
91 Ga0070678_101700295 3300005456 Bacteria 594
92 Ga0070662_100024933 3300005457 Bacteria 4126
93 Ga0070662_100041269 3300005457 Bacteria 3291
94 Ga0070662_100118793 3300005457 Bacteria 2024
95 Ga0070681_10076514 3300005458 Bacteria 3305
96 Ga0070681_10168578 3300005458 Bacteria 2112
97 Ga0070681_10409272 3300005458 Bacteria 1268
98 Ga0068867_100034065 3300005459 Bacteria 3690
99 Ga0068867_100090977 3300005459 Bacteria 2316
100 Ga0070685_10047439 3300005466 Bacteria 2470
101 Ga0070685_10085500 3300005466 Bacteria 1899
102 Ga0070707_100026204 3300005468 Bacteria 5534
103 Ga0070707_100527412 3300005468 Bacteria 1143
104 Ga0070699_100134760 3300005518 Bacteria 2178
105 Ga0070679_100181000 3300005530 Bacteria 2080
106 Ga0070679_100313991 3300005530 Bacteria 1517
107 Ga0070679_100394557 3300005530 Bacteria 1330
108 Ga0070679_100908781 3300005530 Bacteria 824
109 Ga0070679_101070131 3300005530 Bacteria 751
110 Ga0070679_101784948 3300005530 Unclassified 563
111 Ga0070684_100024686 3300005535 Bacteria 5044
112 Ga0070684_100036551 3300005535 Bacteria 4209
113 Ga0070697_101402457 3300005536 Bacteria 624
114 Ga0068853_100116075 3300005539 Bacteria 2383
115 Ga0068853_100339661 3300005539 Bacteria 1395
116 Ga0068853_101703639 3300005539 Bacteria 611
117 Ga0070672_100041348 3300005543 Bacteria 3544
118 Ga0070672_100073389 3300005543 Bacteria 2727
119 Ga0070672_100305222 3300005543 Bacteria 1350
120 Ga0070672_100443799 3300005543 Bacteria 1117
121 Ga0070686_100135885 3300005544 Bacteria 1706
122 Ga0070695_100015005 3300005545 Bacteria 4674
123 Ga0070696_100176715 3300005546 Bacteria 1582
124 Ga0070693_100105002 3300005547 Bacteria 1728
125 Ga0070665_100005670 3300005548 Bacteria 12828
126 Ga0070665_100091241 3300005548 Bacteria 3052
127 Ga0070665_100136817 3300005548 Bacteria 2453
128 Ga0070665_101096807 3300005548 Unclassified 807
129 Ga0070704_100363268 3300005549 Bacteria 1225
130 Ga0068855_101858695 3300005563 Bacteria 611
131 Ga0068855_101869259 3300005563 Bacteria 609
132 Ga0070664_100514145 3300005564 Bacteria 1105
133 Ga0070664_100622503 3300005564 Bacteria 1002
134 Ga0070664_100812819 3300005564 Bacteria 874
135 Ga0068857_100007610 3300005577 Bacteria 9326
136 Ga0068857_101194007 3300005577 Bacteria 736
137 Ga0068854_100002758 3300005578 Bacteria 10913
138 Ga0068856_100353191 3300005614 Bacteria 1489
139 Ga0070702_100142920 3300005615 Bacteria 1526
140 Ga0068852_100000390 3300005616 Bacteria 29418
141 Ga0068852_100144743 3300005616 Bacteria 2203
142 Ga0068852_101965584 3300005616 Bacteria 607
143 Ga0068859_100009767 3300005617 Bacteria 9693
144 Ga0068859_101118292 3300005617 Bacteria 867
145 Ga0068864_100000018 3300005618 Bacteria 277365
146 Ga0068864_100048810 3300005618 Bacteria 3640
147 Ga0068864_100397299 3300005618 Bacteria 1309
148 Ga0068866_10051387 3300005718 Bacteria 2098
149 Ga0068866_10084613 3300005718 Bacteria 1712
150 Ga0068861_100022724 3300005719 Bacteria 4522
151 Ga0068861_100286840 3300005719 Bacteria 1420
152 Ga0068851_10001331 3300005834 Bacteria 10772
153 Ga0068870_10060086 3300005840 Bacteria 2039
154 Ga0068870_10359582 3300005840 Bacteria 936
155 Ga0068870_11378852 3300005840 Bacteria 516
156 Ga0068863_100002082 3300005841 Bacteria 19834
157 Ga0068863_100097946 3300005841 Bacteria 2785
158 Ga0068858_100151649 3300005842 Bacteria 2180
159 Ga0068858_100385123 3300005842 Bacteria 1346
160 Ga0068860_100003543 3300005843 Bacteria 16050
161 Ga0068860_100178134 3300005843 Bacteria 2055
162 Ga0068860_100330205 3300005843 Bacteria 1498
163 Ga0068860_102492938 3300005843 Bacteria 537
164 Ga0068862_100004380 3300005844 Bacteria 11937
165 Ga0068862_100231919 3300005844 Bacteria 1675
166 Ga0068862_100872813 3300005844 Bacteria 883
167 Ga0070717_10253701 3300006028 Bacteria 1554
168 Ga0070717_10341510 3300006028 Bacteria 1337
169 Ga0075368_10332263 3300006042 Bacteria 659
170 Ga0075363_100231647 3300006048 Bacteria 1060
171 Ga0075364_10367375 3300006051 Bacteria 981
172 Ga0070715_10061693 3300006163 Bacteria 1647
173 Ga0070716_100066647 3300006173 Bacteria 2101
174 Ga0070716_100205481 3300006173 Bacteria 1312
175 Ga0070716_101706110 3300006173 Bacteria 520
176 Ga0070712_100274656 3300006175 Bacteria 1355
177 Ga0075362_10103645 3300006177 Bacteria 1333
178 Ga0075366_10683065 3300006195 Bacteria 637
179 Ga0097621_100038659 3300006237 Bacteria 3829
180 Ga0097621_100347654 3300006237 Bacteria 1318
181 Ga0075370_10077901 3300006353 Bacteria 1902
182 Ga0068871_100216856 3300006358 Bacteria 1657
183 Ga0068871_100622070 3300006358 Bacteria 983
184 Ga0068871_100652196 3300006358 Bacteria 961
185 Ga0075428_100349982 3300006844 Bacteria 1586
186 Ga0075430_100863159 3300006846 Bacteria 746
187 Ga0075431_100324902 3300006847 Bacteria 1551
188 Ga0075431_100329994 3300006847 Bacteria 1537
189 Ga0075431_100342644 3300006847 Bacteria 1504
190 Ga0075431_100727463 3300006847 Unclassified 969
191 Ga0075434_100808817 3300006871 Unclassified 953
192 Ga0075429_100512718 3300006880 Bacteria 1051
193 Ga0075429_100891170 3300006880 Bacteria 779
194 Ga0068865_100081315 3300006881 Bacteria 2326
195 Ga0068865_100090907 3300006881 Bacteria 2214
196 Ga0068865_100098387 3300006881 Bacteria 2137
197 Ga0068865_100330919 3300006881 Bacteria 1228
198 Ga0068865_101732024 3300006881 Bacteria 564
199 Ga0075436_100786413 3300006914 Unclassified 708
200 Ga0097620_100009767 3300006931 Bacteria 9693
201 Ga0097620_101118344 3300006931 Bacteria 867
202 Ga0105251_10092339 3300009011 Bacteria 1390
203 Ga0105250_10030949 3300009092 Bacteria 2150
204 Ga0105240_10503692 3300009093 Bacteria 1346
205 Ga0105240_10577848 3300009093 Bacteria 1240
206 Ga0105240_11136983 3300009093 Unclassified 829
207 Ga0105240_12045208 3300009093 Bacteria 595
208 Ga0105240_12172052 3300009093 Bacteria 576
209 Ga0105240_12274941 3300009093 Bacteria 562
210 Ga0105240_12647593 3300009093 Bacteria 518
211 Ga0111539_10008259 3300009094 Bacteria 13248
212 Ga0111539_10279094 3300009094 Bacteria 1944
213 Ga0111539_10605512 3300009094 Bacteria 1276
214 Ga0105245_10161996 3300009098 Bacteria 2123
215 Ga0105247_10102313 3300009101 Bacteria 1833
216 Ga0114129_10579642 3300009147 Bacteria 1456
217 Ga0114129_12221022 3300009147 Bacteria 660
218 Ga0105243_10325167 3300009148 Bacteria 1403
219 Ga0105241_10145570 3300009174 Bacteria 1933
220 Ga0105242_10144840 3300009176 Bacteria 2066
221 Ga0105242_11413531 3300009176 Bacteria 724
222 Ga0105242_12698931 3300009176 Bacteria 546
223 Ga0105248_10239439 3300009177 Bacteria 2043
224 Ga0105248_10895465 3300009177 Bacteria 1002
225 Ga0105248_11306607 3300009177 Bacteria 820
226 Ga0105237_10343161 3300009545 Bacteria 1498
227 Ga0105237_10750018 3300009545 Bacteria 983
228 Ga0105238_10116238 3300009551 Bacteria 2654
229 Ga0105238_12232222 3300009551 Bacteria 582
230 Ga0105238_12305025 3300009551 Unclassified 574
231 Ga0105249_10038858 3300009553 Bacteria 4319
232 Ga0105249_10063817 3300009553 Bacteria 3385
233 Ga0105249_10142525 3300009553 Bacteria 2299
234 Ga0105249_10385844 3300009553 Bacteria 1428
235 Ga0105249_10395845 3300009553 Bacteria 1410
236 Ga0105249_10937330 3300009553 Unclassified 933
237 Ga0105249_11257901 3300009553 Bacteria 811
238 Ga0105249_13086240 3300009553 Unclassified 535
239 Ga0105239_10336874 3300010375 Bacteria 1702
240 Ga0105239_11861970 3300010375 Bacteria 698
241 Ga0105246_10133936 3300011119 Bacteria 1855
242 Ga0105246_10533862 3300011119 Bacteria 1002
243 Ga0157373_10192442 3300013100 Bacteria 1437
244 Ga0157371_10074708 3300013102 Bacteria 2400
245 Ga0157371_11303649 3300013102 Bacteria 562
246 Ga0157370_10285225 3300013104 Bacteria 1525
247 Ga0157369_10221635 3300013105 Bacteria 1980
248 Ga0157369_10869832 3300013105 Bacteria 925
249 Ga0157374_10565252 3300013296 Bacteria 1146
250 Ga0157374_11660815 3300013296 Bacteria 663
251 Ga0157378_10717409 3300013297 Bacteria 1020
252 Ga0163162_10270546 3300013306 Bacteria 1831
253 Ga0163162_10581771 3300013306 Bacteria 1246
254 Ga0157372_10204993 3300013307 Bacteria 2285
255 Ga0157372_10551976 3300013307 Bacteria 1343
256 Ga0157375_10006008 3300013308 Bacteria 10585
257 Ga0157375_10312321 3300013308 Bacteria 1736
258 Ga0157375_10477632 3300013308 Unclassified 1412
259 Ga0163163_10000406 3300014325 Bacteria 40553
260 Ga0163163_10338488 3300014325 Bacteria 1560
261 Ga0157380_10019022 3300014326 Bacteria 5112
262 Ga0157380_10036617 3300014326 Bacteria 3798
263 Ga0157380_12553008 3300014326 Bacteria 577
264 Ga0157377_10043578 3300014745 Bacteria 2497
265 Ga0157377_10112358 3300014745 Bacteria 1639
266 Ga0157379_10329618 3300014968 Bacteria 1395
267 Ga0157379_11104537 3300014968 Bacteria 760
268 Ga0157376_10522663 3300014969 Bacteria 1170
269 Ga0157376_11785518 3300014969 Bacteria 651
270 Ga0163161_10039200 3300017792 Bacteria 3400
271 Ga0163161_10687162 3300017792 Bacteria 851
272 Ga0213872_10031527 3300021361 Bacteria 2430
273 Ga0213872_10105601 3300021361 Bacteria 1253
274 Ga0209674_104538 3300025226 Bacteria 2236
275 Ga0207666_1010630 3300025271 Bacteria 1262
276 Ga0207673_1023442 3300025290 Bacteria 841
277 Ga0207697_10033671 3300025315 Bacteria 2096
278 Ga0207656_10000974 3300025321 Bacteria 9361
279 Ga0207696_1054661 3300025711 Bacteria 1134
280 Ga0207682_10034601 3300025893 Bacteria 2037
281 Ga0207642_10077169 3300025899 Bacteria 1606
282 Ga0207710_10127708 3300025900 Bacteria 1219
283 Ga0207688_10054351 3300025901 Bacteria 2246
284 Ga0207680_10000744 3300025903 Bacteria 15347
285 Ga0207680_10414496 3300025903 Bacteria 953
286 Ga0207647_10529384 3300025904 Unclassified 655
287 Ga0207699_10232057 3300025906 Bacteria 1264
288 Ga0207699_11046716 3300025906 Unclassified 604
289 Ga0207699_11272298 3300025906 Bacteria 544
290 Ga0207645_10012221 3300025907 Bacteria 5832
291 Ga0207645_10041219 3300025907 Bacteria 2956
292 Ga0207645_10084104 3300025907 Bacteria 2042
293 Ga0207643_10001596 3300025908 Bacteria 12810
294 Ga0207643_10040194 3300025908 Bacteria 2633
295 Ga0207643_10165129 3300025908 Bacteria 1333
296 Ga0207705_10179674 3300025909 Bacteria 1596
297 Ga0207654_10862344 3300025911 Bacteria 656
298 Ga0207707_10143691 3300025912 Bacteria 2086
299 Ga0207707_10332503 3300025912 Bacteria 1311
300 Ga0207707_10447903 3300025912 Bacteria 1105
301 Ga0207707_10648020 3300025912 Bacteria 890
302 Ga0207695_10322031 3300025913 Bacteria 1435
303 Ga0207695_10569569 3300025913 Bacteria 1014
304 Ga0207671_10650082 3300025914 Bacteria 840
305 Ga0207693_10119618 3300025915 Bacteria 2069
306 Ga0207663_10142731 3300025916 Bacteria 1670
307 Ga0207663_11185323 3300025916 Bacteria 615
308 Ga0207660_10125550 3300025917 Bacteria 1948
309 Ga0207660_10428307 3300025917 Bacteria 1068
310 Ga0207660_11002839 3300025917 Bacteria 681
311 Ga0207662_10172834 3300025918 Bacteria 1386
312 Ga0207662_10210351 3300025918 Bacteria 1262
313 Ga0207657_10377300 3300025919 Bacteria 1117
314 Ga0207657_11331657 3300025919 Bacteria 541
315 Ga0207649_10400231 3300025920 Bacteria 1027
316 Ga0207649_11272493 3300025920 Unclassified 582
317 Ga0207649_11307832 3300025920 Bacteria 573
318 Ga0207652_10344965 3300025921 Bacteria 1344
319 Ga0207652_11047410 3300025921 Bacteria 715
320 Ga0207652_11197130 3300025921 Unclassified 661
321 Ga0207646_10006034 3300025922 Bacteria 12625
322 Ga0207646_10579686 3300025922 Bacteria 1008
323 Ga0207681_10015134 3300025923 Bacteria 4810
324 Ga0207681_10767050 3300025923 Bacteria 804
325 Ga0207694_10192021 3300025924 Bacteria 1659
326 Ga0207694_10588549 3300025924 Bacteria 935
327 Ga0207694_11079161 3300025924 Unclassified 679
328 Ga0207650_10000003 3300025925 Bacteria 1123235
329 Ga0207650_10056652 3300025925 Bacteria 2913
330 Ga0207650_10571782 3300025925 Bacteria 949
331 Ga0207650_11452596 3300025925 Bacteria 583
332 Ga0207659_10003121 3300025926 Bacteria 9902
333 Ga0207659_10004672 3300025926 Bacteria 8295
334 Ga0207687_10134191 3300025927 Bacteria 1870
335 Ga0207700_10219163 3300025928 Bacteria 1612
336 Ga0207664_10624271 3300025929 Bacteria 968
337 Ga0207644_10000418 3300025931 Bacteria 27576
338 Ga0207690_10060175 3300025932 Bacteria 2576
339 Ga0207706_10029593 3300025933 Bacteria 4888
340 Ga0207706_10054855 3300025933 Bacteria 3516
341 Ga0207706_10191182 3300025933 Bacteria 1797
342 Ga0207686_10285395 3300025934 Bacteria 1220
343 Ga0207709_10103479 3300025935 Bacteria 1887
344 Ga0207670_11421197 3300025936 Unclassified 589
345 Ga0207669_10024719 3300025937 Bacteria 3233
346 Ga0207704_10177715 3300025938 Bacteria 1534
347 Ga0207704_10204778 3300025938 Bacteria 1447
348 Ga0207704_10856027 3300025938 Bacteria 762
349 Ga0207665_10119914 3300025939 Bacteria 1857
350 Ga0207665_10346763 3300025939 Bacteria 1120
351 Ga0207665_10751261 3300025939 Bacteria 769
352 Ga0207691_10065733 3300025940 Bacteria 3281
353 Ga0207691_10105734 3300025940 Bacteria 2507
354 Ga0207691_10156887 3300025940 Bacteria 1998
355 Ga0207691_10439969 3300025940 Bacteria 1110
356 Ga0207691_10467883 3300025940 Unclassified 1072
357 Ga0207711_10306598 3300025941 Bacteria 1465
358 Ga0207711_10370582 3300025941 Unclassified 1328
359 Ga0207711_10970237 3300025941 Bacteria 789
360 Ga0207689_10056670 3300025942 Bacteria 3225
361 Ga0207689_10542085 3300025942 Bacteria 977
362 Ga0207661_10024178 3300025944 Bacteria 4600
363 Ga0207661_10815919 3300025944 Bacteria 859
364 Ga0207679_10322145 3300025945 Bacteria 1339
365 Ga0207679_10376087 3300025945 Bacteria 1244
366 Ga0207667_10555515 3300025949 Bacteria 1161
367 Ga0207651_10001418 3300025960 Bacteria 10896
368 Ga0207651_10566421 3300025960 Bacteria 989
369 Ga0207651_10783398 3300025960 Bacteria 844
370 Ga0207712_10113615 3300025961 Bacteria 2035
371 Ga0207712_10370020 3300025961 Bacteria 1196
372 Ga0207712_10834588 3300025961 Bacteria 812
373 Ga0207712_10894689 3300025961 Bacteria 784
374 Ga0207668_10065856 3300025972 Bacteria 2566
375 Ga0207668_10375320 3300025972 Bacteria 1195
376 Ga0207640_10002548 3300025981 Bacteria 9773
377 Ga0207658_10000007 3300025986 Bacteria 329651
378 Ga0207658_10396196 3300025986 Bacteria 1212
379 Ga0207677_10253214 3300026023 Bacteria 1431
380 Ga0207703_10095406 3300026035 Bacteria 2509
381 Ga0207703_11032360 3300026035 Bacteria 789
382 Ga0207639_10109338 3300026041 Bacteria 2249
383 Ga0207639_11817955 3300026041 Bacteria 570
384 Ga0207678_10103686 3300026067 Bacteria 2428
385 Ga0207708_10348805 3300026075 Unclassified 1214
386 Ga0207702_10423557 3300026078 Bacteria 1288
387 Ga0207702_10984777 3300026078 Bacteria 836
388 Ga0207702_11689315 3300026078 Unclassified 626
389 Ga0207641_10001670 3300026088 Bacteria 21581
390 Ga0207641_10077683 3300026088 Bacteria 2873
391 Ga0207648_10017451 3300026089 Bacteria 6530
392 Ga0207648_10036740 3300026089 Bacteria 4316
393 Ga0207676_10000003 3300026095 Bacteria 1123235
394 Ga0207676_10302644 3300026095 Bacteria 1460
395 Ga0207674_10728386 3300026116 Bacteria 957
396 Ga0207674_11169880 3300026116 Unclassified 739
397 Ga0207675_100012950 3300026118 Bacteria 7789
398 Ga0207675_100345890 3300026118 Bacteria 1456
399 Ga0207683_10002093 3300026121 Bacteria 17577
400 Ga0207683_10062230 3300026121 Bacteria 3287
401 Ga0207683_10953062 3300026121 Bacteria 797
402 Ga0207683_11615368 3300026121 Bacteria 597
403 Ga0207698_10128210 3300026142 Bacteria 2162
404 Ga0207698_10273890 3300026142 Bacteria 1557
405 Ga0209973_1016096 3300027252 Bacteria 950
406 Ga0209982_1001027 3300027552 Bacteria 3711
407 Ga0210002_1002097 3300027617 Bacteria 2878
408 Ga0209966_1055626 3300027695 Bacteria 848
409 Ga0209966_1142412 3300027695 Bacteria 556
410 Ga0209998_10004632 3300027717 Bacteria 2914
411 Ga0209998_10067297 3300027717 Bacteria 852
412 Ga0209813_10319353 3300027866 Bacteria 608
413 Ga0209974_10027166 3300027876 Bacteria 1893
414 Ga0207428_10002309 3300027907 Bacteria 19095
415 Ga0268266_10001450 3300028379 Bacteria 28199
416 Ga0268266_10457039 3300028379 Bacteria 1214
417 Ga0268266_10852897 3300028379 Bacteria 880
418 Ga0268266_11663248 3300028379 Bacteria 614
419 Ga0268265_10020118 3300028380 Bacteria 4654
420 Ga0268265_10293369 3300028380 Bacteria 1461
421 Ga0268265_10784502 3300028380 Bacteria 927
422 Ga0268265_10871457 3300028380 Bacteria 882
423 Ga0268264_10010705 3300028381 Bacteria 7576
424 Ga0268264_10463759 3300028381 Bacteria 1229
425 Ga0268264_11167430 3300028381 Bacteria 779
426 Ga0268264_12245970 3300028381 Bacteria 553
427 Ga0268264_12364174 3300028381 Bacteria 538
428 Ga0265334_10005070 3300028573 Bacteria 5776
429 Ga0265770_1011649 3300030878 Bacteria 1292
430 Ga0265760_10035618 3300031090 Bacteria 1474
431 Ga0265320_10188426 3300031240 Bacteria 923
432 Ga0265331_10318015 3300031250 Bacteria 697
433 Ga0265316_10726650 3300031344 Bacteria 699
434 Ga0307509_10003642 3300031507 Bacteria 23084
435 Ga0307509_10140810 3300031507 Bacteria 2348
436 Ga0307408_100265336 3300031548 Unclassified 1423
437 Ga0307408_101645007 3300031548 Bacteria 611
438 Ga0307508_10385855 3300031616 Bacteria 992
439 Ga0307508_10556787 3300031616 Bacteria 745
440 Ga0316579_10119057 3300031691 Bacteria 1268
441 Ga0316579_10244750 3300031691 Bacteria 867
442 Ga0316576_10231338 3300031727 Bacteria 1390
443 Ga0316576_10242936 3300031727 Bacteria 1352
444 Ga0316578_10129092 3300031728 Bacteria 1520
445 Ga0316578_10597301 3300031728 Bacteria 647
446 Ga0316578_10930557 3300031728 Bacteria 501
447 Ga0307405_10499898 3300031731 Unclassified 974
448 Ga0316577_10016985 3300031733 Bacteria 4016
449 Ga0307413_10776593 3300031824 Bacteria 803
450 Ga0307407_10176144 3300031903 Bacteria 1413
451 Ga0307412_11379192 3300031911 Bacteria 637
452 Ga0307416_100941439 3300032002 Unclassified 965
453 Ga0307416_101151637 3300032002 Bacteria 881
454 Ga0307416_102706938 3300032002 Bacteria 593
455 Ga0307414_12105431 3300032004 Bacteria 527
456 Ga0307411_10152781 3300032005 Bacteria 1718
457 Ga0307411_10540202 3300032005 Bacteria 993
458 Ga0307415_100188462 3300032126 Unclassified 1625
459 Ga0307415_100798326 3300032126 Bacteria 861
460 Ga0307415_101549627 3300032126 Bacteria 635
461 Ga0316585_10011187 3300032137 Bacteria 2642
462 Ga0316580_10043601 3300032139 Bacteria 1384
463 Ga0373944_0057126 3300035089 Bacteria 1243
464 Ga0373951_0130023 3300035091 Bacteria 692
465 Ga0373936_0125949 3300035113 Bacteria 1098
466 Ga0373941_0190214 3300035115 Bacteria 775
467 Ga0373945_0049408 3300035116 Bacteria 1543
468 Ga0373943_0132876 3300035170 Bacteria 1333
469 Ga0373955_0811996 3300035172 Bacteria 575
470 Ga0373961_0231631 3300035241 Bacteria 662
471 Ga0316574_0105059 3300035398 Bacteria 1809
472 Ga0316574_0137169 3300035398 Bacteria 1575
473 Ga0316574_0223937 3300035398 Bacteria 1205
474 Ga0373931_0124858 3300035691 Bacteria 1475
475 Ga0373935_0250511 3300035692 Bacteria 1239
476 Ga0373927_0121099 3300035695 Bacteria 1707
477 Ga0373947_0139014 3300035725 Bacteria 1556
478 Ga0316582_0224958 3300036647 Bacteria 1283
479 Ga0316582_0922937 3300036647 Bacteria 597
480 Ga0316582_1067784 3300036647 Bacteria 551
481 Ga0316584_0205954 3300036712 Bacteria 1450
482 Ga0316584_0258095 3300036712 Bacteria 1271
483 Ga0316584_0375225 3300036712 Bacteria 1017
484 Ga0373925_0644977 3300037068 Bacteria 872
485 Ga0395899_0220296 3300037312 Bacteria 1315
486 Ga0395900_1774263 3300037418 Bacteria 528
487 Ga0395898_0198512 3300037466 Bacteria 1916
488 Ga0316581_0094564 3300037588 Bacteria 920
489 Ga0436360_0817650 3300039438 Bacteria 688
490 Ga0436361_0147800 3300039447 Bacteria 1205
491 Ga0436361_0519472 3300039447 Bacteria 4103
492 Ga0436361_0765718 3300039447 Bacteria 1013
493 Ga0436361_1008104 3300039447 Bacteria 1467
494 Ga0439447_036003 3300041407 Bacteria 1224
495 Ga0439465_0057306 3300041413 Bacteria 1285
496 Ga0451789_0630838 3300041443 Bacteria 1640
497 Ga0451793_0316792 3300041452 Bacteria 1210
498 Ga0451795_1495749 3300041456 Unclassified 808
499 Ga0451798_0317467 3300041458 Bacteria 1261
500 Ga0451800_1612496 3300041459 Bacteria 1672
501 Ga0451802_0332722 3300041460 Bacteria 1108
502 Ga0451804_0634357 3300041463 Unclassified 583
503 Ga0451807_0915961 3300041486 Bacteria 3266
504 Ga0451833_1092509 3300041491 Bacteria 1680
505 Ga0451833_1477764 3300041491 Bacteria 531
506 Ga0451835_0175095 3300041492 Unclassified 737
507 Ga0451835_0580138 3300041492 Bacteria 1949
508 Ga0451839_1509357 3300041496 Bacteria 534
509 Ga0451839_1586213 3300041496 Bacteria 1214
510 Ga0451841_0268182 3300041498 Bacteria 1765
511 Ga0451841_0396150 3300041498 Bacteria 1175
512 Ga0451845_0350209 3300041501 Bacteria 805
513 Ga0451845_0609513 3300041501 Bacteria 1094
514 Ga0451849_1066439 3300041505 Bacteria 1385
515 Ga0451843_0475333 3300041509 Bacteria 1059
516 Ga0451843_1603629 3300041509 Bacteria 610
517 Ga0451843_1653883 3300041509 Bacteria 1430
518 Ga0451855_1179725 3300041511 Bacteria 847
519 Ga0451853_1111132 3300041512 Bacteria 1687
520 Ga0451853_1258382 3300041512 Bacteria 1181
521 Ga0451853_1282000 3300041512 Bacteria 2830
522 Ga0439431_0071722 3300041997 Bacteria 924
523 Ga0439433_0189252 3300041999 Bacteria 541
524 Ga0439442_069599 3300042002 Bacteria 749
525 Ga0439445_0019339 3300042004 Bacteria 1697
526 Ga0439450_028295 3300042008 Bacteria 1246
527 Ga0439462_0128788 3300042015 Bacteria 706
528 Ga0450914_038093 3300042118 Bacteria 602
529 Ga0450920_039975 3300042122 Bacteria 934
530 Ga0450921_000892 3300042123 Bacteria 1628
531 Ga0450922_004681 3300042124 Bacteria 1261
532 Ga0450923_018352 3300042125 Bacteria 1337
533 Ga0450888_061148 3300042126 Bacteria 553
534 Ga0450895_003188 3300042132 Bacteria 1256
535 Ga0450896_005254 3300042133 Bacteria 1767
536 Ga0450899_012271 3300042135 Bacteria 961
537 Ga0450906_079179 3300042145 Bacteria 592
538 Ga0450907_034213 3300042146 Bacteria 866
539 Ga0450910_016818 3300042147 Bacteria 1085
540 Ga0439434_0114377 3300042435 Bacteria 876
541 Ga0439434_0173014 3300042435 Bacteria 721
542 Ga0439434_0366258 3300042435 Bacteria 505
543 Ga0439435_0006907 3300042436 Bacteria 2573
544 Ga0439464_0161221 3300042439 Bacteria 705
545 Ga0439460_0042769 3300042461 Bacteria 1336
546 Ga0450918_034442 3300042531 Bacteria 899
547 Ga0450893_0065962 3300042532 Bacteria 697
548 Ga0451577_0269634 3300042876 Bacteria 1541
549 Ga0451577_0537059 3300042876 Bacteria 1062
550 Ga0466972_0623410 3300044658 Bacteria 510
551 Ga0466977_0018143 3300044666 Bacteria 4281
552 Ga0453683_1061433 3300044673 Bacteria 539
553 Ga0453684_0019721 3300044712 Bacteria 10238
554 Ga0453684_0624448 3300044712 Bacteria 1178
555 Ga0453684_1251833 3300044712 Bacteria 776
556 Ga0451576_0341292 3300045051 Bacteria 1568
557 Ga0451576_0715996 3300045051 Bacteria 1051
558 Ga0451576_1740716 3300045051 Bacteria 645
559 Ga0495629_0193831 3300046459 Bacteria 1406
560 Ga0495616_0100144 3300046513 Bacteria 1360
561 Ga0495620_0054158 3300046515 Bacteria 1696
562 Ga0495642_0179618 3300046528 Bacteria 921
563 Ga0495621_0117575 3300046539 Bacteria 1025
564 Ga0495633_0297774 3300046558 Bacteria 733
565 Ga0495647_0074700 3300046681 Bacteria 1363
566 Ga0495647_0479337 3300046681 Bacteria 578
567 Ga0495658_0677730 3300046683 Bacteria 660
568 Ga0495669_0131114 3300046684 Bacteria 1180
569 Ga0495671_0379464 3300046692 Bacteria 677
570 Ga0495581_0202894 3300047315 Bacteria 1160
571 Ga0495636_0149061 3300047318 Bacteria 1048
572 Ga0496100_0119135 3300048903 Bacteria 1844
573 Ga0496101_0128753 3300048904 Bacteria 1920
574 Ga0496102_0202043 3300048905 Bacteria 1873
575 Ga0496103_0173132 3300048906 Bacteria 1386
576 Ga0496104_0219728 3300048907 Bacteria 1812
577 Ga0496104_0359853 3300048907 Bacteria 1367
578 Ga0496105_0090171 3300048908 Bacteria 2532
579 Ga0496105_0278089 3300048908 Bacteria 1350
580 Ga0496106_0119184 3300048909 Bacteria 2061
581 Ga0496106_0713414 3300048909 Bacteria 799
582 Ga0496107_0194423 3300048910 Bacteria 1507
583 Ga0496108_0058854 3300048911 Bacteria 3230
584 Ga0496109_0285161 3300048912 Bacteria 1556
585 Ga0496110_0341672 3300048913 Bacteria 1363
586 Ga0496111_0196479 3300048914 Bacteria 1499
587 Ga0496112_0365141 3300048915 Bacteria 1385
588 Ga0496113_0340650 3300048916 Bacteria 1202
589 Ga0496114_0422694 3300048917 Bacteria 1180
590 Ga0496114_0844743 3300048917 Bacteria 795
591 Ga0496115_0232625 3300048918 Bacteria 1519
592 Ga0496115_0711787 3300048918 Bacteria 788
593 Ga0496120_0097084 3300048923 Bacteria 1564
594 Ga0496121_0259441 3300048924 Bacteria 1201
595 Ga0496124_0378901 3300048927 Bacteria 990
596 Ga0496125_0012461 3300048928 Bacteria 8439
597 Ga0496125_0666626 3300048928 Unclassified 557
598 Ga0495678_236402 3300049459 Bacteria 548
599 Ga0501295_014961 3300049518 Bacteria 1319
600 Ga0501033_0253218 3300049570 Bacteria 1247
601 Ga0501034_0325554 3300049571 Bacteria 1469
602 Ga0501037_0099910 3300049573 Bacteria 2095
603 Ga0501037_0351721 3300049573 Bacteria 1016
604 Ga0501038_0980916 3300049574 Bacteria 621
605 Ga0501043_0232923 3300049579 Bacteria 1422
606 Ga0501043_1052214 3300049579 Bacteria 577
607 Ga0501067_0375740 3300049583 Bacteria 792
608 Ga0501070_1506285 3300049586 Unclassified 509
609 Ga0501080_1015477 3300049742 Bacteria 719
610 Ga0501241_079638 3300049758 Bacteria 680
611 Ga0501035_0083596 3300049822 Bacteria 2816
612 Ga0501035_0348484 3300049822 Bacteria 1239
613 Ga0501044_0025921 3300049823 Bacteria 6213
614 nmdc:mga03683_132531_c1 3300050489 Bacteria 1116
615 nmdc:mga00v17_473230_c1 3300050491 Bacteria 813
616 nmdc:mga0k408_622973_c1 3300050493 Bacteria 636
617 nmdc:mga04h51_281546_c1 3300050495 Bacteria 674
618 nmdc:mga07m45_109960_c1 3300050496 Bacteria 1587
619 nmdc:mga05p37_452451_c1 3300050507 Bacteria 1486
620 nmdc:mga09592_367723_c1 3300050508 Bacteria 1244
621 nmdc:mga09592_480111_c1 3300050508 Bacteria 1071
622 nmdc:mga0qj67_887419_c1 3300050509 Bacteria 703
623 nmdc:mga06r32_231085_c1 3300050510 Bacteria 1837
624 nmdc:mga06r32_404245_c1 3300050510 Bacteria 1348
625 nmdc:mga06r32_710321_c1 3300050510 Unclassified 970
626 nmdc:mga08y16_1977340_c1 3300050511 Bacteria 533
627 nmdc:mga08y16_473316_c1 3300050511 Bacteria 1275
628 nmdc:mga08y16_57762_c1 3300050511 Bacteria 4054
629 nmdc:mga0n895_1227744_c1 3300050512 Unclassified 723
630 nmdc:mga08x19_47707_c1 3300050514 Bacteria 2742
631 Ga0495612_0152216 3300053078 Bacteria 1007
632 Ga0500595_055337 3300053119 Bacteria 1215
633 Ga0500652_063406 3300053131 Bacteria 1525
634 Ga0500568_0121623 3300053139 Bacteria 972
635 Ga0500573_0467875 3300053140 Bacteria 578
636 Ga0500622_0022194 3300053156 Bacteria 3366

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005335 Ga0070666_11087189 Ga0070666_110871892 74
2 3300009101 Ga0105247_10102313 Ga0105247_101023133 80
3 3300009553 Ga0105249_10063817 Ga0105249_100638173 80
4 3300014968 Ga0157379_10329618 Ga0157379_103296182 80
5 3300025961 Ga0207712_10113615 Ga0207712_101136152 81
6 iso_pu_bacteria 2687453129 2687578794 83
7 iso_pu_bacteria 2687453129 2687579175 83
8 iso_pu_bacteria 2687453129 2687579365 83
9 iso_pu_bacteria 2687453129 2687579756 83
10 iso_pu_bacteria 2687453129 2687579761 83
11 iso_pu_bacteria 2687453129 2687579765 83
12 iso_pu_bacteria 2687453129 2687579856 83
13 iso_pu_bacteria 2687453129 2687581190 83
14 iso_pu_bacteria 2998344455 2998344985 83
15 iso_pu_bacteria 2998344455 2998345291 83
16 iso_pu_bacteria 2998344455 2998345401 83
17 iso_pu_bacteria 2998344455 2998345532 83
18 iso_pu_bacteria 2998344455 2998346005 83
19 iso_pu_bacteria 2998344455 2998346149 83
20 iso_pu_bacteria 2998344455 2998346437 83
21 iso_pu_bacteria 2998344455 2998347034 83
22 iso_pu_bacteria 2998344455 2998347344 83
23 iso_pu_bacteria 2998344455 2998347883 83
24 iso_pu_bacteria 2998344455 2998348318 83
25 iso_pu_bacteria 2998344455 2998348501 83
26 3300030878 Ga0265770_1011649 Ga0265770_10116492 86
27 3300031090 Ga0265760_10035618 Ga0265760_100356182 86
28 3300048924 Ga0496121_0259441 Ga0496121_0259441_766_1026 86
29 3300049571 Ga0501034_0325554 Ga0501034_0325554_520_786 86
30 3300049573 Ga0501037_0351721 Ga0501037_0351721_503_769 86
31 3300049579 Ga0501043_1052214 Ga0501043_1052214_208_474 86
32 3300049742 Ga0501080_1015477 Ga0501080_1015477_311_577 86
33 3300049822 Ga0501035_0348484 Ga0501035_0348484_74_340 86
34 2162886012 MBSR1b_contig_11849766 MBSR1b_0599.00002220 87
35 3300001977 JGI24746J21847_1012034 JGI24746J21847_10120341 87
36 3300001978 JGI24747J21853_1001936 JGI24747J21853_10019362 87
37 3300001979 JGI24740J21852_10046349 JGI24740J21852_100463492 87
38 3300001989 JGI24739J22299_10035733 JGI24739J22299_100357332 87
39 3300001991 JGI24743J22301_10012264 JGI24743J22301_100122642 87
40 3300002073 JGI24745J21846_1007289 JGI24745J21846_10072892 87
41 3300002074 JGI24748J21848_1008636 JGI24748J21848_10086361 87
42 3300002075 JGI24738J21930_10026210 JGI24738J21930_100262102 87
43 3300002076 JGI24749J21850_1037074 JGI24749J21850_10370742 87
44 3300002077 JGI24744J21845_10019838 JGI24744J21845_100198382 87
45 3300002155 JGI24033J26618_1008189 JGI24033J26618_10081891 87
46 3300002239 JGI24034J26672_10013196 JGI24034J26672_100131961 87
47 3300002244 JGI24742J22300_10011464 JGI24742J22300_100114642 87
48 3300002459 JGI24751J29686_10024753 JGI24751J29686_100247532 87
49 3300003756 Ga0055533_1017227 Ga0055533_10172271 87
50 3300005288 Ga0065714_10282349 Ga0065714_102823491 87
51 3300005290 Ga0065712_10101423 Ga0065712_101014233 87
52 3300005293 Ga0065715_10413210 Ga0065715_104132102 87
53 3300005295 Ga0065707_11077741 Ga0065707_110777411 87
54 3300005327 Ga0070658_10011175 Ga0070658_100111758 87
55 3300005328 Ga0070676_10024966 Ga0070676_100249663 87
56 3300005328 Ga0070676_10053634 Ga0070676_100536343 87
57 3300005329 Ga0070683_100363089 Ga0070683_1003630891 87
58 3300005329 Ga0070683_100471640 Ga0070683_1004716402 87
59 3300005330 Ga0070690_100129153 Ga0070690_1001291533 87
60 3300005331 Ga0070670_100000010 Ga0070670_100000010211 87
61 3300005331 Ga0070670_100175745 Ga0070670_1001757452 87
62 3300005331 Ga0070670_100369755 Ga0070670_1003697552 87
63 3300005333 Ga0070677_10003290 Ga0070677_100032904 87
64 3300005334 Ga0068869_100108552 Ga0068869_1001085521 87
65 3300005335 Ga0070666_10000434 Ga0070666_1000043416 87
66 3300005335 Ga0070666_10011606 Ga0070666_100116066 87
67 3300005336 Ga0070680_100130992 Ga0070680_1001309923 87
68 3300005336 Ga0070680_100515795 Ga0070680_1005157952 87
69 3300005336 Ga0070680_100665778 Ga0070680_1006657781 87
70 3300005336 Ga0070680_101054829 Ga0070680_1010548291 87
71 3300005337 Ga0070682_100043208 Ga0070682_1000432083 87
72 3300005337 Ga0070682_100184869 Ga0070682_1001848692 87
73 3300005337 Ga0070682_100492970 Ga0070682_1004929701 87
74 3300005338 Ga0068868_100000731 Ga0068868_10000073114 87
75 3300005339 Ga0070660_100201660 Ga0070660_1002016602 87
76 3300005340 Ga0070689_100282769 Ga0070689_1002827692 87
77 3300005341 Ga0070691_10688627 Ga0070691_106886272 87
78 3300005343 Ga0070687_100138766 Ga0070687_1001387661 87
79 3300005345 Ga0070692_10038212 Ga0070692_100382124 87
80 3300005345 Ga0070692_10145666 Ga0070692_101456662 87
81 3300005347 Ga0070668_100184870 Ga0070668_1001848701 87
82 3300005347 Ga0070668_100313726 Ga0070668_1003137262 87
83 3300005353 Ga0070669_100002038 Ga0070669_10000203811 87
84 3300005353 Ga0070669_100002915 Ga0070669_1000029152 87
85 3300005353 Ga0070669_100159865 Ga0070669_1001598652 87
86 3300005354 Ga0070675_100000142 Ga0070675_1000001427 87
87 3300005354 Ga0070675_100212151 Ga0070675_1002121513 87
88 3300005354 Ga0070675_100552825 Ga0070675_1005528252 87
89 3300005355 Ga0070671_100019810 Ga0070671_1000198108 87
90 3300005356 Ga0070674_100062122 Ga0070674_1000621222 87
91 3300005364 Ga0070673_100044911 Ga0070673_1000449114 87
92 3300005364 Ga0070673_100151331 Ga0070673_1001513312 87
93 3300005364 Ga0070673_100788185 Ga0070673_1007881852 87
94 3300005365 Ga0070688_100010706 Ga0070688_10001070611 87
95 3300005365 Ga0070688_100012276 Ga0070688_1000122769 87
96 3300005365 Ga0070688_100229611 Ga0070688_1002296112 87
97 3300005366 Ga0070659_100118073 Ga0070659_1001180733 87
98 3300005367 Ga0070667_100000097 Ga0070667_10000009738 87
99 3300005367 Ga0070667_100050742 Ga0070667_1000507427 87
100 3300005367 Ga0070667_100218224 Ga0070667_1002182243 87
101 3300005367 Ga0070667_102233172 Ga0070667_1022331721 87
102 3300005434 Ga0070709_10160141 Ga0070709_101601411 87
103 3300005434 Ga0070709_10206878 Ga0070709_102068783 87
104 3300005434 Ga0070709_10779002 Ga0070709_107790021 87
105 3300005435 Ga0070714_100365933 Ga0070714_1003659332 87
106 3300005436 Ga0070713_100122073 Ga0070713_1001220732 87
107 3300005437 Ga0070710_10804279 Ga0070710_108042792 87
108 3300005438 Ga0070701_10076196 Ga0070701_100761963 87
109 3300005438 Ga0070701_10128378 Ga0070701_101283781 87
110 3300005439 Ga0070711_100219576 Ga0070711_1002195762 87
111 3300005439 Ga0070711_101158306 Ga0070711_1011583062 87
112 3300005439 Ga0070711_101413076 Ga0070711_1014130761 87
113 3300005440 Ga0070705_100205971 Ga0070705_1002059712 87
114 3300005440 Ga0070705_100828802 Ga0070705_1008288021 87
115 3300005440 Ga0070705_101417797 Ga0070705_1014177971 87
116 3300005441 Ga0070700_100184620 Ga0070700_1001846202 87
117 3300005441 Ga0070700_100763939 Ga0070700_1007639391 87
118 3300005441 Ga0070700_100877569 Ga0070700_1008775692 87
119 3300005441 Ga0070700_101529816 Ga0070700_1015298161 87
120 3300005445 Ga0070708_101984769 Ga0070708_1019847691 87
121 3300005455 Ga0070663_100251970 Ga0070663_1002519702 87
122 3300005455 Ga0070663_102123513 Ga0070663_1021235131 87
123 3300005456 Ga0070678_101700295 Ga0070678_1017002952 87
124 3300005457 Ga0070662_100024933 Ga0070662_1000249333 87
125 3300005457 Ga0070662_100041269 Ga0070662_1000412693 87
126 3300005457 Ga0070662_100118793 Ga0070662_1001187933 87
127 3300005458 Ga0070681_10076514 Ga0070681_100765143 87
128 3300005458 Ga0070681_10168578 Ga0070681_101685782 87
129 3300005458 Ga0070681_10409272 Ga0070681_104092722 87
130 3300005459 Ga0068867_100034065 Ga0068867_1000340651 87
131 3300005459 Ga0068867_100090977 Ga0068867_1000909772 87
132 3300005466 Ga0070685_10047439 Ga0070685_100474394 87
133 3300005466 Ga0070685_10085500 Ga0070685_100855001 87
134 3300005468 Ga0070707_100026204 Ga0070707_1000262043 87
135 3300005468 Ga0070707_100527412 Ga0070707_1005274122 87
136 3300005518 Ga0070699_100134760 Ga0070699_1001347603 87
137 3300005530 Ga0070679_100181000 Ga0070679_1001810002 87
138 3300005530 Ga0070679_100313991 Ga0070679_1003139911 87
139 3300005530 Ga0070679_100394557 Ga0070679_1003945571 87
140 3300005530 Ga0070679_100908781 Ga0070679_1009087812 87
141 3300005530 Ga0070679_101070131 Ga0070679_1010701312 87
142 3300005530 Ga0070679_101784948 Ga0070679_1017849482 87
143 3300005535 Ga0070684_100024686 Ga0070684_1000246867 87
144 3300005535 Ga0070684_100036551 Ga0070684_1000365514 87
145 3300005536 Ga0070697_101402457 Ga0070697_1014024572 87
146 3300005539 Ga0068853_100116075 Ga0068853_1001160754 87
147 3300005539 Ga0068853_100339661 Ga0068853_1003396612 87
148 3300005539 Ga0068853_101703639 Ga0068853_1017036391 87
149 3300005543 Ga0070672_100041348 Ga0070672_1000413488 87
150 3300005543 Ga0070672_100073389 Ga0070672_1000733892 87
151 3300005543 Ga0070672_100305222 Ga0070672_1003052222 87
152 3300005543 Ga0070672_100443799 Ga0070672_1004437991 87
153 3300005544 Ga0070686_100135885 Ga0070686_1001358851 87
154 3300005545 Ga0070695_100015005 Ga0070695_1000150053 87
155 3300005546 Ga0070696_100176715 Ga0070696_1001767152 87
156 3300005547 Ga0070693_100105002 Ga0070693_1001050022 87
157 3300005548 Ga0070665_100005670 Ga0070665_1000056703 87
158 3300005548 Ga0070665_100091241 Ga0070665_1000912412 87
159 3300005548 Ga0070665_100136817 Ga0070665_1001368173 87
160 3300005548 Ga0070665_101096807 Ga0070665_1010968072 87
161 3300005549 Ga0070704_100363268 Ga0070704_1003632681 87
162 3300005563 Ga0068855_101858695 Ga0068855_1018586951 87
163 3300005563 Ga0068855_101869259 Ga0068855_1018692591 87
164 3300005564 Ga0070664_100514145 Ga0070664_1005141451 87
165 3300005564 Ga0070664_100622503 Ga0070664_1006225032 87
166 3300005564 Ga0070664_100812819 Ga0070664_1008128192 87
167 3300005577 Ga0068857_100007610 Ga0068857_10000761010 87
168 3300005577 Ga0068857_101194007 Ga0068857_1011940072 87
169 3300005578 Ga0068854_100002758 Ga0068854_10000275815 87
170 3300005614 Ga0068856_100353191 Ga0068856_1003531911 87
171 3300005615 Ga0070702_100142920 Ga0070702_1001429202 87
172 3300005616 Ga0068852_100000390 Ga0068852_10000039034 87
173 3300005616 Ga0068852_100144743 Ga0068852_1001447432 87
174 3300005616 Ga0068852_101965584 Ga0068852_1019655841 87
175 3300005617 Ga0068859_100009767 Ga0068859_10000976712 87
176 3300005617 Ga0068859_101118292 Ga0068859_1011182921 87
177 3300005618 Ga0068864_100000018 Ga0068864_10000001881 87
178 3300005618 Ga0068864_100048810 Ga0068864_1000488106 87
179 3300005618 Ga0068864_100397299 Ga0068864_1003972993 87
180 3300005718 Ga0068866_10051387 Ga0068866_100513873 87
181 3300005718 Ga0068866_10084613 Ga0068866_100846132 87
182 3300005719 Ga0068861_100022724 Ga0068861_1000227241 87
183 3300005719 Ga0068861_100286840 Ga0068861_1002868403 87
184 3300005834 Ga0068851_10001331 Ga0068851_1000133115 87
185 3300005840 Ga0068870_10060086 Ga0068870_100600862 87
186 3300005840 Ga0068870_10359582 Ga0068870_103595822 87
187 3300005840 Ga0068870_11378852 Ga0068870_113788522 87
188 3300005841 Ga0068863_100002082 Ga0068863_1000020823 87
189 3300005841 Ga0068863_100097946 Ga0068863_1000979462 87
190 3300005842 Ga0068858_100151649 Ga0068858_1001516494 87
191 3300005842 Ga0068858_100385123 Ga0068858_1003851231 87
192 3300005843 Ga0068860_100003543 Ga0068860_1000035432 87
193 3300005843 Ga0068860_100178134 Ga0068860_1001781342 87
194 3300005843 Ga0068860_100330205 Ga0068860_1003302052 87
195 3300005843 Ga0068860_102492938 Ga0068860_1024929382 87
196 3300005844 Ga0068862_100004380 Ga0068862_1000043808 87
197 3300005844 Ga0068862_100231919 Ga0068862_1002319192 87
198 3300005844 Ga0068862_100872813 Ga0068862_1008728132 87
199 3300006028 Ga0070717_10253701 Ga0070717_102537013 87
200 3300006028 Ga0070717_10341510 Ga0070717_103415102 87
201 3300006042 Ga0075368_10332263 Ga0075368_103322632 87
202 3300006048 Ga0075363_100231647 Ga0075363_1002316472 87
203 3300006051 Ga0075364_10367375 Ga0075364_103673752 87
204 3300006163 Ga0070715_10061693 Ga0070715_100616932 87
205 3300006173 Ga0070716_100066647 Ga0070716_1000666471 87
206 3300006173 Ga0070716_100205481 Ga0070716_1002054812 87
207 3300006173 Ga0070716_101706110 Ga0070716_1017061102 87
208 3300006175 Ga0070712_100274656 Ga0070712_1002746561 87
209 3300006177 Ga0075362_10103645 Ga0075362_101036453 87
210 3300006195 Ga0075366_10683065 Ga0075366_106830652 87
211 3300006237 Ga0097621_100038659 Ga0097621_1000386595 87
212 3300006237 Ga0097621_100347654 Ga0097621_1003476542 87
213 3300006353 Ga0075370_10077901 Ga0075370_100779014 87
214 3300006358 Ga0068871_100216856 Ga0068871_1002168564 87
215 3300006358 Ga0068871_100622070 Ga0068871_1006220701 87
216 3300006358 Ga0068871_100652196 Ga0068871_1006521962 87
217 3300006844 Ga0075428_100349982 Ga0075428_1003499822 87
218 3300006846 Ga0075430_100863159 Ga0075430_1008631592 87
219 3300006847 Ga0075431_100324902 Ga0075431_1003249022 87
220 3300006847 Ga0075431_100329994 Ga0075431_1003299941 87
221 3300006847 Ga0075431_100342644 Ga0075431_1003426442 87
222 3300006847 Ga0075431_100727463 Ga0075431_1007274633 87
223 3300006871 Ga0075434_100808817 Ga0075434_1008088172 87
224 3300006880 Ga0075429_100512718 Ga0075429_1005127182 87
225 3300006880 Ga0075429_100891170 Ga0075429_1008911701 87
226 3300006881 Ga0068865_100081315 Ga0068865_1000813152 87
227 3300006881 Ga0068865_100090907 Ga0068865_1000909073 87
228 3300006881 Ga0068865_100098387 Ga0068865_1000983873 87
229 3300006881 Ga0068865_100330919 Ga0068865_1003309192 87
230 3300006881 Ga0068865_101732024 Ga0068865_1017320241 87
231 3300006914 Ga0075436_100786413 Ga0075436_1007864132 87
232 3300006931 Ga0097620_100009767 Ga0097620_10000976712 87
233 3300006931 Ga0097620_101118344 Ga0097620_1011183441 87
234 3300009011 Ga0105251_10092339 Ga0105251_100923391 87
235 3300009092 Ga0105250_10030949 Ga0105250_100309493 87
236 3300009093 Ga0105240_10503692 Ga0105240_105036922 87
237 3300009093 Ga0105240_10577848 Ga0105240_105778482 87
238 3300009093 Ga0105240_11136983 Ga0105240_111369832 87
239 3300009093 Ga0105240_12045208 Ga0105240_120452082 87
240 3300009093 Ga0105240_12172052 Ga0105240_121720521 87
241 3300009093 Ga0105240_12274941 Ga0105240_122749411 87
242 3300009093 Ga0105240_12647593 Ga0105240_126475931 87
243 3300009094 Ga0111539_10008259 Ga0111539_100082594 87
244 3300009094 Ga0111539_10279094 Ga0111539_102790941 87
245 3300009094 Ga0111539_10605512 Ga0111539_106055121 87
246 3300009098 Ga0105245_10161996 Ga0105245_101619962 87
247 3300009147 Ga0114129_10579642 Ga0114129_105796422 87
248 3300009147 Ga0114129_12221022 Ga0114129_122210221 87
249 3300009148 Ga0105243_10325167 Ga0105243_103251671 87
250 3300009174 Ga0105241_10145570 Ga0105241_101455703 87
251 3300009176 Ga0105242_10144840 Ga0105242_101448402 87
252 3300009176 Ga0105242_11413531 Ga0105242_114135311 87
253 3300009176 Ga0105242_12698931 Ga0105242_126989312 87
254 3300009177 Ga0105248_10239439 Ga0105248_102394392 87
255 3300009177 Ga0105248_10895465 Ga0105248_108954653 87
256 3300009177 Ga0105248_11306607 Ga0105248_113066071 87
257 3300009545 Ga0105237_10343161 Ga0105237_103431611 87
258 3300009545 Ga0105237_10750018 Ga0105237_107500181 87
259 3300009551 Ga0105238_10116238 Ga0105238_101162383 87
260 3300009551 Ga0105238_12232222 Ga0105238_122322221 87
261 3300009551 Ga0105238_12305025 Ga0105238_123050252 87
262 3300009553 Ga0105249_10038858 Ga0105249_100388588 87
263 3300009553 Ga0105249_10142525 Ga0105249_101425252 87
264 3300009553 Ga0105249_10385844 Ga0105249_103858442 87
265 3300009553 Ga0105249_10395845 Ga0105249_103958453 87
266 3300009553 Ga0105249_10937330 Ga0105249_109373302 87
267 3300009553 Ga0105249_11257901 Ga0105249_112579012 87
268 3300009553 Ga0105249_13086240 Ga0105249_130862402 87
269 3300010375 Ga0105239_10336874 Ga0105239_103368743 87
270 3300010375 Ga0105239_11861970 Ga0105239_118619701 87
271 3300011119 Ga0105246_10133936 Ga0105246_101339361 87
272 3300011119 Ga0105246_10533862 Ga0105246_105338622 87
273 3300013100 Ga0157373_10192442 Ga0157373_101924422 87
274 3300013102 Ga0157371_10074708 Ga0157371_100747082 87
275 3300013102 Ga0157371_11303649 Ga0157371_113036492 87
276 3300013104 Ga0157370_10285225 Ga0157370_102852251 87
277 3300013105 Ga0157369_10221635 Ga0157369_102216351 87
278 3300013105 Ga0157369_10869832 Ga0157369_108698321 87
279 3300013296 Ga0157374_10565252 Ga0157374_105652522 87
280 3300013296 Ga0157374_11660815 Ga0157374_116608151 87
281 3300013297 Ga0157378_10717409 Ga0157378_107174092 87
282 3300013306 Ga0163162_10270546 Ga0163162_102705464 87
283 3300013306 Ga0163162_10581771 Ga0163162_105817711 87
284 3300013307 Ga0157372_10204993 Ga0157372_102049932 87
285 3300013307 Ga0157372_10551976 Ga0157372_105519762 87
286 3300013308 Ga0157375_10006008 Ga0157375_100060082 87
287 3300013308 Ga0157375_10312321 Ga0157375_103123211 87
288 3300013308 Ga0157375_10477632 Ga0157375_104776322 87
289 3300014325 Ga0163163_10000406 Ga0163163_1000040638 87
290 3300014325 Ga0163163_10338488 Ga0163163_103384883 87
291 3300014326 Ga0157380_10019022 Ga0157380_100190227 87
292 3300014326 Ga0157380_10036617 Ga0157380_100366175 87
293 3300014326 Ga0157380_12553008 Ga0157380_125530081 87
294 3300014745 Ga0157377_10043578 Ga0157377_100435782 87
295 3300014745 Ga0157377_10112358 Ga0157377_101123582 87
296 3300014968 Ga0157379_11104537 Ga0157379_111045372 87
297 3300014969 Ga0157376_10522663 Ga0157376_105226631 87
298 3300014969 Ga0157376_11785518 Ga0157376_117855181 87
299 3300017792 Ga0163161_10039200 Ga0163161_100392002 87
300 3300017792 Ga0163161_10687162 Ga0163161_106871622 87
301 3300021361 Ga0213872_10031527 Ga0213872_100315273 87
302 3300021361 Ga0213872_10105601 Ga0213872_101056012 87
303 3300025226 Ga0209674_104538 Ga0209674_1045382 87
304 3300025271 Ga0207666_1010630 Ga0207666_10106301 87
305 3300025290 Ga0207673_1023442 Ga0207673_10234422 87
306 3300025315 Ga0207697_10033671 Ga0207697_100336712 87
307 3300025321 Ga0207656_10000974 Ga0207656_100009744 87
308 3300025711 Ga0207696_1054661 Ga0207696_10546611 87
309 3300025893 Ga0207682_10034601 Ga0207682_100346013 87
310 3300025899 Ga0207642_10077169 Ga0207642_100771692 87
311 3300025900 Ga0207710_10127708 Ga0207710_101277082 87
312 3300025901 Ga0207688_10054351 Ga0207688_100543512 87
313 3300025903 Ga0207680_10000744 Ga0207680_100007447 87
314 3300025903 Ga0207680_10414496 Ga0207680_104144961 87
315 3300025904 Ga0207647_10529384 Ga0207647_105293841 87
316 3300025906 Ga0207699_10232057 Ga0207699_102320571 87
317 3300025906 Ga0207699_11046716 Ga0207699_110467161 87
318 3300025906 Ga0207699_11272298 Ga0207699_112722981 87
319 3300025907 Ga0207645_10012221 Ga0207645_100122212 87
320 3300025907 Ga0207645_10041219 Ga0207645_100412192 87
321 3300025907 Ga0207645_10084104 Ga0207645_100841042 87
322 3300025908 Ga0207643_10001596 Ga0207643_1000159612 87
323 3300025908 Ga0207643_10040194 Ga0207643_100401943 87
324 3300025908 Ga0207643_10165129 Ga0207643_101651292 87
325 3300025909 Ga0207705_10179674 Ga0207705_101796743 87
326 3300025911 Ga0207654_10862344 Ga0207654_108623441 87
327 3300025912 Ga0207707_10143691 Ga0207707_101436914 87
328 3300025912 Ga0207707_10332503 Ga0207707_103325031 87
329 3300025912 Ga0207707_10447903 Ga0207707_104479032 87
330 3300025912 Ga0207707_10648020 Ga0207707_106480201 87
331 3300025913 Ga0207695_10322031 Ga0207695_103220311 87
332 3300025913 Ga0207695_10569569 Ga0207695_105695691 87
333 3300025914 Ga0207671_10650082 Ga0207671_106500821 87
334 3300025915 Ga0207693_10119618 Ga0207693_101196182 87
335 3300025916 Ga0207663_10142731 Ga0207663_101427311 87
336 3300025916 Ga0207663_11185323 Ga0207663_111853231 87
337 3300025917 Ga0207660_10125550 Ga0207660_101255502 87
338 3300025917 Ga0207660_10428307 Ga0207660_104283072 87
339 3300025917 Ga0207660_11002839 Ga0207660_110028391 87
340 3300025918 Ga0207662_10172834 Ga0207662_101728341 87
341 3300025918 Ga0207662_10210351 Ga0207662_102103511 87
342 3300025919 Ga0207657_10377300 Ga0207657_103773002 87
343 3300025919 Ga0207657_11331657 Ga0207657_113316571 87
344 3300025920 Ga0207649_10400231 Ga0207649_104002312 87
345 3300025920 Ga0207649_11272493 Ga0207649_112724931 87
346 3300025920 Ga0207649_11307832 Ga0207649_113078322 87
347 3300025921 Ga0207652_10344965 Ga0207652_103449652 87
348 3300025921 Ga0207652_11047410 Ga0207652_110474102 87
349 3300025921 Ga0207652_11197130 Ga0207652_111971302 87
350 3300025922 Ga0207646_10006034 Ga0207646_100060347 87
351 3300025922 Ga0207646_10579686 Ga0207646_105796861 87
352 3300025923 Ga0207681_10015134 Ga0207681_100151342 87
353 3300025923 Ga0207681_10767050 Ga0207681_107670502 87
354 3300025924 Ga0207694_10192021 Ga0207694_101920211 87
355 3300025924 Ga0207694_10588549 Ga0207694_105885491 87
356 3300025924 Ga0207694_11079161 Ga0207694_110791611 87
357 3300025925 Ga0207650_10000003 Ga0207650_10000003290 87
358 3300025925 Ga0207650_10056652 Ga0207650_100566524 87
359 3300025925 Ga0207650_10571782 Ga0207650_105717822 87
360 3300025925 Ga0207650_11452596 Ga0207650_114525961 87
361 3300025926 Ga0207659_10003121 Ga0207659_100031218 87
362 3300025926 Ga0207659_10004672 Ga0207659_100046728 87
363 3300025927 Ga0207687_10134191 Ga0207687_101341912 87
364 3300025928 Ga0207700_10219163 Ga0207700_102191631 87
365 3300025929 Ga0207664_10624271 Ga0207664_106242711 87
366 3300025931 Ga0207644_10000418 Ga0207644_1000041814 87
367 3300025932 Ga0207690_10060175 Ga0207690_100601754 87
368 3300025933 Ga0207706_10029593 Ga0207706_100295932 87
369 3300025933 Ga0207706_10054855 Ga0207706_100548553 87
370 3300025933 Ga0207706_10191182 Ga0207706_101911823 87
371 3300025934 Ga0207686_10285395 Ga0207686_102853952 87
372 3300025935 Ga0207709_10103479 Ga0207709_101034794 87
373 3300025936 Ga0207670_11421197 Ga0207670_114211971 87
374 3300025937 Ga0207669_10024719 Ga0207669_100247192 87
375 3300025938 Ga0207704_10177715 Ga0207704_101777152 87
376 3300025938 Ga0207704_10204778 Ga0207704_102047781 87
377 3300025938 Ga0207704_10856027 Ga0207704_108560271 87
378 3300025939 Ga0207665_10119914 Ga0207665_101199141 87
379 3300025939 Ga0207665_10346763 Ga0207665_103467632 87
380 3300025939 Ga0207665_10751261 Ga0207665_107512612 87
381 3300025940 Ga0207691_10065733 Ga0207691_100657332 87
382 3300025940 Ga0207691_10105734 Ga0207691_101057342 87
383 3300025940 Ga0207691_10156887 Ga0207691_101568873 87
384 3300025940 Ga0207691_10439969 Ga0207691_104399691 87
385 3300025940 Ga0207691_10467883 Ga0207691_104678832 87
386 3300025941 Ga0207711_10306598 Ga0207711_103065983 87
387 3300025941 Ga0207711_10370582 Ga0207711_103705822 87
388 3300025941 Ga0207711_10970237 Ga0207711_109702372 87
389 3300025942 Ga0207689_10056670 Ga0207689_100566704 87
390 3300025942 Ga0207689_10542085 Ga0207689_105420852 87
391 3300025944 Ga0207661_10024178 Ga0207661_100241784 87
392 3300025944 Ga0207661_10815919 Ga0207661_108159191 87
393 3300025945 Ga0207679_10322145 Ga0207679_103221452 87
394 3300025945 Ga0207679_10376087 Ga0207679_103760872 87
395 3300025949 Ga0207667_10555515 Ga0207667_105555152 87
396 3300025960 Ga0207651_10001418 Ga0207651_100014186 87
397 3300025960 Ga0207651_10566421 Ga0207651_105664212 87
398 3300025960 Ga0207651_10783398 Ga0207651_107833982 87
399 3300025961 Ga0207712_10370020 Ga0207712_103700202 87
400 3300025961 Ga0207712_10834588 Ga0207712_108345881 87
401 3300025961 Ga0207712_10894689 Ga0207712_108946891 87
402 3300025972 Ga0207668_10065856 Ga0207668_100658562 87
403 3300025972 Ga0207668_10375320 Ga0207668_103753201 87
404 3300025981 Ga0207640_10002548 Ga0207640_1000254812 87
405 3300025986 Ga0207658_10000007 Ga0207658_1000000779 87
406 3300025986 Ga0207658_10396196 Ga0207658_103961962 87
407 3300026023 Ga0207677_10253214 Ga0207677_102532142 87
408 3300026035 Ga0207703_10095406 Ga0207703_100954063 87
409 3300026035 Ga0207703_11032360 Ga0207703_110323602 87
410 3300026041 Ga0207639_10109338 Ga0207639_101093383 87
411 3300026041 Ga0207639_11817955 Ga0207639_118179551 87
412 3300026067 Ga0207678_10103686 Ga0207678_101036862 87
413 3300026075 Ga0207708_10348805 Ga0207708_103488052 87
414 3300026078 Ga0207702_10423557 Ga0207702_104235572 87
415 3300026078 Ga0207702_10984777 Ga0207702_109847771 87
416 3300026078 Ga0207702_11689315 Ga0207702_116893152 87
417 3300026088 Ga0207641_10001670 Ga0207641_100016706 87
418 3300026088 Ga0207641_10077683 Ga0207641_100776832 87
419 3300026089 Ga0207648_10017451 Ga0207648_100174513 87
420 3300026089 Ga0207648_10036740 Ga0207648_100367402 87
421 3300026095 Ga0207676_10000003 Ga0207676_10000003805 87
422 3300026095 Ga0207676_10302644 Ga0207676_103026441 87
423 3300026116 Ga0207674_10728386 Ga0207674_107283862 87
424 3300026116 Ga0207674_11169880 Ga0207674_111698801 87
425 3300026118 Ga0207675_100012950 Ga0207675_1000129506 87
426 3300026118 Ga0207675_100345890 Ga0207675_1003458901 87
427 3300026121 Ga0207683_10002093 Ga0207683_1000209316 87
428 3300026121 Ga0207683_10062230 Ga0207683_100622302 87
429 3300026121 Ga0207683_10953062 Ga0207683_109530621 87
430 3300026121 Ga0207683_11615368 Ga0207683_116153682 87
431 3300026142 Ga0207698_10128210 Ga0207698_101282104 87
432 3300026142 Ga0207698_10273890 Ga0207698_102738902 87
433 3300027252 Ga0209973_1016096 Ga0209973_10160962 87
434 3300027552 Ga0209982_1001027 Ga0209982_10010273 87
435 3300027617 Ga0210002_1002097 Ga0210002_10020973 87
436 3300027695 Ga0209966_1055626 Ga0209966_10556262 87
437 3300027695 Ga0209966_1142412 Ga0209966_11424121 87
438 3300027717 Ga0209998_10004632 Ga0209998_100046322 87
439 3300027717 Ga0209998_10067297 Ga0209998_100672972 87
440 3300027866 Ga0209813_10319353 Ga0209813_103193532 87
441 3300027876 Ga0209974_10027166 Ga0209974_100271662 87
442 3300027907 Ga0207428_10002309 Ga0207428_1000230913 87
443 3300028379 Ga0268266_10001450 Ga0268266_100014505 87
444 3300028379 Ga0268266_10457039 Ga0268266_104570391 87
445 3300028379 Ga0268266_10852897 Ga0268266_108528972 87
446 3300028379 Ga0268266_11663248 Ga0268266_116632482 87
447 3300028380 Ga0268265_10020118 Ga0268265_100201184 87
448 3300028380 Ga0268265_10293369 Ga0268265_102933691 87
449 3300028380 Ga0268265_10784502 Ga0268265_107845022 87
450 3300028380 Ga0268265_10871457 Ga0268265_108714571 87
451 3300028381 Ga0268264_10010705 Ga0268264_100107052 87
452 3300028381 Ga0268264_10463759 Ga0268264_104637591 87
453 3300028381 Ga0268264_11167430 Ga0268264_111674302 87
454 3300028381 Ga0268264_12245970 Ga0268264_122459702 87
455 3300028381 Ga0268264_12364174 Ga0268264_123641742 87
456 3300028573 Ga0265334_10005070 Ga0265334_100050706 87
457 3300031240 Ga0265320_10188426 Ga0265320_101884261 87
458 3300031250 Ga0265331_10318015 Ga0265331_103180151 87
459 3300031344 Ga0265316_10726650 Ga0265316_107266502 87
460 3300031507 Ga0307509_10003642 Ga0307509_1000364221 87
461 3300031507 Ga0307509_10140810 Ga0307509_101408104 87
462 3300031548 Ga0307408_100265336 Ga0307408_1002653362 87
463 3300031548 Ga0307408_101645007 Ga0307408_1016450072 87
464 3300031616 Ga0307508_10385855 Ga0307508_103858551 87
465 3300031616 Ga0307508_10556787 Ga0307508_105567871 87
466 3300031691 Ga0316579_10119057 Ga0316579_101190572 87
467 3300031691 Ga0316579_10244750 Ga0316579_102447501 87
468 3300031727 Ga0316576_10231338 Ga0316576_102313382 87
469 3300031727 Ga0316576_10242936 Ga0316576_102429361 87
470 3300031728 Ga0316578_10129092 Ga0316578_101290923 87
471 3300031728 Ga0316578_10597301 Ga0316578_105973011 87
472 3300031728 Ga0316578_10930557 Ga0316578_109305572 87
473 3300031731 Ga0307405_10499898 Ga0307405_104998982 87
474 3300031733 Ga0316577_10016985 Ga0316577_100169852 87
475 3300031824 Ga0307413_10776593 Ga0307413_107765931 87
476 3300031903 Ga0307407_10176144 Ga0307407_101761442 87
477 3300031911 Ga0307412_11379192 Ga0307412_113791921 87
478 3300032002 Ga0307416_100941439 Ga0307416_1009414392 87
479 3300032002 Ga0307416_101151637 Ga0307416_1011516372 87
480 3300032002 Ga0307416_102706938 Ga0307416_1027069381 87
481 3300032004 Ga0307414_12105431 Ga0307414_121054312 87
482 3300032005 Ga0307411_10152781 Ga0307411_101527813 87
483 3300032005 Ga0307411_10540202 Ga0307411_105402022 87
484 3300032126 Ga0307415_100188462 Ga0307415_1001884623 87
485 3300032126 Ga0307415_100798326 Ga0307415_1007983262 87
486 3300032126 Ga0307415_101549627 Ga0307415_1015496271 87
487 3300032137 Ga0316585_10011187 Ga0316585_100111873 87
488 3300032139 Ga0316580_10043601 Ga0316580_100436013 87
489 3300035089 Ga0373944_0057126 Ga0373944_0057126_902_1165 87
490 3300035091 Ga0373951_0130023 Ga0373951_0130023_370_633 87
491 3300035113 Ga0373936_0125949 Ga0373936_0125949_252_515 87
492 3300035115 Ga0373941_0190214 Ga0373941_0190214_147_410 87
493 3300035116 Ga0373945_0049408 Ga0373945_0049408_312_575 87
494 3300035170 Ga0373943_0132876 Ga0373943_0132876_174_437 87
495 3300035172 Ga0373955_0811996 Ga0373955_0811996_145_414 87
496 3300035241 Ga0373961_0231631 Ga0373961_0231631_325_588 87
497 3300035398 Ga0316574_0105059 Ga0316574_0105059_664_933 87
498 3300035398 Ga0316574_0137169 Ga0316574_0137169_1096_1359 87
499 3300035398 Ga0316574_0223937 Ga0316574_0223937_850_1113 87
500 3300035691 Ga0373931_0124858 Ga0373931_0124858_77_340 87
501 3300035692 Ga0373935_0250511 Ga0373935_0250511_891_1160 87
502 3300035695 Ga0373927_0121099 Ga0373927_0121099_1286_1549 87
503 3300035725 Ga0373947_0139014 Ga0373947_0139014_335_598 87
504 3300036647 Ga0316582_0224958 Ga0316582_0224958_118_387 87
505 3300036647 Ga0316582_0922937 Ga0316582_0922937_276_545 87
506 3300036647 Ga0316582_1067784 Ga0316582_1067784_124_387 87
507 3300036712 Ga0316584_0205954 Ga0316584_0205954_142_411 87
508 3300036712 Ga0316584_0258095 Ga0316584_0258095_898_1161 87
509 3300036712 Ga0316584_0375225 Ga0316584_0375225_631_894 87
510 3300037068 Ga0373925_0644977 Ga0373925_0644977_510_773 87
511 3300037312 Ga0395899_0220296 Ga0395899_0220296_991_1260 87
512 3300037418 Ga0395900_1774263 Ga0395900_1774263_94_357 87
513 3300037466 Ga0395898_0198512 Ga0395898_0198512_902_1171 87
514 3300037588 Ga0316581_0094564 Ga0316581_0094564_492_761 87
515 3300039438 Ga0436360_0817650 Ga0436360_0817650_210_479 87
516 3300039447 Ga0436361_0147800 Ga0436361_0147800_874_1143 87
517 3300039447 Ga0436361_0519472 Ga0436361_0519472_15_278 87
518 3300039447 Ga0436361_0765718 Ga0436361_0765718_219_482 87
519 3300039447 Ga0436361_1008104 Ga0436361_1008104_937_1206 87
520 3300041407 Ga0439447_036003 Ga0439447_036003_91_354 87
521 3300041413 Ga0439465_0057306 Ga0439465_0057306_40_309 87
522 3300041443 Ga0451789_0630838 Ga0451789_0630838_1183_1446 87
523 3300041452 Ga0451793_0316792 Ga0451793_0316792_349_612 87
524 3300041456 Ga0451795_1495749 Ga0451795_1495749_473_736 87
525 3300041458 Ga0451798_0317467 Ga0451798_0317467_892_1155 87
526 3300041459 Ga0451800_1612496 Ga0451800_1612496_1236_1499 87
527 3300041460 Ga0451802_0332722 Ga0451802_0332722_194_457 87
528 3300041463 Ga0451804_0634357 Ga0451804_0634357_265_528 87
529 3300041486 Ga0451807_0915961 Ga0451807_0915961_2880_3143 87
530 3300041491 Ga0451833_1092509 Ga0451833_1092509_261_524 87
531 3300041491 Ga0451833_1477764 Ga0451833_1477764_255_518 87
532 3300041492 Ga0451835_0175095 Ga0451835_0175095_232_495 87
533 3300041492 Ga0451835_0580138 Ga0451835_0580138_989_1252 87
534 3300041496 Ga0451839_1509357 Ga0451839_1509357_238_501 87
535 3300041496 Ga0451839_1586213 Ga0451839_1586213_749_1012 87
536 3300041498 Ga0451841_0268182 Ga0451841_0268182_289_552 87
537 3300041498 Ga0451841_0396150 Ga0451841_0396150_243_506 87
538 3300041501 Ga0451845_0350209 Ga0451845_0350209_344_607 87
539 3300041501 Ga0451845_0609513 Ga0451845_0609513_70_333 87
540 3300041505 Ga0451849_1066439 Ga0451849_1066439_979_1242 87
541 3300041509 Ga0451843_0475333 Ga0451843_0475333_766_1029 87
542 3300041509 Ga0451843_1603629 Ga0451843_1603629_179_442 87
543 3300041509 Ga0451843_1653883 Ga0451843_1653883_562_825 87
544 3300041511 Ga0451855_1179725 Ga0451855_1179725_222_485 87
545 3300041512 Ga0451853_1111132 Ga0451853_1111132_254_517 87
546 3300041512 Ga0451853_1258382 Ga0451853_1258382_70_333 87
547 3300041512 Ga0451853_1282000 Ga0451853_1282000_762_1025 87
548 3300041997 Ga0439431_0071722 Ga0439431_0071722_156_419 87
549 3300041999 Ga0439433_0189252 Ga0439433_0189252_115_378 87
550 3300042002 Ga0439442_069599 Ga0439442_069599_435_698 87
551 3300042004 Ga0439445_0019339 Ga0439445_0019339_1335_1604 87
552 3300042008 Ga0439450_028295 Ga0439450_028295_922_1185 87
553 3300042015 Ga0439462_0128788 Ga0439462_0128788_400_663 87
554 3300042118 Ga0450914_038093 Ga0450914_038093_142_501 87
555 3300042122 Ga0450920_039975 Ga0450920_039975_115_384 87
556 3300042123 Ga0450921_000892 Ga0450921_000892_890_1159 87
557 3300042124 Ga0450922_004681 Ga0450922_004681_175_444 87
558 3300042125 Ga0450923_018352 Ga0450923_018352_742_1011 87
559 3300042126 Ga0450888_061148 Ga0450888_061148_175_444 87
560 3300042132 Ga0450895_003188 Ga0450895_003188_915_1184 87
561 3300042133 Ga0450896_005254 Ga0450896_005254_852_1121 87
562 3300042135 Ga0450899_012271 Ga0450899_012271_73_342 87
563 3300042145 Ga0450906_079179 Ga0450906_079179_184_453 87
564 3300042146 Ga0450907_034213 Ga0450907_034213_438_707 87
565 3300042147 Ga0450910_016818 Ga0450910_016818_669_938 87
566 3300042435 Ga0439434_0114377 Ga0439434_0114377_377_640 87
567 3300042435 Ga0439434_0173014 Ga0439434_0173014_414_683 87
568 3300042435 Ga0439434_0366258 Ga0439434_0366258_190_459 87
569 3300042436 Ga0439435_0006907 Ga0439435_0006907_1711_1974 87
570 3300042439 Ga0439464_0161221 Ga0439464_0161221_141_404 87
571 3300042461 Ga0439460_0042769 Ga0439460_0042769_174_437 87
572 3300042531 Ga0450918_034442 Ga0450918_034442_62_331 87
573 3300042532 Ga0450893_0065962 Ga0450893_0065962_271_534 87
574 3300042876 Ga0451577_0269634 Ga0451577_0269634_69_332 87
575 3300042876 Ga0451577_0537059 Ga0451577_0537059_712_975 87
576 3300044658 Ga0466972_0623410 Ga0466972_0623410_141_407 87
577 3300044666 Ga0466977_0018143 Ga0466977_0018143_3187_3456 87
578 3300044673 Ga0453683_1061433 Ga0453683_1061433_103_366 87
579 3300044712 Ga0453684_0019721 Ga0453684_0019721_4738_5001 87
580 3300044712 Ga0453684_0624448 Ga0453684_0624448_547_810 87
581 3300044712 Ga0453684_1251833 Ga0453684_1251833_119_382 87
582 3300045051 Ga0451576_0341292 Ga0451576_0341292_1160_1423 87
583 3300045051 Ga0451576_0715996 Ga0451576_0715996_52_315 87
584 3300045051 Ga0451576_1740716 Ga0451576_1740716_98_361 87
585 3300046459 Ga0495629_0193831 Ga0495629_0193831_952_1215 87
586 3300046513 Ga0495616_0100144 Ga0495616_0100144_117_380 87
587 3300046515 Ga0495620_0054158 Ga0495620_0054158_961_1224 87
588 3300046528 Ga0495642_0179618 Ga0495642_0179618_27_290 87
589 3300046539 Ga0495621_0117575 Ga0495621_0117575_740_1009 87
590 3300046558 Ga0495633_0297774 Ga0495633_0297774_281_550 87
591 3300046681 Ga0495647_0074700 Ga0495647_0074700_291_554 87
592 3300046681 Ga0495647_0479337 Ga0495647_0479337_76_345 87
593 3300046683 Ga0495658_0677730 Ga0495658_0677730_332_595 87
594 3300046684 Ga0495669_0131114 Ga0495669_0131114_782_1051 87
595 3300046692 Ga0495671_0379464 Ga0495671_0379464_15_278 87
596 3300047315 Ga0495581_0202894 Ga0495581_0202894_19_282 87
597 3300047318 Ga0495636_0149061 Ga0495636_0149061_622_891 87
598 3300048903 Ga0496100_0119135 Ga0496100_0119135_564_827 87
599 3300048904 Ga0496101_0128753 Ga0496101_0128753_81_344 87
600 3300048905 Ga0496102_0202043 Ga0496102_0202043_1348_1611 87
601 3300048906 Ga0496103_0173132 Ga0496103_0173132_1053_1316 87
602 3300048907 Ga0496104_0219728 Ga0496104_0219728_982_1251 87
603 3300048907 Ga0496104_0359853 Ga0496104_0359853_317_580 87
604 3300048908 Ga0496105_0090171 Ga0496105_0090171_2193_2456 87
605 3300048908 Ga0496105_0278089 Ga0496105_0278089_979_1248 87
606 3300048909 Ga0496106_0119184 Ga0496106_0119184_816_1079 87
607 3300048909 Ga0496106_0713414 Ga0496106_0713414_214_477 87
608 3300048910 Ga0496107_0194423 Ga0496107_0194423_594_857 87
609 3300048911 Ga0496108_0058854 Ga0496108_0058854_568_831 87
610 3300048912 Ga0496109_0285161 Ga0496109_0285161_378_641 87
611 3300048913 Ga0496110_0341672 Ga0496110_0341672_533_796 87
612 3300048914 Ga0496111_0196479 Ga0496111_0196479_326_589 87
613 3300048915 Ga0496112_0365141 Ga0496112_0365141_176_439 87
614 3300048916 Ga0496113_0340650 Ga0496113_0340650_863_1126 87
615 3300048917 Ga0496114_0422694 Ga0496114_0422694_75_338 87
616 3300048917 Ga0496114_0844743 Ga0496114_0844743_98_361 87
617 3300048918 Ga0496115_0232625 Ga0496115_0232625_267_530 87
618 3300048918 Ga0496115_0711787 Ga0496115_0711787_129_392 87
619 3300048923 Ga0496120_0097084 Ga0496120_0097084_498_767 87
620 3300048927 Ga0496124_0378901 Ga0496124_0378901_649_912 87
621 3300048928 Ga0496125_0012461 Ga0496125_0012461_2074_2337 87
622 3300048928 Ga0496125_0666626 Ga0496125_0666626_240_503 87
623 3300049459 Ga0495678_236402 Ga0495678_236402_48_311 87
624 3300049518 Ga0501295_014961 Ga0501295_014961_526_795 87
625 3300049570 Ga0501033_0253218 Ga0501033_0253218_813_1082 87
626 3300049573 Ga0501037_0099910 Ga0501037_0099910_865_1134 87
627 3300049574 Ga0501038_0980916 Ga0501038_0980916_229_492 87
628 3300049579 Ga0501043_0232923 Ga0501043_0232923_1009_1272 87
629 3300049583 Ga0501067_0375740 Ga0501067_0375740_419_685 87
630 3300049586 Ga0501070_1506285 Ga0501070_1506285_234_497 87
631 3300049758 Ga0501241_079638 Ga0501241_079638_175_444 87
632 3300049822 Ga0501035_0083596 Ga0501035_0083596_1776_2045 87
633 3300049823 Ga0501044_0025921 Ga0501044_0025921_325_594 87
634 3300050489 nmdc:mga03683_132531_c1 nmdc:mga03683_132531_c1_794_1057 87
635 3300050491 nmdc:mga00v17_473230_c1 nmdc:mga00v17_473230_c1_312_575 87
636 3300050493 nmdc:mga0k408_622973_c1 nmdc:mga0k408_622973_c1_35_298 87
637 3300050495 nmdc:mga04h51_281546_c1 nmdc:mga04h51_281546_c1_259_522 87
638 3300050496 nmdc:mga07m45_109960_c1 nmdc:mga07m45_109960_c1_166_429 87
639 3300050507 nmdc:mga05p37_452451_c1 nmdc:mga05p37_452451_c1_1154_1417 87
640 3300050508 nmdc:mga09592_367723_c1 nmdc:mga09592_367723_c1_604_867 87
641 3300050508 nmdc:mga09592_480111_c1 nmdc:mga09592_480111_c1_659_922 87
642 3300050509 nmdc:mga0qj67_887419_c1 nmdc:mga0qj67_887419_c1_305_574 87
643 3300050510 nmdc:mga06r32_231085_c1 nmdc:mga06r32_231085_c1_362_628 87
644 3300050510 nmdc:mga06r32_404245_c1 nmdc:mga06r32_404245_c1_73_336 87
645 3300050510 nmdc:mga06r32_710321_c1 nmdc:mga06r32_710321_c1_566_835 87
646 3300050511 nmdc:mga08y16_1977340_c1 nmdc:mga08y16_1977340_c1_158_421 87
647 3300050511 nmdc:mga08y16_473316_c1 nmdc:mga08y16_473316_c1_918_1184 87
648 3300050511 nmdc:mga08y16_57762_c1 nmdc:mga08y16_57762_c1_2660_2926 87
649 3300050512 nmdc:mga0n895_1227744_c1 nmdc:mga0n895_1227744_c1_408_671 87
650 3300050514 nmdc:mga08x19_47707_c1 nmdc:mga08x19_47707_c1_1591_1854 87
651 3300053078 Ga0495612_0152216 Ga0495612_0152216_212_475 87
652 3300053119 Ga0500595_055337 Ga0500595_055337_69_338 87
653 3300053131 Ga0500652_063406 Ga0500652_063406_10_282 87
654 3300053139 Ga0500568_0121623 Ga0500568_0121623_102_365 87
655 3300053140 Ga0500573_0467875 Ga0500573_0467875_113_382 87
656 3300053156 Ga0500622_0022194 Ga0500622_0022194_878_1156 87

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01527

HTH_Tnp_1

Transposase

3

72

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
8b4h-assembly1.cif.gz_D ista transposase cleaved donor complex 0.9083 4 40
2elh-assembly1.cif.gz_A solution structure of the cenp-b n-terminal dna-binding domain of fruit fly distal antenna cg11849-pa 0.8643 3 43
5af3-assembly1.cif.gz_B x-ray crystal structure of rv2018 from mycobacterium tuberculosis 0.8266 10 38
5af3-assembly1.cif.gz_A x-ray crystal structure of rv2018 from mycobacterium tuberculosis 0.8253 10 38
1hlv-assembly1.cif.gz_A crystal structure of cenp-b(1-129) complexed with the cenp-b box dna 0.8215 1 40
ID Description Score Start End Superfamily
2elhA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8643 3 43 1.10.10.10
af_P0AED5_2_210_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8301 8 43 3.40.50.2300
2r0qF02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.8153 10 42 1.10.10.60
af_Q2G2N6_1_70_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8149 8 43 1.10.10.10
af_A0A1D8PUB1_3_238_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8107 10 45 3.40.50.300
ID Description Score Start End GO Terms
AF-Q9I4Y3-F1-model_v4 Transposase 0.9673 1 87 GO:0003677
GO:0004803
GO:0006313
AF-U9SRC7-F1-model_v4 Pogo transposable element with krab domain 0.9626 1 43 GO:0003677
GO:0005634
AF-A0A7U9IXE8-F1-model_v4 Transposase 0.9621 1 87 GO:0003677
GO:0004803
GO:0006313
AF-A0A316G3R5-F1-model_v4 Putative transposase 0.9604 6 71 GO:0003677
GO:0004803
GO:0006313
AF-A0A1T1ZZQ5-F1-model_v4 Transposase 0.9595 11 87 GO:0003677
GO:0004803
GO:0006313

Feature Viewer

pLDDT pTM Quality
94.76 0.7 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map