F473018
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 656 | 380 | 636 | 87 |
Family's Representative Sequence
| Representative Sequence | 3300009553|Ga0105249_11257901|Ga0105249_112579012 |
| Length | 101 |
| Sequence | LDVKKRFSEEQIIGFLKEAEAGVPVKELARKQGFSDASFYLWRSKFGGMDVPDAKRLKSLETENARLKKLLAESMLENEVTREALRKKFQPHRLDESWCGG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2687453129 | Halotalea alkalilenta IHB B 13600 | Isolate | Unclassified |
| 3 | 2998344455 | Vogesella urethralis SLBN-145 | Isolate | Rhizosphere |
| 4 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 5 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 6 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 7 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 8 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 9 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 10 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 11 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 12 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 13 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 14 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 15 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 16 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 17 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 18 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 19 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 21 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 30 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 34 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 46 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 61 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 62 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 66 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 69 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 71 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 77 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 79 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 80 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 81 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 83 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 84 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 85 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 86 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 87 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 88 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 89 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 90 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 91 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 92 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 93 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 95 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 96 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 97 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 98 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 99 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 100 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 101 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 102 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 104 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 105 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 106 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 107 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 108 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 109 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 110 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 111 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 112 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 145 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 219 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 221 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 225 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 226 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 227 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 228 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 229 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 230 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 231 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 232 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 233 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 234 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 235 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 236 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 237 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 238 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 239 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 240 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 241 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 242 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 243 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 244 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 245 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 246 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 247 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 248 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 249 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 250 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 251 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 252 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 253 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 254 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 255 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 256 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 257 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 258 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 259 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 260 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 261 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 262 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 263 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 264 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 265 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 266 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 267 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 268 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 269 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 270 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 271 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 272 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 273 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 274 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 275 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 276 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 277 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 278 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 279 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 280 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 281 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 282 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 283 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 284 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 285 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 286 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 287 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 288 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 289 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 290 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 291 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 292 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 293 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 294 | 3300042118 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 | Metagenome | Rhizosphere |
| 295 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 296 | 3300042123 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 | Metagenome | Rhizosphere |
| 297 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 298 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 299 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 300 | 3300042132 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 | Metagenome | Rhizosphere |
| 301 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 302 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 303 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 304 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 305 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 306 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 307 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 308 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 309 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 310 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 311 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 312 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 313 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 314 | 3300044666 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E | Metagenome | Unclassified |
| 315 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 316 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 317 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 318 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 331 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 332 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 333 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 334 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 335 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 336 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 337 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 338 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 339 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 340 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 341 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 342 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 343 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 344 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 345 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 346 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 347 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 348 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 349 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 350 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300049518 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control | Metagenome | Rhizosphere |
| 352 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 357 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 361 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 364 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 365 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 366 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 367 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 368 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 370 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 371 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 372 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 373 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 374 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 375 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 377 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 378 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 379 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 380 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.65 |
| Metatranscriptomes | 0.3 |
| Isolates | 3.05 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.9 |
| Nodule | 0 |
| Rhizoplane | 4.42 |
| Rhizosphere | 87.2 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.49 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_11849766 | 2162886012 | Bacteria | 1306 |
| 2 | JGI24746J21847_1012034 | 3300001977 | Bacteria | 1267 |
| 3 | JGI24747J21853_1001936 | 3300001978 | Bacteria | 1621 |
| 4 | JGI24740J21852_10046349 | 3300001979 | Bacteria | 1277 |
| 5 | JGI24739J22299_10035733 | 3300001989 | Bacteria | 1681 |
| 6 | JGI24743J22301_10012264 | 3300001991 | Bacteria | 1557 |
| 7 | JGI24745J21846_1007289 | 3300002073 | Bacteria | 1236 |
| 8 | JGI24748J21848_1008636 | 3300002074 | Bacteria | 1198 |
| 9 | JGI24738J21930_10026210 | 3300002075 | Bacteria | 1197 |
| 10 | JGI24749J21850_1037074 | 3300002076 | Bacteria | 709 |
| 11 | JGI24744J21845_10019838 | 3300002077 | Bacteria | 1328 |
| 12 | JGI24033J26618_1008189 | 3300002155 | Bacteria | 1200 |
| 13 | JGI24034J26672_10013196 | 3300002239 | Bacteria | 1253 |
| 14 | JGI24742J22300_10011464 | 3300002244 | Bacteria | 1472 |
| 15 | JGI24751J29686_10024753 | 3300002459 | Bacteria | 1245 |
| 16 | Ga0055533_1017227 | 3300003756 | Bacteria | 687 |
| 17 | Ga0065714_10282349 | 3300005288 | Unclassified | 694 |
| 18 | Ga0065712_10101423 | 3300005290 | Bacteria | 2035 |
| 19 | Ga0065715_10413210 | 3300005293 | Bacteria | 867 |
| 20 | Ga0065707_11077741 | 3300005295 | Bacteria | 520 |
| 21 | Ga0070658_10011175 | 3300005327 | Bacteria | 7196 |
| 22 | Ga0070676_10024966 | 3300005328 | Bacteria | 3373 |
| 23 | Ga0070676_10053634 | 3300005328 | Bacteria | 2375 |
| 24 | Ga0070683_100363089 | 3300005329 | Bacteria | 1379 |
| 25 | Ga0070683_100471640 | 3300005329 | Bacteria | 1198 |
| 26 | Ga0070690_100129153 | 3300005330 | Bacteria | 1705 |
| 27 | Ga0070670_100000010 | 3300005331 | Bacteria | 277365 |
| 28 | Ga0070670_100175745 | 3300005331 | Bacteria | 1858 |
| 29 | Ga0070670_100369755 | 3300005331 | Bacteria | 1262 |
| 30 | Ga0070677_10003290 | 3300005333 | Bacteria | 5203 |
| 31 | Ga0068869_100108552 | 3300005334 | Bacteria | 2108 |
| 32 | Ga0070666_10000434 | 3300005335 | Bacteria | 25623 |
| 33 | Ga0070666_10011606 | 3300005335 | Bacteria | 5534 |
| 34 | Ga0070666_11087189 | 3300005335 | Bacteria | 594 |
| 35 | Ga0070680_100130992 | 3300005336 | Bacteria | 2098 |
| 36 | Ga0070680_100515795 | 3300005336 | Bacteria | 1023 |
| 37 | Ga0070680_100665778 | 3300005336 | Bacteria | 895 |
| 38 | Ga0070680_101054829 | 3300005336 | Bacteria | 702 |
| 39 | Ga0070682_100043208 | 3300005337 | Bacteria | 2786 |
| 40 | Ga0070682_100184869 | 3300005337 | Bacteria | 1459 |
| 41 | Ga0070682_100492970 | 3300005337 | Bacteria | 948 |
| 42 | Ga0068868_100000731 | 3300005338 | Bacteria | 22214 |
| 43 | Ga0070660_100201660 | 3300005339 | Bacteria | 1614 |
| 44 | Ga0070689_100282769 | 3300005340 | Bacteria | 1376 |
| 45 | Ga0070691_10688627 | 3300005341 | Unclassified | 612 |
| 46 | Ga0070687_100138766 | 3300005343 | Bacteria | 1413 |
| 47 | Ga0070692_10038212 | 3300005345 | Bacteria | 2445 |
| 48 | Ga0070692_10145666 | 3300005345 | Bacteria | 1345 |
| 49 | Ga0070668_100184870 | 3300005347 | Bacteria | 1704 |
| 50 | Ga0070668_100313726 | 3300005347 | Bacteria | 1318 |
| 51 | Ga0070669_100002038 | 3300005353 | Bacteria | 14615 |
| 52 | Ga0070669_100002915 | 3300005353 | Bacteria | 12321 |
| 53 | Ga0070669_100159865 | 3300005353 | Bacteria | 1750 |
| 54 | Ga0070675_100000142 | 3300005354 | Bacteria | 42794 |
| 55 | Ga0070675_100212151 | 3300005354 | Bacteria | 1683 |
| 56 | Ga0070675_100552825 | 3300005354 | Bacteria | 1041 |
| 57 | Ga0070671_100019810 | 3300005355 | Bacteria | 5480 |
| 58 | Ga0070674_100062122 | 3300005356 | Bacteria | 2609 |
| 59 | Ga0070673_100044911 | 3300005364 | Bacteria | 3423 |
| 60 | Ga0070673_100151331 | 3300005364 | Bacteria | 1965 |
| 61 | Ga0070673_100788185 | 3300005364 | Bacteria | 877 |
| 62 | Ga0070688_100010706 | 3300005365 | Bacteria | 5067 |
| 63 | Ga0070688_100012276 | 3300005365 | Bacteria | 4795 |
| 64 | Ga0070688_100229611 | 3300005365 | Bacteria | 1312 |
| 65 | Ga0070659_100118073 | 3300005366 | Bacteria | 2145 |
| 66 | Ga0070667_100000097 | 3300005367 | Bacteria | 108709 |
| 67 | Ga0070667_100050742 | 3300005367 | Bacteria | 3497 |
| 68 | Ga0070667_100218224 | 3300005367 | Bacteria | 1697 |
| 69 | Ga0070667_102233172 | 3300005367 | Bacteria | 515 |
| 70 | Ga0070709_10160141 | 3300005434 | Bacteria | 1564 |
| 71 | Ga0070709_10206878 | 3300005434 | Bacteria | 1393 |
| 72 | Ga0070709_10779002 | 3300005434 | Unclassified | 749 |
| 73 | Ga0070714_100365933 | 3300005435 | Bacteria | 1357 |
| 74 | Ga0070713_100122073 | 3300005436 | Bacteria | 2286 |
| 75 | Ga0070710_10804279 | 3300005437 | Bacteria | 672 |
| 76 | Ga0070701_10076196 | 3300005438 | Bacteria | 1805 |
| 77 | Ga0070701_10128378 | 3300005438 | Bacteria | 1438 |
| 78 | Ga0070711_100219576 | 3300005439 | Bacteria | 1477 |
| 79 | Ga0070711_101158306 | 3300005439 | Bacteria | 668 |
| 80 | Ga0070711_101413076 | 3300005439 | Bacteria | 606 |
| 81 | Ga0070705_100205971 | 3300005440 | Bacteria | 1352 |
| 82 | Ga0070705_100828802 | 3300005440 | Bacteria | 738 |
| 83 | Ga0070705_101417797 | 3300005440 | Unclassified | 579 |
| 84 | Ga0070700_100184620 | 3300005441 | Bacteria | 1454 |
| 85 | Ga0070700_100763939 | 3300005441 | Unclassified | 775 |
| 86 | Ga0070700_100877569 | 3300005441 | Unclassified | 729 |
| 87 | Ga0070700_101529816 | 3300005441 | Bacteria | 568 |
| 88 | Ga0070708_101984769 | 3300005445 | Bacteria | 539 |
| 89 | Ga0070663_100251970 | 3300005455 | Bacteria | 1398 |
| 90 | Ga0070663_102123513 | 3300005455 | Bacteria | 506 |
| 91 | Ga0070678_101700295 | 3300005456 | Bacteria | 594 |
| 92 | Ga0070662_100024933 | 3300005457 | Bacteria | 4126 |
| 93 | Ga0070662_100041269 | 3300005457 | Bacteria | 3291 |
| 94 | Ga0070662_100118793 | 3300005457 | Bacteria | 2024 |
| 95 | Ga0070681_10076514 | 3300005458 | Bacteria | 3305 |
| 96 | Ga0070681_10168578 | 3300005458 | Bacteria | 2112 |
| 97 | Ga0070681_10409272 | 3300005458 | Bacteria | 1268 |
| 98 | Ga0068867_100034065 | 3300005459 | Bacteria | 3690 |
| 99 | Ga0068867_100090977 | 3300005459 | Bacteria | 2316 |
| 100 | Ga0070685_10047439 | 3300005466 | Bacteria | 2470 |
| 101 | Ga0070685_10085500 | 3300005466 | Bacteria | 1899 |
| 102 | Ga0070707_100026204 | 3300005468 | Bacteria | 5534 |
| 103 | Ga0070707_100527412 | 3300005468 | Bacteria | 1143 |
| 104 | Ga0070699_100134760 | 3300005518 | Bacteria | 2178 |
| 105 | Ga0070679_100181000 | 3300005530 | Bacteria | 2080 |
| 106 | Ga0070679_100313991 | 3300005530 | Bacteria | 1517 |
| 107 | Ga0070679_100394557 | 3300005530 | Bacteria | 1330 |
| 108 | Ga0070679_100908781 | 3300005530 | Bacteria | 824 |
| 109 | Ga0070679_101070131 | 3300005530 | Bacteria | 751 |
| 110 | Ga0070679_101784948 | 3300005530 | Unclassified | 563 |
| 111 | Ga0070684_100024686 | 3300005535 | Bacteria | 5044 |
| 112 | Ga0070684_100036551 | 3300005535 | Bacteria | 4209 |
| 113 | Ga0070697_101402457 | 3300005536 | Bacteria | 624 |
| 114 | Ga0068853_100116075 | 3300005539 | Bacteria | 2383 |
| 115 | Ga0068853_100339661 | 3300005539 | Bacteria | 1395 |
| 116 | Ga0068853_101703639 | 3300005539 | Bacteria | 611 |
| 117 | Ga0070672_100041348 | 3300005543 | Bacteria | 3544 |
| 118 | Ga0070672_100073389 | 3300005543 | Bacteria | 2727 |
| 119 | Ga0070672_100305222 | 3300005543 | Bacteria | 1350 |
| 120 | Ga0070672_100443799 | 3300005543 | Bacteria | 1117 |
| 121 | Ga0070686_100135885 | 3300005544 | Bacteria | 1706 |
| 122 | Ga0070695_100015005 | 3300005545 | Bacteria | 4674 |
| 123 | Ga0070696_100176715 | 3300005546 | Bacteria | 1582 |
| 124 | Ga0070693_100105002 | 3300005547 | Bacteria | 1728 |
| 125 | Ga0070665_100005670 | 3300005548 | Bacteria | 12828 |
| 126 | Ga0070665_100091241 | 3300005548 | Bacteria | 3052 |
| 127 | Ga0070665_100136817 | 3300005548 | Bacteria | 2453 |
| 128 | Ga0070665_101096807 | 3300005548 | Unclassified | 807 |
| 129 | Ga0070704_100363268 | 3300005549 | Bacteria | 1225 |
| 130 | Ga0068855_101858695 | 3300005563 | Bacteria | 611 |
| 131 | Ga0068855_101869259 | 3300005563 | Bacteria | 609 |
| 132 | Ga0070664_100514145 | 3300005564 | Bacteria | 1105 |
| 133 | Ga0070664_100622503 | 3300005564 | Bacteria | 1002 |
| 134 | Ga0070664_100812819 | 3300005564 | Bacteria | 874 |
| 135 | Ga0068857_100007610 | 3300005577 | Bacteria | 9326 |
| 136 | Ga0068857_101194007 | 3300005577 | Bacteria | 736 |
| 137 | Ga0068854_100002758 | 3300005578 | Bacteria | 10913 |
| 138 | Ga0068856_100353191 | 3300005614 | Bacteria | 1489 |
| 139 | Ga0070702_100142920 | 3300005615 | Bacteria | 1526 |
| 140 | Ga0068852_100000390 | 3300005616 | Bacteria | 29418 |
| 141 | Ga0068852_100144743 | 3300005616 | Bacteria | 2203 |
| 142 | Ga0068852_101965584 | 3300005616 | Bacteria | 607 |
| 143 | Ga0068859_100009767 | 3300005617 | Bacteria | 9693 |
| 144 | Ga0068859_101118292 | 3300005617 | Bacteria | 867 |
| 145 | Ga0068864_100000018 | 3300005618 | Bacteria | 277365 |
| 146 | Ga0068864_100048810 | 3300005618 | Bacteria | 3640 |
| 147 | Ga0068864_100397299 | 3300005618 | Bacteria | 1309 |
| 148 | Ga0068866_10051387 | 3300005718 | Bacteria | 2098 |
| 149 | Ga0068866_10084613 | 3300005718 | Bacteria | 1712 |
| 150 | Ga0068861_100022724 | 3300005719 | Bacteria | 4522 |
| 151 | Ga0068861_100286840 | 3300005719 | Bacteria | 1420 |
| 152 | Ga0068851_10001331 | 3300005834 | Bacteria | 10772 |
| 153 | Ga0068870_10060086 | 3300005840 | Bacteria | 2039 |
| 154 | Ga0068870_10359582 | 3300005840 | Bacteria | 936 |
| 155 | Ga0068870_11378852 | 3300005840 | Bacteria | 516 |
| 156 | Ga0068863_100002082 | 3300005841 | Bacteria | 19834 |
| 157 | Ga0068863_100097946 | 3300005841 | Bacteria | 2785 |
| 158 | Ga0068858_100151649 | 3300005842 | Bacteria | 2180 |
| 159 | Ga0068858_100385123 | 3300005842 | Bacteria | 1346 |
| 160 | Ga0068860_100003543 | 3300005843 | Bacteria | 16050 |
| 161 | Ga0068860_100178134 | 3300005843 | Bacteria | 2055 |
| 162 | Ga0068860_100330205 | 3300005843 | Bacteria | 1498 |
| 163 | Ga0068860_102492938 | 3300005843 | Bacteria | 537 |
| 164 | Ga0068862_100004380 | 3300005844 | Bacteria | 11937 |
| 165 | Ga0068862_100231919 | 3300005844 | Bacteria | 1675 |
| 166 | Ga0068862_100872813 | 3300005844 | Bacteria | 883 |
| 167 | Ga0070717_10253701 | 3300006028 | Bacteria | 1554 |
| 168 | Ga0070717_10341510 | 3300006028 | Bacteria | 1337 |
| 169 | Ga0075368_10332263 | 3300006042 | Bacteria | 659 |
| 170 | Ga0075363_100231647 | 3300006048 | Bacteria | 1060 |
| 171 | Ga0075364_10367375 | 3300006051 | Bacteria | 981 |
| 172 | Ga0070715_10061693 | 3300006163 | Bacteria | 1647 |
| 173 | Ga0070716_100066647 | 3300006173 | Bacteria | 2101 |
| 174 | Ga0070716_100205481 | 3300006173 | Bacteria | 1312 |
| 175 | Ga0070716_101706110 | 3300006173 | Bacteria | 520 |
| 176 | Ga0070712_100274656 | 3300006175 | Bacteria | 1355 |
| 177 | Ga0075362_10103645 | 3300006177 | Bacteria | 1333 |
| 178 | Ga0075366_10683065 | 3300006195 | Bacteria | 637 |
| 179 | Ga0097621_100038659 | 3300006237 | Bacteria | 3829 |
| 180 | Ga0097621_100347654 | 3300006237 | Bacteria | 1318 |
| 181 | Ga0075370_10077901 | 3300006353 | Bacteria | 1902 |
| 182 | Ga0068871_100216856 | 3300006358 | Bacteria | 1657 |
| 183 | Ga0068871_100622070 | 3300006358 | Bacteria | 983 |
| 184 | Ga0068871_100652196 | 3300006358 | Bacteria | 961 |
| 185 | Ga0075428_100349982 | 3300006844 | Bacteria | 1586 |
| 186 | Ga0075430_100863159 | 3300006846 | Bacteria | 746 |
| 187 | Ga0075431_100324902 | 3300006847 | Bacteria | 1551 |
| 188 | Ga0075431_100329994 | 3300006847 | Bacteria | 1537 |
| 189 | Ga0075431_100342644 | 3300006847 | Bacteria | 1504 |
| 190 | Ga0075431_100727463 | 3300006847 | Unclassified | 969 |
| 191 | Ga0075434_100808817 | 3300006871 | Unclassified | 953 |
| 192 | Ga0075429_100512718 | 3300006880 | Bacteria | 1051 |
| 193 | Ga0075429_100891170 | 3300006880 | Bacteria | 779 |
| 194 | Ga0068865_100081315 | 3300006881 | Bacteria | 2326 |
| 195 | Ga0068865_100090907 | 3300006881 | Bacteria | 2214 |
| 196 | Ga0068865_100098387 | 3300006881 | Bacteria | 2137 |
| 197 | Ga0068865_100330919 | 3300006881 | Bacteria | 1228 |
| 198 | Ga0068865_101732024 | 3300006881 | Bacteria | 564 |
| 199 | Ga0075436_100786413 | 3300006914 | Unclassified | 708 |
| 200 | Ga0097620_100009767 | 3300006931 | Bacteria | 9693 |
| 201 | Ga0097620_101118344 | 3300006931 | Bacteria | 867 |
| 202 | Ga0105251_10092339 | 3300009011 | Bacteria | 1390 |
| 203 | Ga0105250_10030949 | 3300009092 | Bacteria | 2150 |
| 204 | Ga0105240_10503692 | 3300009093 | Bacteria | 1346 |
| 205 | Ga0105240_10577848 | 3300009093 | Bacteria | 1240 |
| 206 | Ga0105240_11136983 | 3300009093 | Unclassified | 829 |
| 207 | Ga0105240_12045208 | 3300009093 | Bacteria | 595 |
| 208 | Ga0105240_12172052 | 3300009093 | Bacteria | 576 |
| 209 | Ga0105240_12274941 | 3300009093 | Bacteria | 562 |
| 210 | Ga0105240_12647593 | 3300009093 | Bacteria | 518 |
| 211 | Ga0111539_10008259 | 3300009094 | Bacteria | 13248 |
| 212 | Ga0111539_10279094 | 3300009094 | Bacteria | 1944 |
| 213 | Ga0111539_10605512 | 3300009094 | Bacteria | 1276 |
| 214 | Ga0105245_10161996 | 3300009098 | Bacteria | 2123 |
| 215 | Ga0105247_10102313 | 3300009101 | Bacteria | 1833 |
| 216 | Ga0114129_10579642 | 3300009147 | Bacteria | 1456 |
| 217 | Ga0114129_12221022 | 3300009147 | Bacteria | 660 |
| 218 | Ga0105243_10325167 | 3300009148 | Bacteria | 1403 |
| 219 | Ga0105241_10145570 | 3300009174 | Bacteria | 1933 |
| 220 | Ga0105242_10144840 | 3300009176 | Bacteria | 2066 |
| 221 | Ga0105242_11413531 | 3300009176 | Bacteria | 724 |
| 222 | Ga0105242_12698931 | 3300009176 | Bacteria | 546 |
| 223 | Ga0105248_10239439 | 3300009177 | Bacteria | 2043 |
| 224 | Ga0105248_10895465 | 3300009177 | Bacteria | 1002 |
| 225 | Ga0105248_11306607 | 3300009177 | Bacteria | 820 |
| 226 | Ga0105237_10343161 | 3300009545 | Bacteria | 1498 |
| 227 | Ga0105237_10750018 | 3300009545 | Bacteria | 983 |
| 228 | Ga0105238_10116238 | 3300009551 | Bacteria | 2654 |
| 229 | Ga0105238_12232222 | 3300009551 | Bacteria | 582 |
| 230 | Ga0105238_12305025 | 3300009551 | Unclassified | 574 |
| 231 | Ga0105249_10038858 | 3300009553 | Bacteria | 4319 |
| 232 | Ga0105249_10063817 | 3300009553 | Bacteria | 3385 |
| 233 | Ga0105249_10142525 | 3300009553 | Bacteria | 2299 |
| 234 | Ga0105249_10385844 | 3300009553 | Bacteria | 1428 |
| 235 | Ga0105249_10395845 | 3300009553 | Bacteria | 1410 |
| 236 | Ga0105249_10937330 | 3300009553 | Unclassified | 933 |
| 237 | Ga0105249_11257901 | 3300009553 | Bacteria | 811 |
| 238 | Ga0105249_13086240 | 3300009553 | Unclassified | 535 |
| 239 | Ga0105239_10336874 | 3300010375 | Bacteria | 1702 |
| 240 | Ga0105239_11861970 | 3300010375 | Bacteria | 698 |
| 241 | Ga0105246_10133936 | 3300011119 | Bacteria | 1855 |
| 242 | Ga0105246_10533862 | 3300011119 | Bacteria | 1002 |
| 243 | Ga0157373_10192442 | 3300013100 | Bacteria | 1437 |
| 244 | Ga0157371_10074708 | 3300013102 | Bacteria | 2400 |
| 245 | Ga0157371_11303649 | 3300013102 | Bacteria | 562 |
| 246 | Ga0157370_10285225 | 3300013104 | Bacteria | 1525 |
| 247 | Ga0157369_10221635 | 3300013105 | Bacteria | 1980 |
| 248 | Ga0157369_10869832 | 3300013105 | Bacteria | 925 |
| 249 | Ga0157374_10565252 | 3300013296 | Bacteria | 1146 |
| 250 | Ga0157374_11660815 | 3300013296 | Bacteria | 663 |
| 251 | Ga0157378_10717409 | 3300013297 | Bacteria | 1020 |
| 252 | Ga0163162_10270546 | 3300013306 | Bacteria | 1831 |
| 253 | Ga0163162_10581771 | 3300013306 | Bacteria | 1246 |
| 254 | Ga0157372_10204993 | 3300013307 | Bacteria | 2285 |
| 255 | Ga0157372_10551976 | 3300013307 | Bacteria | 1343 |
| 256 | Ga0157375_10006008 | 3300013308 | Bacteria | 10585 |
| 257 | Ga0157375_10312321 | 3300013308 | Bacteria | 1736 |
| 258 | Ga0157375_10477632 | 3300013308 | Unclassified | 1412 |
| 259 | Ga0163163_10000406 | 3300014325 | Bacteria | 40553 |
| 260 | Ga0163163_10338488 | 3300014325 | Bacteria | 1560 |
| 261 | Ga0157380_10019022 | 3300014326 | Bacteria | 5112 |
| 262 | Ga0157380_10036617 | 3300014326 | Bacteria | 3798 |
| 263 | Ga0157380_12553008 | 3300014326 | Bacteria | 577 |
| 264 | Ga0157377_10043578 | 3300014745 | Bacteria | 2497 |
| 265 | Ga0157377_10112358 | 3300014745 | Bacteria | 1639 |
| 266 | Ga0157379_10329618 | 3300014968 | Bacteria | 1395 |
| 267 | Ga0157379_11104537 | 3300014968 | Bacteria | 760 |
| 268 | Ga0157376_10522663 | 3300014969 | Bacteria | 1170 |
| 269 | Ga0157376_11785518 | 3300014969 | Bacteria | 651 |
| 270 | Ga0163161_10039200 | 3300017792 | Bacteria | 3400 |
| 271 | Ga0163161_10687162 | 3300017792 | Bacteria | 851 |
| 272 | Ga0213872_10031527 | 3300021361 | Bacteria | 2430 |
| 273 | Ga0213872_10105601 | 3300021361 | Bacteria | 1253 |
| 274 | Ga0209674_104538 | 3300025226 | Bacteria | 2236 |
| 275 | Ga0207666_1010630 | 3300025271 | Bacteria | 1262 |
| 276 | Ga0207673_1023442 | 3300025290 | Bacteria | 841 |
| 277 | Ga0207697_10033671 | 3300025315 | Bacteria | 2096 |
| 278 | Ga0207656_10000974 | 3300025321 | Bacteria | 9361 |
| 279 | Ga0207696_1054661 | 3300025711 | Bacteria | 1134 |
| 280 | Ga0207682_10034601 | 3300025893 | Bacteria | 2037 |
| 281 | Ga0207642_10077169 | 3300025899 | Bacteria | 1606 |
| 282 | Ga0207710_10127708 | 3300025900 | Bacteria | 1219 |
| 283 | Ga0207688_10054351 | 3300025901 | Bacteria | 2246 |
| 284 | Ga0207680_10000744 | 3300025903 | Bacteria | 15347 |
| 285 | Ga0207680_10414496 | 3300025903 | Bacteria | 953 |
| 286 | Ga0207647_10529384 | 3300025904 | Unclassified | 655 |
| 287 | Ga0207699_10232057 | 3300025906 | Bacteria | 1264 |
| 288 | Ga0207699_11046716 | 3300025906 | Unclassified | 604 |
| 289 | Ga0207699_11272298 | 3300025906 | Bacteria | 544 |
| 290 | Ga0207645_10012221 | 3300025907 | Bacteria | 5832 |
| 291 | Ga0207645_10041219 | 3300025907 | Bacteria | 2956 |
| 292 | Ga0207645_10084104 | 3300025907 | Bacteria | 2042 |
| 293 | Ga0207643_10001596 | 3300025908 | Bacteria | 12810 |
| 294 | Ga0207643_10040194 | 3300025908 | Bacteria | 2633 |
| 295 | Ga0207643_10165129 | 3300025908 | Bacteria | 1333 |
| 296 | Ga0207705_10179674 | 3300025909 | Bacteria | 1596 |
| 297 | Ga0207654_10862344 | 3300025911 | Bacteria | 656 |
| 298 | Ga0207707_10143691 | 3300025912 | Bacteria | 2086 |
| 299 | Ga0207707_10332503 | 3300025912 | Bacteria | 1311 |
| 300 | Ga0207707_10447903 | 3300025912 | Bacteria | 1105 |
| 301 | Ga0207707_10648020 | 3300025912 | Bacteria | 890 |
| 302 | Ga0207695_10322031 | 3300025913 | Bacteria | 1435 |
| 303 | Ga0207695_10569569 | 3300025913 | Bacteria | 1014 |
| 304 | Ga0207671_10650082 | 3300025914 | Bacteria | 840 |
| 305 | Ga0207693_10119618 | 3300025915 | Bacteria | 2069 |
| 306 | Ga0207663_10142731 | 3300025916 | Bacteria | 1670 |
| 307 | Ga0207663_11185323 | 3300025916 | Bacteria | 615 |
| 308 | Ga0207660_10125550 | 3300025917 | Bacteria | 1948 |
| 309 | Ga0207660_10428307 | 3300025917 | Bacteria | 1068 |
| 310 | Ga0207660_11002839 | 3300025917 | Bacteria | 681 |
| 311 | Ga0207662_10172834 | 3300025918 | Bacteria | 1386 |
| 312 | Ga0207662_10210351 | 3300025918 | Bacteria | 1262 |
| 313 | Ga0207657_10377300 | 3300025919 | Bacteria | 1117 |
| 314 | Ga0207657_11331657 | 3300025919 | Bacteria | 541 |
| 315 | Ga0207649_10400231 | 3300025920 | Bacteria | 1027 |
| 316 | Ga0207649_11272493 | 3300025920 | Unclassified | 582 |
| 317 | Ga0207649_11307832 | 3300025920 | Bacteria | 573 |
| 318 | Ga0207652_10344965 | 3300025921 | Bacteria | 1344 |
| 319 | Ga0207652_11047410 | 3300025921 | Bacteria | 715 |
| 320 | Ga0207652_11197130 | 3300025921 | Unclassified | 661 |
| 321 | Ga0207646_10006034 | 3300025922 | Bacteria | 12625 |
| 322 | Ga0207646_10579686 | 3300025922 | Bacteria | 1008 |
| 323 | Ga0207681_10015134 | 3300025923 | Bacteria | 4810 |
| 324 | Ga0207681_10767050 | 3300025923 | Bacteria | 804 |
| 325 | Ga0207694_10192021 | 3300025924 | Bacteria | 1659 |
| 326 | Ga0207694_10588549 | 3300025924 | Bacteria | 935 |
| 327 | Ga0207694_11079161 | 3300025924 | Unclassified | 679 |
| 328 | Ga0207650_10000003 | 3300025925 | Bacteria | 1123235 |
| 329 | Ga0207650_10056652 | 3300025925 | Bacteria | 2913 |
| 330 | Ga0207650_10571782 | 3300025925 | Bacteria | 949 |
| 331 | Ga0207650_11452596 | 3300025925 | Bacteria | 583 |
| 332 | Ga0207659_10003121 | 3300025926 | Bacteria | 9902 |
| 333 | Ga0207659_10004672 | 3300025926 | Bacteria | 8295 |
| 334 | Ga0207687_10134191 | 3300025927 | Bacteria | 1870 |
| 335 | Ga0207700_10219163 | 3300025928 | Bacteria | 1612 |
| 336 | Ga0207664_10624271 | 3300025929 | Bacteria | 968 |
| 337 | Ga0207644_10000418 | 3300025931 | Bacteria | 27576 |
| 338 | Ga0207690_10060175 | 3300025932 | Bacteria | 2576 |
| 339 | Ga0207706_10029593 | 3300025933 | Bacteria | 4888 |
| 340 | Ga0207706_10054855 | 3300025933 | Bacteria | 3516 |
| 341 | Ga0207706_10191182 | 3300025933 | Bacteria | 1797 |
| 342 | Ga0207686_10285395 | 3300025934 | Bacteria | 1220 |
| 343 | Ga0207709_10103479 | 3300025935 | Bacteria | 1887 |
| 344 | Ga0207670_11421197 | 3300025936 | Unclassified | 589 |
| 345 | Ga0207669_10024719 | 3300025937 | Bacteria | 3233 |
| 346 | Ga0207704_10177715 | 3300025938 | Bacteria | 1534 |
| 347 | Ga0207704_10204778 | 3300025938 | Bacteria | 1447 |
| 348 | Ga0207704_10856027 | 3300025938 | Bacteria | 762 |
| 349 | Ga0207665_10119914 | 3300025939 | Bacteria | 1857 |
| 350 | Ga0207665_10346763 | 3300025939 | Bacteria | 1120 |
| 351 | Ga0207665_10751261 | 3300025939 | Bacteria | 769 |
| 352 | Ga0207691_10065733 | 3300025940 | Bacteria | 3281 |
| 353 | Ga0207691_10105734 | 3300025940 | Bacteria | 2507 |
| 354 | Ga0207691_10156887 | 3300025940 | Bacteria | 1998 |
| 355 | Ga0207691_10439969 | 3300025940 | Bacteria | 1110 |
| 356 | Ga0207691_10467883 | 3300025940 | Unclassified | 1072 |
| 357 | Ga0207711_10306598 | 3300025941 | Bacteria | 1465 |
| 358 | Ga0207711_10370582 | 3300025941 | Unclassified | 1328 |
| 359 | Ga0207711_10970237 | 3300025941 | Bacteria | 789 |
| 360 | Ga0207689_10056670 | 3300025942 | Bacteria | 3225 |
| 361 | Ga0207689_10542085 | 3300025942 | Bacteria | 977 |
| 362 | Ga0207661_10024178 | 3300025944 | Bacteria | 4600 |
| 363 | Ga0207661_10815919 | 3300025944 | Bacteria | 859 |
| 364 | Ga0207679_10322145 | 3300025945 | Bacteria | 1339 |
| 365 | Ga0207679_10376087 | 3300025945 | Bacteria | 1244 |
| 366 | Ga0207667_10555515 | 3300025949 | Bacteria | 1161 |
| 367 | Ga0207651_10001418 | 3300025960 | Bacteria | 10896 |
| 368 | Ga0207651_10566421 | 3300025960 | Bacteria | 989 |
| 369 | Ga0207651_10783398 | 3300025960 | Bacteria | 844 |
| 370 | Ga0207712_10113615 | 3300025961 | Bacteria | 2035 |
| 371 | Ga0207712_10370020 | 3300025961 | Bacteria | 1196 |
| 372 | Ga0207712_10834588 | 3300025961 | Bacteria | 812 |
| 373 | Ga0207712_10894689 | 3300025961 | Bacteria | 784 |
| 374 | Ga0207668_10065856 | 3300025972 | Bacteria | 2566 |
| 375 | Ga0207668_10375320 | 3300025972 | Bacteria | 1195 |
| 376 | Ga0207640_10002548 | 3300025981 | Bacteria | 9773 |
| 377 | Ga0207658_10000007 | 3300025986 | Bacteria | 329651 |
| 378 | Ga0207658_10396196 | 3300025986 | Bacteria | 1212 |
| 379 | Ga0207677_10253214 | 3300026023 | Bacteria | 1431 |
| 380 | Ga0207703_10095406 | 3300026035 | Bacteria | 2509 |
| 381 | Ga0207703_11032360 | 3300026035 | Bacteria | 789 |
| 382 | Ga0207639_10109338 | 3300026041 | Bacteria | 2249 |
| 383 | Ga0207639_11817955 | 3300026041 | Bacteria | 570 |
| 384 | Ga0207678_10103686 | 3300026067 | Bacteria | 2428 |
| 385 | Ga0207708_10348805 | 3300026075 | Unclassified | 1214 |
| 386 | Ga0207702_10423557 | 3300026078 | Bacteria | 1288 |
| 387 | Ga0207702_10984777 | 3300026078 | Bacteria | 836 |
| 388 | Ga0207702_11689315 | 3300026078 | Unclassified | 626 |
| 389 | Ga0207641_10001670 | 3300026088 | Bacteria | 21581 |
| 390 | Ga0207641_10077683 | 3300026088 | Bacteria | 2873 |
| 391 | Ga0207648_10017451 | 3300026089 | Bacteria | 6530 |
| 392 | Ga0207648_10036740 | 3300026089 | Bacteria | 4316 |
| 393 | Ga0207676_10000003 | 3300026095 | Bacteria | 1123235 |
| 394 | Ga0207676_10302644 | 3300026095 | Bacteria | 1460 |
| 395 | Ga0207674_10728386 | 3300026116 | Bacteria | 957 |
| 396 | Ga0207674_11169880 | 3300026116 | Unclassified | 739 |
| 397 | Ga0207675_100012950 | 3300026118 | Bacteria | 7789 |
| 398 | Ga0207675_100345890 | 3300026118 | Bacteria | 1456 |
| 399 | Ga0207683_10002093 | 3300026121 | Bacteria | 17577 |
| 400 | Ga0207683_10062230 | 3300026121 | Bacteria | 3287 |
| 401 | Ga0207683_10953062 | 3300026121 | Bacteria | 797 |
| 402 | Ga0207683_11615368 | 3300026121 | Bacteria | 597 |
| 403 | Ga0207698_10128210 | 3300026142 | Bacteria | 2162 |
| 404 | Ga0207698_10273890 | 3300026142 | Bacteria | 1557 |
| 405 | Ga0209973_1016096 | 3300027252 | Bacteria | 950 |
| 406 | Ga0209982_1001027 | 3300027552 | Bacteria | 3711 |
| 407 | Ga0210002_1002097 | 3300027617 | Bacteria | 2878 |
| 408 | Ga0209966_1055626 | 3300027695 | Bacteria | 848 |
| 409 | Ga0209966_1142412 | 3300027695 | Bacteria | 556 |
| 410 | Ga0209998_10004632 | 3300027717 | Bacteria | 2914 |
| 411 | Ga0209998_10067297 | 3300027717 | Bacteria | 852 |
| 412 | Ga0209813_10319353 | 3300027866 | Bacteria | 608 |
| 413 | Ga0209974_10027166 | 3300027876 | Bacteria | 1893 |
| 414 | Ga0207428_10002309 | 3300027907 | Bacteria | 19095 |
| 415 | Ga0268266_10001450 | 3300028379 | Bacteria | 28199 |
| 416 | Ga0268266_10457039 | 3300028379 | Bacteria | 1214 |
| 417 | Ga0268266_10852897 | 3300028379 | Bacteria | 880 |
| 418 | Ga0268266_11663248 | 3300028379 | Bacteria | 614 |
| 419 | Ga0268265_10020118 | 3300028380 | Bacteria | 4654 |
| 420 | Ga0268265_10293369 | 3300028380 | Bacteria | 1461 |
| 421 | Ga0268265_10784502 | 3300028380 | Bacteria | 927 |
| 422 | Ga0268265_10871457 | 3300028380 | Bacteria | 882 |
| 423 | Ga0268264_10010705 | 3300028381 | Bacteria | 7576 |
| 424 | Ga0268264_10463759 | 3300028381 | Bacteria | 1229 |
| 425 | Ga0268264_11167430 | 3300028381 | Bacteria | 779 |
| 426 | Ga0268264_12245970 | 3300028381 | Bacteria | 553 |
| 427 | Ga0268264_12364174 | 3300028381 | Bacteria | 538 |
| 428 | Ga0265334_10005070 | 3300028573 | Bacteria | 5776 |
| 429 | Ga0265770_1011649 | 3300030878 | Bacteria | 1292 |
| 430 | Ga0265760_10035618 | 3300031090 | Bacteria | 1474 |
| 431 | Ga0265320_10188426 | 3300031240 | Bacteria | 923 |
| 432 | Ga0265331_10318015 | 3300031250 | Bacteria | 697 |
| 433 | Ga0265316_10726650 | 3300031344 | Bacteria | 699 |
| 434 | Ga0307509_10003642 | 3300031507 | Bacteria | 23084 |
| 435 | Ga0307509_10140810 | 3300031507 | Bacteria | 2348 |
| 436 | Ga0307408_100265336 | 3300031548 | Unclassified | 1423 |
| 437 | Ga0307408_101645007 | 3300031548 | Bacteria | 611 |
| 438 | Ga0307508_10385855 | 3300031616 | Bacteria | 992 |
| 439 | Ga0307508_10556787 | 3300031616 | Bacteria | 745 |
| 440 | Ga0316579_10119057 | 3300031691 | Bacteria | 1268 |
| 441 | Ga0316579_10244750 | 3300031691 | Bacteria | 867 |
| 442 | Ga0316576_10231338 | 3300031727 | Bacteria | 1390 |
| 443 | Ga0316576_10242936 | 3300031727 | Bacteria | 1352 |
| 444 | Ga0316578_10129092 | 3300031728 | Bacteria | 1520 |
| 445 | Ga0316578_10597301 | 3300031728 | Bacteria | 647 |
| 446 | Ga0316578_10930557 | 3300031728 | Bacteria | 501 |
| 447 | Ga0307405_10499898 | 3300031731 | Unclassified | 974 |
| 448 | Ga0316577_10016985 | 3300031733 | Bacteria | 4016 |
| 449 | Ga0307413_10776593 | 3300031824 | Bacteria | 803 |
| 450 | Ga0307407_10176144 | 3300031903 | Bacteria | 1413 |
| 451 | Ga0307412_11379192 | 3300031911 | Bacteria | 637 |
| 452 | Ga0307416_100941439 | 3300032002 | Unclassified | 965 |
| 453 | Ga0307416_101151637 | 3300032002 | Bacteria | 881 |
| 454 | Ga0307416_102706938 | 3300032002 | Bacteria | 593 |
| 455 | Ga0307414_12105431 | 3300032004 | Bacteria | 527 |
| 456 | Ga0307411_10152781 | 3300032005 | Bacteria | 1718 |
| 457 | Ga0307411_10540202 | 3300032005 | Bacteria | 993 |
| 458 | Ga0307415_100188462 | 3300032126 | Unclassified | 1625 |
| 459 | Ga0307415_100798326 | 3300032126 | Bacteria | 861 |
| 460 | Ga0307415_101549627 | 3300032126 | Bacteria | 635 |
| 461 | Ga0316585_10011187 | 3300032137 | Bacteria | 2642 |
| 462 | Ga0316580_10043601 | 3300032139 | Bacteria | 1384 |
| 463 | Ga0373944_0057126 | 3300035089 | Bacteria | 1243 |
| 464 | Ga0373951_0130023 | 3300035091 | Bacteria | 692 |
| 465 | Ga0373936_0125949 | 3300035113 | Bacteria | 1098 |
| 466 | Ga0373941_0190214 | 3300035115 | Bacteria | 775 |
| 467 | Ga0373945_0049408 | 3300035116 | Bacteria | 1543 |
| 468 | Ga0373943_0132876 | 3300035170 | Bacteria | 1333 |
| 469 | Ga0373955_0811996 | 3300035172 | Bacteria | 575 |
| 470 | Ga0373961_0231631 | 3300035241 | Bacteria | 662 |
| 471 | Ga0316574_0105059 | 3300035398 | Bacteria | 1809 |
| 472 | Ga0316574_0137169 | 3300035398 | Bacteria | 1575 |
| 473 | Ga0316574_0223937 | 3300035398 | Bacteria | 1205 |
| 474 | Ga0373931_0124858 | 3300035691 | Bacteria | 1475 |
| 475 | Ga0373935_0250511 | 3300035692 | Bacteria | 1239 |
| 476 | Ga0373927_0121099 | 3300035695 | Bacteria | 1707 |
| 477 | Ga0373947_0139014 | 3300035725 | Bacteria | 1556 |
| 478 | Ga0316582_0224958 | 3300036647 | Bacteria | 1283 |
| 479 | Ga0316582_0922937 | 3300036647 | Bacteria | 597 |
| 480 | Ga0316582_1067784 | 3300036647 | Bacteria | 551 |
| 481 | Ga0316584_0205954 | 3300036712 | Bacteria | 1450 |
| 482 | Ga0316584_0258095 | 3300036712 | Bacteria | 1271 |
| 483 | Ga0316584_0375225 | 3300036712 | Bacteria | 1017 |
| 484 | Ga0373925_0644977 | 3300037068 | Bacteria | 872 |
| 485 | Ga0395899_0220296 | 3300037312 | Bacteria | 1315 |
| 486 | Ga0395900_1774263 | 3300037418 | Bacteria | 528 |
| 487 | Ga0395898_0198512 | 3300037466 | Bacteria | 1916 |
| 488 | Ga0316581_0094564 | 3300037588 | Bacteria | 920 |
| 489 | Ga0436360_0817650 | 3300039438 | Bacteria | 688 |
| 490 | Ga0436361_0147800 | 3300039447 | Bacteria | 1205 |
| 491 | Ga0436361_0519472 | 3300039447 | Bacteria | 4103 |
| 492 | Ga0436361_0765718 | 3300039447 | Bacteria | 1013 |
| 493 | Ga0436361_1008104 | 3300039447 | Bacteria | 1467 |
| 494 | Ga0439447_036003 | 3300041407 | Bacteria | 1224 |
| 495 | Ga0439465_0057306 | 3300041413 | Bacteria | 1285 |
| 496 | Ga0451789_0630838 | 3300041443 | Bacteria | 1640 |
| 497 | Ga0451793_0316792 | 3300041452 | Bacteria | 1210 |
| 498 | Ga0451795_1495749 | 3300041456 | Unclassified | 808 |
| 499 | Ga0451798_0317467 | 3300041458 | Bacteria | 1261 |
| 500 | Ga0451800_1612496 | 3300041459 | Bacteria | 1672 |
| 501 | Ga0451802_0332722 | 3300041460 | Bacteria | 1108 |
| 502 | Ga0451804_0634357 | 3300041463 | Unclassified | 583 |
| 503 | Ga0451807_0915961 | 3300041486 | Bacteria | 3266 |
| 504 | Ga0451833_1092509 | 3300041491 | Bacteria | 1680 |
| 505 | Ga0451833_1477764 | 3300041491 | Bacteria | 531 |
| 506 | Ga0451835_0175095 | 3300041492 | Unclassified | 737 |
| 507 | Ga0451835_0580138 | 3300041492 | Bacteria | 1949 |
| 508 | Ga0451839_1509357 | 3300041496 | Bacteria | 534 |
| 509 | Ga0451839_1586213 | 3300041496 | Bacteria | 1214 |
| 510 | Ga0451841_0268182 | 3300041498 | Bacteria | 1765 |
| 511 | Ga0451841_0396150 | 3300041498 | Bacteria | 1175 |
| 512 | Ga0451845_0350209 | 3300041501 | Bacteria | 805 |
| 513 | Ga0451845_0609513 | 3300041501 | Bacteria | 1094 |
| 514 | Ga0451849_1066439 | 3300041505 | Bacteria | 1385 |
| 515 | Ga0451843_0475333 | 3300041509 | Bacteria | 1059 |
| 516 | Ga0451843_1603629 | 3300041509 | Bacteria | 610 |
| 517 | Ga0451843_1653883 | 3300041509 | Bacteria | 1430 |
| 518 | Ga0451855_1179725 | 3300041511 | Bacteria | 847 |
| 519 | Ga0451853_1111132 | 3300041512 | Bacteria | 1687 |
| 520 | Ga0451853_1258382 | 3300041512 | Bacteria | 1181 |
| 521 | Ga0451853_1282000 | 3300041512 | Bacteria | 2830 |
| 522 | Ga0439431_0071722 | 3300041997 | Bacteria | 924 |
| 523 | Ga0439433_0189252 | 3300041999 | Bacteria | 541 |
| 524 | Ga0439442_069599 | 3300042002 | Bacteria | 749 |
| 525 | Ga0439445_0019339 | 3300042004 | Bacteria | 1697 |
| 526 | Ga0439450_028295 | 3300042008 | Bacteria | 1246 |
| 527 | Ga0439462_0128788 | 3300042015 | Bacteria | 706 |
| 528 | Ga0450914_038093 | 3300042118 | Bacteria | 602 |
| 529 | Ga0450920_039975 | 3300042122 | Bacteria | 934 |
| 530 | Ga0450921_000892 | 3300042123 | Bacteria | 1628 |
| 531 | Ga0450922_004681 | 3300042124 | Bacteria | 1261 |
| 532 | Ga0450923_018352 | 3300042125 | Bacteria | 1337 |
| 533 | Ga0450888_061148 | 3300042126 | Bacteria | 553 |
| 534 | Ga0450895_003188 | 3300042132 | Bacteria | 1256 |
| 535 | Ga0450896_005254 | 3300042133 | Bacteria | 1767 |
| 536 | Ga0450899_012271 | 3300042135 | Bacteria | 961 |
| 537 | Ga0450906_079179 | 3300042145 | Bacteria | 592 |
| 538 | Ga0450907_034213 | 3300042146 | Bacteria | 866 |
| 539 | Ga0450910_016818 | 3300042147 | Bacteria | 1085 |
| 540 | Ga0439434_0114377 | 3300042435 | Bacteria | 876 |
| 541 | Ga0439434_0173014 | 3300042435 | Bacteria | 721 |
| 542 | Ga0439434_0366258 | 3300042435 | Bacteria | 505 |
| 543 | Ga0439435_0006907 | 3300042436 | Bacteria | 2573 |
| 544 | Ga0439464_0161221 | 3300042439 | Bacteria | 705 |
| 545 | Ga0439460_0042769 | 3300042461 | Bacteria | 1336 |
| 546 | Ga0450918_034442 | 3300042531 | Bacteria | 899 |
| 547 | Ga0450893_0065962 | 3300042532 | Bacteria | 697 |
| 548 | Ga0451577_0269634 | 3300042876 | Bacteria | 1541 |
| 549 | Ga0451577_0537059 | 3300042876 | Bacteria | 1062 |
| 550 | Ga0466972_0623410 | 3300044658 | Bacteria | 510 |
| 551 | Ga0466977_0018143 | 3300044666 | Bacteria | 4281 |
| 552 | Ga0453683_1061433 | 3300044673 | Bacteria | 539 |
| 553 | Ga0453684_0019721 | 3300044712 | Bacteria | 10238 |
| 554 | Ga0453684_0624448 | 3300044712 | Bacteria | 1178 |
| 555 | Ga0453684_1251833 | 3300044712 | Bacteria | 776 |
| 556 | Ga0451576_0341292 | 3300045051 | Bacteria | 1568 |
| 557 | Ga0451576_0715996 | 3300045051 | Bacteria | 1051 |
| 558 | Ga0451576_1740716 | 3300045051 | Bacteria | 645 |
| 559 | Ga0495629_0193831 | 3300046459 | Bacteria | 1406 |
| 560 | Ga0495616_0100144 | 3300046513 | Bacteria | 1360 |
| 561 | Ga0495620_0054158 | 3300046515 | Bacteria | 1696 |
| 562 | Ga0495642_0179618 | 3300046528 | Bacteria | 921 |
| 563 | Ga0495621_0117575 | 3300046539 | Bacteria | 1025 |
| 564 | Ga0495633_0297774 | 3300046558 | Bacteria | 733 |
| 565 | Ga0495647_0074700 | 3300046681 | Bacteria | 1363 |
| 566 | Ga0495647_0479337 | 3300046681 | Bacteria | 578 |
| 567 | Ga0495658_0677730 | 3300046683 | Bacteria | 660 |
| 568 | Ga0495669_0131114 | 3300046684 | Bacteria | 1180 |
| 569 | Ga0495671_0379464 | 3300046692 | Bacteria | 677 |
| 570 | Ga0495581_0202894 | 3300047315 | Bacteria | 1160 |
| 571 | Ga0495636_0149061 | 3300047318 | Bacteria | 1048 |
| 572 | Ga0496100_0119135 | 3300048903 | Bacteria | 1844 |
| 573 | Ga0496101_0128753 | 3300048904 | Bacteria | 1920 |
| 574 | Ga0496102_0202043 | 3300048905 | Bacteria | 1873 |
| 575 | Ga0496103_0173132 | 3300048906 | Bacteria | 1386 |
| 576 | Ga0496104_0219728 | 3300048907 | Bacteria | 1812 |
| 577 | Ga0496104_0359853 | 3300048907 | Bacteria | 1367 |
| 578 | Ga0496105_0090171 | 3300048908 | Bacteria | 2532 |
| 579 | Ga0496105_0278089 | 3300048908 | Bacteria | 1350 |
| 580 | Ga0496106_0119184 | 3300048909 | Bacteria | 2061 |
| 581 | Ga0496106_0713414 | 3300048909 | Bacteria | 799 |
| 582 | Ga0496107_0194423 | 3300048910 | Bacteria | 1507 |
| 583 | Ga0496108_0058854 | 3300048911 | Bacteria | 3230 |
| 584 | Ga0496109_0285161 | 3300048912 | Bacteria | 1556 |
| 585 | Ga0496110_0341672 | 3300048913 | Bacteria | 1363 |
| 586 | Ga0496111_0196479 | 3300048914 | Bacteria | 1499 |
| 587 | Ga0496112_0365141 | 3300048915 | Bacteria | 1385 |
| 588 | Ga0496113_0340650 | 3300048916 | Bacteria | 1202 |
| 589 | Ga0496114_0422694 | 3300048917 | Bacteria | 1180 |
| 590 | Ga0496114_0844743 | 3300048917 | Bacteria | 795 |
| 591 | Ga0496115_0232625 | 3300048918 | Bacteria | 1519 |
| 592 | Ga0496115_0711787 | 3300048918 | Bacteria | 788 |
| 593 | Ga0496120_0097084 | 3300048923 | Bacteria | 1564 |
| 594 | Ga0496121_0259441 | 3300048924 | Bacteria | 1201 |
| 595 | Ga0496124_0378901 | 3300048927 | Bacteria | 990 |
| 596 | Ga0496125_0012461 | 3300048928 | Bacteria | 8439 |
| 597 | Ga0496125_0666626 | 3300048928 | Unclassified | 557 |
| 598 | Ga0495678_236402 | 3300049459 | Bacteria | 548 |
| 599 | Ga0501295_014961 | 3300049518 | Bacteria | 1319 |
| 600 | Ga0501033_0253218 | 3300049570 | Bacteria | 1247 |
| 601 | Ga0501034_0325554 | 3300049571 | Bacteria | 1469 |
| 602 | Ga0501037_0099910 | 3300049573 | Bacteria | 2095 |
| 603 | Ga0501037_0351721 | 3300049573 | Bacteria | 1016 |
| 604 | Ga0501038_0980916 | 3300049574 | Bacteria | 621 |
| 605 | Ga0501043_0232923 | 3300049579 | Bacteria | 1422 |
| 606 | Ga0501043_1052214 | 3300049579 | Bacteria | 577 |
| 607 | Ga0501067_0375740 | 3300049583 | Bacteria | 792 |
| 608 | Ga0501070_1506285 | 3300049586 | Unclassified | 509 |
| 609 | Ga0501080_1015477 | 3300049742 | Bacteria | 719 |
| 610 | Ga0501241_079638 | 3300049758 | Bacteria | 680 |
| 611 | Ga0501035_0083596 | 3300049822 | Bacteria | 2816 |
| 612 | Ga0501035_0348484 | 3300049822 | Bacteria | 1239 |
| 613 | Ga0501044_0025921 | 3300049823 | Bacteria | 6213 |
| 614 | nmdc:mga03683_132531_c1 | 3300050489 | Bacteria | 1116 |
| 615 | nmdc:mga00v17_473230_c1 | 3300050491 | Bacteria | 813 |
| 616 | nmdc:mga0k408_622973_c1 | 3300050493 | Bacteria | 636 |
| 617 | nmdc:mga04h51_281546_c1 | 3300050495 | Bacteria | 674 |
| 618 | nmdc:mga07m45_109960_c1 | 3300050496 | Bacteria | 1587 |
| 619 | nmdc:mga05p37_452451_c1 | 3300050507 | Bacteria | 1486 |
| 620 | nmdc:mga09592_367723_c1 | 3300050508 | Bacteria | 1244 |
| 621 | nmdc:mga09592_480111_c1 | 3300050508 | Bacteria | 1071 |
| 622 | nmdc:mga0qj67_887419_c1 | 3300050509 | Bacteria | 703 |
| 623 | nmdc:mga06r32_231085_c1 | 3300050510 | Bacteria | 1837 |
| 624 | nmdc:mga06r32_404245_c1 | 3300050510 | Bacteria | 1348 |
| 625 | nmdc:mga06r32_710321_c1 | 3300050510 | Unclassified | 970 |
| 626 | nmdc:mga08y16_1977340_c1 | 3300050511 | Bacteria | 533 |
| 627 | nmdc:mga08y16_473316_c1 | 3300050511 | Bacteria | 1275 |
| 628 | nmdc:mga08y16_57762_c1 | 3300050511 | Bacteria | 4054 |
| 629 | nmdc:mga0n895_1227744_c1 | 3300050512 | Unclassified | 723 |
| 630 | nmdc:mga08x19_47707_c1 | 3300050514 | Bacteria | 2742 |
| 631 | Ga0495612_0152216 | 3300053078 | Bacteria | 1007 |
| 632 | Ga0500595_055337 | 3300053119 | Bacteria | 1215 |
| 633 | Ga0500652_063406 | 3300053131 | Bacteria | 1525 |
| 634 | Ga0500568_0121623 | 3300053139 | Bacteria | 972 |
| 635 | Ga0500573_0467875 | 3300053140 | Bacteria | 578 |
| 636 | Ga0500622_0022194 | 3300053156 | Bacteria | 3366 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005335 | Ga0070666_11087189 | Ga0070666_110871892 | 74 |
| 2 | 3300009101 | Ga0105247_10102313 | Ga0105247_101023133 | 80 |
| 3 | 3300009553 | Ga0105249_10063817 | Ga0105249_100638173 | 80 |
| 4 | 3300014968 | Ga0157379_10329618 | Ga0157379_103296182 | 80 |
| 5 | 3300025961 | Ga0207712_10113615 | Ga0207712_101136152 | 81 |
| 6 | iso_pu_bacteria | 2687453129 | 2687578794 | 83 |
| 7 | iso_pu_bacteria | 2687453129 | 2687579175 | 83 |
| 8 | iso_pu_bacteria | 2687453129 | 2687579365 | 83 |
| 9 | iso_pu_bacteria | 2687453129 | 2687579756 | 83 |
| 10 | iso_pu_bacteria | 2687453129 | 2687579761 | 83 |
| 11 | iso_pu_bacteria | 2687453129 | 2687579765 | 83 |
| 12 | iso_pu_bacteria | 2687453129 | 2687579856 | 83 |
| 13 | iso_pu_bacteria | 2687453129 | 2687581190 | 83 |
| 14 | iso_pu_bacteria | 2998344455 | 2998344985 | 83 |
| 15 | iso_pu_bacteria | 2998344455 | 2998345291 | 83 |
| 16 | iso_pu_bacteria | 2998344455 | 2998345401 | 83 |
| 17 | iso_pu_bacteria | 2998344455 | 2998345532 | 83 |
| 18 | iso_pu_bacteria | 2998344455 | 2998346005 | 83 |
| 19 | iso_pu_bacteria | 2998344455 | 2998346149 | 83 |
| 20 | iso_pu_bacteria | 2998344455 | 2998346437 | 83 |
| 21 | iso_pu_bacteria | 2998344455 | 2998347034 | 83 |
| 22 | iso_pu_bacteria | 2998344455 | 2998347344 | 83 |
| 23 | iso_pu_bacteria | 2998344455 | 2998347883 | 83 |
| 24 | iso_pu_bacteria | 2998344455 | 2998348318 | 83 |
| 25 | iso_pu_bacteria | 2998344455 | 2998348501 | 83 |
| 26 | 3300030878 | Ga0265770_1011649 | Ga0265770_10116492 | 86 |
| 27 | 3300031090 | Ga0265760_10035618 | Ga0265760_100356182 | 86 |
| 28 | 3300048924 | Ga0496121_0259441 | Ga0496121_0259441_766_1026 | 86 |
| 29 | 3300049571 | Ga0501034_0325554 | Ga0501034_0325554_520_786 | 86 |
| 30 | 3300049573 | Ga0501037_0351721 | Ga0501037_0351721_503_769 | 86 |
| 31 | 3300049579 | Ga0501043_1052214 | Ga0501043_1052214_208_474 | 86 |
| 32 | 3300049742 | Ga0501080_1015477 | Ga0501080_1015477_311_577 | 86 |
| 33 | 3300049822 | Ga0501035_0348484 | Ga0501035_0348484_74_340 | 86 |
| 34 | 2162886012 | MBSR1b_contig_11849766 | MBSR1b_0599.00002220 | 87 |
| 35 | 3300001977 | JGI24746J21847_1012034 | JGI24746J21847_10120341 | 87 |
| 36 | 3300001978 | JGI24747J21853_1001936 | JGI24747J21853_10019362 | 87 |
| 37 | 3300001979 | JGI24740J21852_10046349 | JGI24740J21852_100463492 | 87 |
| 38 | 3300001989 | JGI24739J22299_10035733 | JGI24739J22299_100357332 | 87 |
| 39 | 3300001991 | JGI24743J22301_10012264 | JGI24743J22301_100122642 | 87 |
| 40 | 3300002073 | JGI24745J21846_1007289 | JGI24745J21846_10072892 | 87 |
| 41 | 3300002074 | JGI24748J21848_1008636 | JGI24748J21848_10086361 | 87 |
| 42 | 3300002075 | JGI24738J21930_10026210 | JGI24738J21930_100262102 | 87 |
| 43 | 3300002076 | JGI24749J21850_1037074 | JGI24749J21850_10370742 | 87 |
| 44 | 3300002077 | JGI24744J21845_10019838 | JGI24744J21845_100198382 | 87 |
| 45 | 3300002155 | JGI24033J26618_1008189 | JGI24033J26618_10081891 | 87 |
| 46 | 3300002239 | JGI24034J26672_10013196 | JGI24034J26672_100131961 | 87 |
| 47 | 3300002244 | JGI24742J22300_10011464 | JGI24742J22300_100114642 | 87 |
| 48 | 3300002459 | JGI24751J29686_10024753 | JGI24751J29686_100247532 | 87 |
| 49 | 3300003756 | Ga0055533_1017227 | Ga0055533_10172271 | 87 |
| 50 | 3300005288 | Ga0065714_10282349 | Ga0065714_102823491 | 87 |
| 51 | 3300005290 | Ga0065712_10101423 | Ga0065712_101014233 | 87 |
| 52 | 3300005293 | Ga0065715_10413210 | Ga0065715_104132102 | 87 |
| 53 | 3300005295 | Ga0065707_11077741 | Ga0065707_110777411 | 87 |
| 54 | 3300005327 | Ga0070658_10011175 | Ga0070658_100111758 | 87 |
| 55 | 3300005328 | Ga0070676_10024966 | Ga0070676_100249663 | 87 |
| 56 | 3300005328 | Ga0070676_10053634 | Ga0070676_100536343 | 87 |
| 57 | 3300005329 | Ga0070683_100363089 | Ga0070683_1003630891 | 87 |
| 58 | 3300005329 | Ga0070683_100471640 | Ga0070683_1004716402 | 87 |
| 59 | 3300005330 | Ga0070690_100129153 | Ga0070690_1001291533 | 87 |
| 60 | 3300005331 | Ga0070670_100000010 | Ga0070670_100000010211 | 87 |
| 61 | 3300005331 | Ga0070670_100175745 | Ga0070670_1001757452 | 87 |
| 62 | 3300005331 | Ga0070670_100369755 | Ga0070670_1003697552 | 87 |
| 63 | 3300005333 | Ga0070677_10003290 | Ga0070677_100032904 | 87 |
| 64 | 3300005334 | Ga0068869_100108552 | Ga0068869_1001085521 | 87 |
| 65 | 3300005335 | Ga0070666_10000434 | Ga0070666_1000043416 | 87 |
| 66 | 3300005335 | Ga0070666_10011606 | Ga0070666_100116066 | 87 |
| 67 | 3300005336 | Ga0070680_100130992 | Ga0070680_1001309923 | 87 |
| 68 | 3300005336 | Ga0070680_100515795 | Ga0070680_1005157952 | 87 |
| 69 | 3300005336 | Ga0070680_100665778 | Ga0070680_1006657781 | 87 |
| 70 | 3300005336 | Ga0070680_101054829 | Ga0070680_1010548291 | 87 |
| 71 | 3300005337 | Ga0070682_100043208 | Ga0070682_1000432083 | 87 |
| 72 | 3300005337 | Ga0070682_100184869 | Ga0070682_1001848692 | 87 |
| 73 | 3300005337 | Ga0070682_100492970 | Ga0070682_1004929701 | 87 |
| 74 | 3300005338 | Ga0068868_100000731 | Ga0068868_10000073114 | 87 |
| 75 | 3300005339 | Ga0070660_100201660 | Ga0070660_1002016602 | 87 |
| 76 | 3300005340 | Ga0070689_100282769 | Ga0070689_1002827692 | 87 |
| 77 | 3300005341 | Ga0070691_10688627 | Ga0070691_106886272 | 87 |
| 78 | 3300005343 | Ga0070687_100138766 | Ga0070687_1001387661 | 87 |
| 79 | 3300005345 | Ga0070692_10038212 | Ga0070692_100382124 | 87 |
| 80 | 3300005345 | Ga0070692_10145666 | Ga0070692_101456662 | 87 |
| 81 | 3300005347 | Ga0070668_100184870 | Ga0070668_1001848701 | 87 |
| 82 | 3300005347 | Ga0070668_100313726 | Ga0070668_1003137262 | 87 |
| 83 | 3300005353 | Ga0070669_100002038 | Ga0070669_10000203811 | 87 |
| 84 | 3300005353 | Ga0070669_100002915 | Ga0070669_1000029152 | 87 |
| 85 | 3300005353 | Ga0070669_100159865 | Ga0070669_1001598652 | 87 |
| 86 | 3300005354 | Ga0070675_100000142 | Ga0070675_1000001427 | 87 |
| 87 | 3300005354 | Ga0070675_100212151 | Ga0070675_1002121513 | 87 |
| 88 | 3300005354 | Ga0070675_100552825 | Ga0070675_1005528252 | 87 |
| 89 | 3300005355 | Ga0070671_100019810 | Ga0070671_1000198108 | 87 |
| 90 | 3300005356 | Ga0070674_100062122 | Ga0070674_1000621222 | 87 |
| 91 | 3300005364 | Ga0070673_100044911 | Ga0070673_1000449114 | 87 |
| 92 | 3300005364 | Ga0070673_100151331 | Ga0070673_1001513312 | 87 |
| 93 | 3300005364 | Ga0070673_100788185 | Ga0070673_1007881852 | 87 |
| 94 | 3300005365 | Ga0070688_100010706 | Ga0070688_10001070611 | 87 |
| 95 | 3300005365 | Ga0070688_100012276 | Ga0070688_1000122769 | 87 |
| 96 | 3300005365 | Ga0070688_100229611 | Ga0070688_1002296112 | 87 |
| 97 | 3300005366 | Ga0070659_100118073 | Ga0070659_1001180733 | 87 |
| 98 | 3300005367 | Ga0070667_100000097 | Ga0070667_10000009738 | 87 |
| 99 | 3300005367 | Ga0070667_100050742 | Ga0070667_1000507427 | 87 |
| 100 | 3300005367 | Ga0070667_100218224 | Ga0070667_1002182243 | 87 |
| 101 | 3300005367 | Ga0070667_102233172 | Ga0070667_1022331721 | 87 |
| 102 | 3300005434 | Ga0070709_10160141 | Ga0070709_101601411 | 87 |
| 103 | 3300005434 | Ga0070709_10206878 | Ga0070709_102068783 | 87 |
| 104 | 3300005434 | Ga0070709_10779002 | Ga0070709_107790021 | 87 |
| 105 | 3300005435 | Ga0070714_100365933 | Ga0070714_1003659332 | 87 |
| 106 | 3300005436 | Ga0070713_100122073 | Ga0070713_1001220732 | 87 |
| 107 | 3300005437 | Ga0070710_10804279 | Ga0070710_108042792 | 87 |
| 108 | 3300005438 | Ga0070701_10076196 | Ga0070701_100761963 | 87 |
| 109 | 3300005438 | Ga0070701_10128378 | Ga0070701_101283781 | 87 |
| 110 | 3300005439 | Ga0070711_100219576 | Ga0070711_1002195762 | 87 |
| 111 | 3300005439 | Ga0070711_101158306 | Ga0070711_1011583062 | 87 |
| 112 | 3300005439 | Ga0070711_101413076 | Ga0070711_1014130761 | 87 |
| 113 | 3300005440 | Ga0070705_100205971 | Ga0070705_1002059712 | 87 |
| 114 | 3300005440 | Ga0070705_100828802 | Ga0070705_1008288021 | 87 |
| 115 | 3300005440 | Ga0070705_101417797 | Ga0070705_1014177971 | 87 |
| 116 | 3300005441 | Ga0070700_100184620 | Ga0070700_1001846202 | 87 |
| 117 | 3300005441 | Ga0070700_100763939 | Ga0070700_1007639391 | 87 |
| 118 | 3300005441 | Ga0070700_100877569 | Ga0070700_1008775692 | 87 |
| 119 | 3300005441 | Ga0070700_101529816 | Ga0070700_1015298161 | 87 |
| 120 | 3300005445 | Ga0070708_101984769 | Ga0070708_1019847691 | 87 |
| 121 | 3300005455 | Ga0070663_100251970 | Ga0070663_1002519702 | 87 |
| 122 | 3300005455 | Ga0070663_102123513 | Ga0070663_1021235131 | 87 |
| 123 | 3300005456 | Ga0070678_101700295 | Ga0070678_1017002952 | 87 |
| 124 | 3300005457 | Ga0070662_100024933 | Ga0070662_1000249333 | 87 |
| 125 | 3300005457 | Ga0070662_100041269 | Ga0070662_1000412693 | 87 |
| 126 | 3300005457 | Ga0070662_100118793 | Ga0070662_1001187933 | 87 |
| 127 | 3300005458 | Ga0070681_10076514 | Ga0070681_100765143 | 87 |
| 128 | 3300005458 | Ga0070681_10168578 | Ga0070681_101685782 | 87 |
| 129 | 3300005458 | Ga0070681_10409272 | Ga0070681_104092722 | 87 |
| 130 | 3300005459 | Ga0068867_100034065 | Ga0068867_1000340651 | 87 |
| 131 | 3300005459 | Ga0068867_100090977 | Ga0068867_1000909772 | 87 |
| 132 | 3300005466 | Ga0070685_10047439 | Ga0070685_100474394 | 87 |
| 133 | 3300005466 | Ga0070685_10085500 | Ga0070685_100855001 | 87 |
| 134 | 3300005468 | Ga0070707_100026204 | Ga0070707_1000262043 | 87 |
| 135 | 3300005468 | Ga0070707_100527412 | Ga0070707_1005274122 | 87 |
| 136 | 3300005518 | Ga0070699_100134760 | Ga0070699_1001347603 | 87 |
| 137 | 3300005530 | Ga0070679_100181000 | Ga0070679_1001810002 | 87 |
| 138 | 3300005530 | Ga0070679_100313991 | Ga0070679_1003139911 | 87 |
| 139 | 3300005530 | Ga0070679_100394557 | Ga0070679_1003945571 | 87 |
| 140 | 3300005530 | Ga0070679_100908781 | Ga0070679_1009087812 | 87 |
| 141 | 3300005530 | Ga0070679_101070131 | Ga0070679_1010701312 | 87 |
| 142 | 3300005530 | Ga0070679_101784948 | Ga0070679_1017849482 | 87 |
| 143 | 3300005535 | Ga0070684_100024686 | Ga0070684_1000246867 | 87 |
| 144 | 3300005535 | Ga0070684_100036551 | Ga0070684_1000365514 | 87 |
| 145 | 3300005536 | Ga0070697_101402457 | Ga0070697_1014024572 | 87 |
| 146 | 3300005539 | Ga0068853_100116075 | Ga0068853_1001160754 | 87 |
| 147 | 3300005539 | Ga0068853_100339661 | Ga0068853_1003396612 | 87 |
| 148 | 3300005539 | Ga0068853_101703639 | Ga0068853_1017036391 | 87 |
| 149 | 3300005543 | Ga0070672_100041348 | Ga0070672_1000413488 | 87 |
| 150 | 3300005543 | Ga0070672_100073389 | Ga0070672_1000733892 | 87 |
| 151 | 3300005543 | Ga0070672_100305222 | Ga0070672_1003052222 | 87 |
| 152 | 3300005543 | Ga0070672_100443799 | Ga0070672_1004437991 | 87 |
| 153 | 3300005544 | Ga0070686_100135885 | Ga0070686_1001358851 | 87 |
| 154 | 3300005545 | Ga0070695_100015005 | Ga0070695_1000150053 | 87 |
| 155 | 3300005546 | Ga0070696_100176715 | Ga0070696_1001767152 | 87 |
| 156 | 3300005547 | Ga0070693_100105002 | Ga0070693_1001050022 | 87 |
| 157 | 3300005548 | Ga0070665_100005670 | Ga0070665_1000056703 | 87 |
| 158 | 3300005548 | Ga0070665_100091241 | Ga0070665_1000912412 | 87 |
| 159 | 3300005548 | Ga0070665_100136817 | Ga0070665_1001368173 | 87 |
| 160 | 3300005548 | Ga0070665_101096807 | Ga0070665_1010968072 | 87 |
| 161 | 3300005549 | Ga0070704_100363268 | Ga0070704_1003632681 | 87 |
| 162 | 3300005563 | Ga0068855_101858695 | Ga0068855_1018586951 | 87 |
| 163 | 3300005563 | Ga0068855_101869259 | Ga0068855_1018692591 | 87 |
| 164 | 3300005564 | Ga0070664_100514145 | Ga0070664_1005141451 | 87 |
| 165 | 3300005564 | Ga0070664_100622503 | Ga0070664_1006225032 | 87 |
| 166 | 3300005564 | Ga0070664_100812819 | Ga0070664_1008128192 | 87 |
| 167 | 3300005577 | Ga0068857_100007610 | Ga0068857_10000761010 | 87 |
| 168 | 3300005577 | Ga0068857_101194007 | Ga0068857_1011940072 | 87 |
| 169 | 3300005578 | Ga0068854_100002758 | Ga0068854_10000275815 | 87 |
| 170 | 3300005614 | Ga0068856_100353191 | Ga0068856_1003531911 | 87 |
| 171 | 3300005615 | Ga0070702_100142920 | Ga0070702_1001429202 | 87 |
| 172 | 3300005616 | Ga0068852_100000390 | Ga0068852_10000039034 | 87 |
| 173 | 3300005616 | Ga0068852_100144743 | Ga0068852_1001447432 | 87 |
| 174 | 3300005616 | Ga0068852_101965584 | Ga0068852_1019655841 | 87 |
| 175 | 3300005617 | Ga0068859_100009767 | Ga0068859_10000976712 | 87 |
| 176 | 3300005617 | Ga0068859_101118292 | Ga0068859_1011182921 | 87 |
| 177 | 3300005618 | Ga0068864_100000018 | Ga0068864_10000001881 | 87 |
| 178 | 3300005618 | Ga0068864_100048810 | Ga0068864_1000488106 | 87 |
| 179 | 3300005618 | Ga0068864_100397299 | Ga0068864_1003972993 | 87 |
| 180 | 3300005718 | Ga0068866_10051387 | Ga0068866_100513873 | 87 |
| 181 | 3300005718 | Ga0068866_10084613 | Ga0068866_100846132 | 87 |
| 182 | 3300005719 | Ga0068861_100022724 | Ga0068861_1000227241 | 87 |
| 183 | 3300005719 | Ga0068861_100286840 | Ga0068861_1002868403 | 87 |
| 184 | 3300005834 | Ga0068851_10001331 | Ga0068851_1000133115 | 87 |
| 185 | 3300005840 | Ga0068870_10060086 | Ga0068870_100600862 | 87 |
| 186 | 3300005840 | Ga0068870_10359582 | Ga0068870_103595822 | 87 |
| 187 | 3300005840 | Ga0068870_11378852 | Ga0068870_113788522 | 87 |
| 188 | 3300005841 | Ga0068863_100002082 | Ga0068863_1000020823 | 87 |
| 189 | 3300005841 | Ga0068863_100097946 | Ga0068863_1000979462 | 87 |
| 190 | 3300005842 | Ga0068858_100151649 | Ga0068858_1001516494 | 87 |
| 191 | 3300005842 | Ga0068858_100385123 | Ga0068858_1003851231 | 87 |
| 192 | 3300005843 | Ga0068860_100003543 | Ga0068860_1000035432 | 87 |
| 193 | 3300005843 | Ga0068860_100178134 | Ga0068860_1001781342 | 87 |
| 194 | 3300005843 | Ga0068860_100330205 | Ga0068860_1003302052 | 87 |
| 195 | 3300005843 | Ga0068860_102492938 | Ga0068860_1024929382 | 87 |
| 196 | 3300005844 | Ga0068862_100004380 | Ga0068862_1000043808 | 87 |
| 197 | 3300005844 | Ga0068862_100231919 | Ga0068862_1002319192 | 87 |
| 198 | 3300005844 | Ga0068862_100872813 | Ga0068862_1008728132 | 87 |
| 199 | 3300006028 | Ga0070717_10253701 | Ga0070717_102537013 | 87 |
| 200 | 3300006028 | Ga0070717_10341510 | Ga0070717_103415102 | 87 |
| 201 | 3300006042 | Ga0075368_10332263 | Ga0075368_103322632 | 87 |
| 202 | 3300006048 | Ga0075363_100231647 | Ga0075363_1002316472 | 87 |
| 203 | 3300006051 | Ga0075364_10367375 | Ga0075364_103673752 | 87 |
| 204 | 3300006163 | Ga0070715_10061693 | Ga0070715_100616932 | 87 |
| 205 | 3300006173 | Ga0070716_100066647 | Ga0070716_1000666471 | 87 |
| 206 | 3300006173 | Ga0070716_100205481 | Ga0070716_1002054812 | 87 |
| 207 | 3300006173 | Ga0070716_101706110 | Ga0070716_1017061102 | 87 |
| 208 | 3300006175 | Ga0070712_100274656 | Ga0070712_1002746561 | 87 |
| 209 | 3300006177 | Ga0075362_10103645 | Ga0075362_101036453 | 87 |
| 210 | 3300006195 | Ga0075366_10683065 | Ga0075366_106830652 | 87 |
| 211 | 3300006237 | Ga0097621_100038659 | Ga0097621_1000386595 | 87 |
| 212 | 3300006237 | Ga0097621_100347654 | Ga0097621_1003476542 | 87 |
| 213 | 3300006353 | Ga0075370_10077901 | Ga0075370_100779014 | 87 |
| 214 | 3300006358 | Ga0068871_100216856 | Ga0068871_1002168564 | 87 |
| 215 | 3300006358 | Ga0068871_100622070 | Ga0068871_1006220701 | 87 |
| 216 | 3300006358 | Ga0068871_100652196 | Ga0068871_1006521962 | 87 |
| 217 | 3300006844 | Ga0075428_100349982 | Ga0075428_1003499822 | 87 |
| 218 | 3300006846 | Ga0075430_100863159 | Ga0075430_1008631592 | 87 |
| 219 | 3300006847 | Ga0075431_100324902 | Ga0075431_1003249022 | 87 |
| 220 | 3300006847 | Ga0075431_100329994 | Ga0075431_1003299941 | 87 |
| 221 | 3300006847 | Ga0075431_100342644 | Ga0075431_1003426442 | 87 |
| 222 | 3300006847 | Ga0075431_100727463 | Ga0075431_1007274633 | 87 |
| 223 | 3300006871 | Ga0075434_100808817 | Ga0075434_1008088172 | 87 |
| 224 | 3300006880 | Ga0075429_100512718 | Ga0075429_1005127182 | 87 |
| 225 | 3300006880 | Ga0075429_100891170 | Ga0075429_1008911701 | 87 |
| 226 | 3300006881 | Ga0068865_100081315 | Ga0068865_1000813152 | 87 |
| 227 | 3300006881 | Ga0068865_100090907 | Ga0068865_1000909073 | 87 |
| 228 | 3300006881 | Ga0068865_100098387 | Ga0068865_1000983873 | 87 |
| 229 | 3300006881 | Ga0068865_100330919 | Ga0068865_1003309192 | 87 |
| 230 | 3300006881 | Ga0068865_101732024 | Ga0068865_1017320241 | 87 |
| 231 | 3300006914 | Ga0075436_100786413 | Ga0075436_1007864132 | 87 |
| 232 | 3300006931 | Ga0097620_100009767 | Ga0097620_10000976712 | 87 |
| 233 | 3300006931 | Ga0097620_101118344 | Ga0097620_1011183441 | 87 |
| 234 | 3300009011 | Ga0105251_10092339 | Ga0105251_100923391 | 87 |
| 235 | 3300009092 | Ga0105250_10030949 | Ga0105250_100309493 | 87 |
| 236 | 3300009093 | Ga0105240_10503692 | Ga0105240_105036922 | 87 |
| 237 | 3300009093 | Ga0105240_10577848 | Ga0105240_105778482 | 87 |
| 238 | 3300009093 | Ga0105240_11136983 | Ga0105240_111369832 | 87 |
| 239 | 3300009093 | Ga0105240_12045208 | Ga0105240_120452082 | 87 |
| 240 | 3300009093 | Ga0105240_12172052 | Ga0105240_121720521 | 87 |
| 241 | 3300009093 | Ga0105240_12274941 | Ga0105240_122749411 | 87 |
| 242 | 3300009093 | Ga0105240_12647593 | Ga0105240_126475931 | 87 |
| 243 | 3300009094 | Ga0111539_10008259 | Ga0111539_100082594 | 87 |
| 244 | 3300009094 | Ga0111539_10279094 | Ga0111539_102790941 | 87 |
| 245 | 3300009094 | Ga0111539_10605512 | Ga0111539_106055121 | 87 |
| 246 | 3300009098 | Ga0105245_10161996 | Ga0105245_101619962 | 87 |
| 247 | 3300009147 | Ga0114129_10579642 | Ga0114129_105796422 | 87 |
| 248 | 3300009147 | Ga0114129_12221022 | Ga0114129_122210221 | 87 |
| 249 | 3300009148 | Ga0105243_10325167 | Ga0105243_103251671 | 87 |
| 250 | 3300009174 | Ga0105241_10145570 | Ga0105241_101455703 | 87 |
| 251 | 3300009176 | Ga0105242_10144840 | Ga0105242_101448402 | 87 |
| 252 | 3300009176 | Ga0105242_11413531 | Ga0105242_114135311 | 87 |
| 253 | 3300009176 | Ga0105242_12698931 | Ga0105242_126989312 | 87 |
| 254 | 3300009177 | Ga0105248_10239439 | Ga0105248_102394392 | 87 |
| 255 | 3300009177 | Ga0105248_10895465 | Ga0105248_108954653 | 87 |
| 256 | 3300009177 | Ga0105248_11306607 | Ga0105248_113066071 | 87 |
| 257 | 3300009545 | Ga0105237_10343161 | Ga0105237_103431611 | 87 |
| 258 | 3300009545 | Ga0105237_10750018 | Ga0105237_107500181 | 87 |
| 259 | 3300009551 | Ga0105238_10116238 | Ga0105238_101162383 | 87 |
| 260 | 3300009551 | Ga0105238_12232222 | Ga0105238_122322221 | 87 |
| 261 | 3300009551 | Ga0105238_12305025 | Ga0105238_123050252 | 87 |
| 262 | 3300009553 | Ga0105249_10038858 | Ga0105249_100388588 | 87 |
| 263 | 3300009553 | Ga0105249_10142525 | Ga0105249_101425252 | 87 |
| 264 | 3300009553 | Ga0105249_10385844 | Ga0105249_103858442 | 87 |
| 265 | 3300009553 | Ga0105249_10395845 | Ga0105249_103958453 | 87 |
| 266 | 3300009553 | Ga0105249_10937330 | Ga0105249_109373302 | 87 |
| 267 | 3300009553 | Ga0105249_11257901 | Ga0105249_112579012 | 87 |
| 268 | 3300009553 | Ga0105249_13086240 | Ga0105249_130862402 | 87 |
| 269 | 3300010375 | Ga0105239_10336874 | Ga0105239_103368743 | 87 |
| 270 | 3300010375 | Ga0105239_11861970 | Ga0105239_118619701 | 87 |
| 271 | 3300011119 | Ga0105246_10133936 | Ga0105246_101339361 | 87 |
| 272 | 3300011119 | Ga0105246_10533862 | Ga0105246_105338622 | 87 |
| 273 | 3300013100 | Ga0157373_10192442 | Ga0157373_101924422 | 87 |
| 274 | 3300013102 | Ga0157371_10074708 | Ga0157371_100747082 | 87 |
| 275 | 3300013102 | Ga0157371_11303649 | Ga0157371_113036492 | 87 |
| 276 | 3300013104 | Ga0157370_10285225 | Ga0157370_102852251 | 87 |
| 277 | 3300013105 | Ga0157369_10221635 | Ga0157369_102216351 | 87 |
| 278 | 3300013105 | Ga0157369_10869832 | Ga0157369_108698321 | 87 |
| 279 | 3300013296 | Ga0157374_10565252 | Ga0157374_105652522 | 87 |
| 280 | 3300013296 | Ga0157374_11660815 | Ga0157374_116608151 | 87 |
| 281 | 3300013297 | Ga0157378_10717409 | Ga0157378_107174092 | 87 |
| 282 | 3300013306 | Ga0163162_10270546 | Ga0163162_102705464 | 87 |
| 283 | 3300013306 | Ga0163162_10581771 | Ga0163162_105817711 | 87 |
| 284 | 3300013307 | Ga0157372_10204993 | Ga0157372_102049932 | 87 |
| 285 | 3300013307 | Ga0157372_10551976 | Ga0157372_105519762 | 87 |
| 286 | 3300013308 | Ga0157375_10006008 | Ga0157375_100060082 | 87 |
| 287 | 3300013308 | Ga0157375_10312321 | Ga0157375_103123211 | 87 |
| 288 | 3300013308 | Ga0157375_10477632 | Ga0157375_104776322 | 87 |
| 289 | 3300014325 | Ga0163163_10000406 | Ga0163163_1000040638 | 87 |
| 290 | 3300014325 | Ga0163163_10338488 | Ga0163163_103384883 | 87 |
| 291 | 3300014326 | Ga0157380_10019022 | Ga0157380_100190227 | 87 |
| 292 | 3300014326 | Ga0157380_10036617 | Ga0157380_100366175 | 87 |
| 293 | 3300014326 | Ga0157380_12553008 | Ga0157380_125530081 | 87 |
| 294 | 3300014745 | Ga0157377_10043578 | Ga0157377_100435782 | 87 |
| 295 | 3300014745 | Ga0157377_10112358 | Ga0157377_101123582 | 87 |
| 296 | 3300014968 | Ga0157379_11104537 | Ga0157379_111045372 | 87 |
| 297 | 3300014969 | Ga0157376_10522663 | Ga0157376_105226631 | 87 |
| 298 | 3300014969 | Ga0157376_11785518 | Ga0157376_117855181 | 87 |
| 299 | 3300017792 | Ga0163161_10039200 | Ga0163161_100392002 | 87 |
| 300 | 3300017792 | Ga0163161_10687162 | Ga0163161_106871622 | 87 |
| 301 | 3300021361 | Ga0213872_10031527 | Ga0213872_100315273 | 87 |
| 302 | 3300021361 | Ga0213872_10105601 | Ga0213872_101056012 | 87 |
| 303 | 3300025226 | Ga0209674_104538 | Ga0209674_1045382 | 87 |
| 304 | 3300025271 | Ga0207666_1010630 | Ga0207666_10106301 | 87 |
| 305 | 3300025290 | Ga0207673_1023442 | Ga0207673_10234422 | 87 |
| 306 | 3300025315 | Ga0207697_10033671 | Ga0207697_100336712 | 87 |
| 307 | 3300025321 | Ga0207656_10000974 | Ga0207656_100009744 | 87 |
| 308 | 3300025711 | Ga0207696_1054661 | Ga0207696_10546611 | 87 |
| 309 | 3300025893 | Ga0207682_10034601 | Ga0207682_100346013 | 87 |
| 310 | 3300025899 | Ga0207642_10077169 | Ga0207642_100771692 | 87 |
| 311 | 3300025900 | Ga0207710_10127708 | Ga0207710_101277082 | 87 |
| 312 | 3300025901 | Ga0207688_10054351 | Ga0207688_100543512 | 87 |
| 313 | 3300025903 | Ga0207680_10000744 | Ga0207680_100007447 | 87 |
| 314 | 3300025903 | Ga0207680_10414496 | Ga0207680_104144961 | 87 |
| 315 | 3300025904 | Ga0207647_10529384 | Ga0207647_105293841 | 87 |
| 316 | 3300025906 | Ga0207699_10232057 | Ga0207699_102320571 | 87 |
| 317 | 3300025906 | Ga0207699_11046716 | Ga0207699_110467161 | 87 |
| 318 | 3300025906 | Ga0207699_11272298 | Ga0207699_112722981 | 87 |
| 319 | 3300025907 | Ga0207645_10012221 | Ga0207645_100122212 | 87 |
| 320 | 3300025907 | Ga0207645_10041219 | Ga0207645_100412192 | 87 |
| 321 | 3300025907 | Ga0207645_10084104 | Ga0207645_100841042 | 87 |
| 322 | 3300025908 | Ga0207643_10001596 | Ga0207643_1000159612 | 87 |
| 323 | 3300025908 | Ga0207643_10040194 | Ga0207643_100401943 | 87 |
| 324 | 3300025908 | Ga0207643_10165129 | Ga0207643_101651292 | 87 |
| 325 | 3300025909 | Ga0207705_10179674 | Ga0207705_101796743 | 87 |
| 326 | 3300025911 | Ga0207654_10862344 | Ga0207654_108623441 | 87 |
| 327 | 3300025912 | Ga0207707_10143691 | Ga0207707_101436914 | 87 |
| 328 | 3300025912 | Ga0207707_10332503 | Ga0207707_103325031 | 87 |
| 329 | 3300025912 | Ga0207707_10447903 | Ga0207707_104479032 | 87 |
| 330 | 3300025912 | Ga0207707_10648020 | Ga0207707_106480201 | 87 |
| 331 | 3300025913 | Ga0207695_10322031 | Ga0207695_103220311 | 87 |
| 332 | 3300025913 | Ga0207695_10569569 | Ga0207695_105695691 | 87 |
| 333 | 3300025914 | Ga0207671_10650082 | Ga0207671_106500821 | 87 |
| 334 | 3300025915 | Ga0207693_10119618 | Ga0207693_101196182 | 87 |
| 335 | 3300025916 | Ga0207663_10142731 | Ga0207663_101427311 | 87 |
| 336 | 3300025916 | Ga0207663_11185323 | Ga0207663_111853231 | 87 |
| 337 | 3300025917 | Ga0207660_10125550 | Ga0207660_101255502 | 87 |
| 338 | 3300025917 | Ga0207660_10428307 | Ga0207660_104283072 | 87 |
| 339 | 3300025917 | Ga0207660_11002839 | Ga0207660_110028391 | 87 |
| 340 | 3300025918 | Ga0207662_10172834 | Ga0207662_101728341 | 87 |
| 341 | 3300025918 | Ga0207662_10210351 | Ga0207662_102103511 | 87 |
| 342 | 3300025919 | Ga0207657_10377300 | Ga0207657_103773002 | 87 |
| 343 | 3300025919 | Ga0207657_11331657 | Ga0207657_113316571 | 87 |
| 344 | 3300025920 | Ga0207649_10400231 | Ga0207649_104002312 | 87 |
| 345 | 3300025920 | Ga0207649_11272493 | Ga0207649_112724931 | 87 |
| 346 | 3300025920 | Ga0207649_11307832 | Ga0207649_113078322 | 87 |
| 347 | 3300025921 | Ga0207652_10344965 | Ga0207652_103449652 | 87 |
| 348 | 3300025921 | Ga0207652_11047410 | Ga0207652_110474102 | 87 |
| 349 | 3300025921 | Ga0207652_11197130 | Ga0207652_111971302 | 87 |
| 350 | 3300025922 | Ga0207646_10006034 | Ga0207646_100060347 | 87 |
| 351 | 3300025922 | Ga0207646_10579686 | Ga0207646_105796861 | 87 |
| 352 | 3300025923 | Ga0207681_10015134 | Ga0207681_100151342 | 87 |
| 353 | 3300025923 | Ga0207681_10767050 | Ga0207681_107670502 | 87 |
| 354 | 3300025924 | Ga0207694_10192021 | Ga0207694_101920211 | 87 |
| 355 | 3300025924 | Ga0207694_10588549 | Ga0207694_105885491 | 87 |
| 356 | 3300025924 | Ga0207694_11079161 | Ga0207694_110791611 | 87 |
| 357 | 3300025925 | Ga0207650_10000003 | Ga0207650_10000003290 | 87 |
| 358 | 3300025925 | Ga0207650_10056652 | Ga0207650_100566524 | 87 |
| 359 | 3300025925 | Ga0207650_10571782 | Ga0207650_105717822 | 87 |
| 360 | 3300025925 | Ga0207650_11452596 | Ga0207650_114525961 | 87 |
| 361 | 3300025926 | Ga0207659_10003121 | Ga0207659_100031218 | 87 |
| 362 | 3300025926 | Ga0207659_10004672 | Ga0207659_100046728 | 87 |
| 363 | 3300025927 | Ga0207687_10134191 | Ga0207687_101341912 | 87 |
| 364 | 3300025928 | Ga0207700_10219163 | Ga0207700_102191631 | 87 |
| 365 | 3300025929 | Ga0207664_10624271 | Ga0207664_106242711 | 87 |
| 366 | 3300025931 | Ga0207644_10000418 | Ga0207644_1000041814 | 87 |
| 367 | 3300025932 | Ga0207690_10060175 | Ga0207690_100601754 | 87 |
| 368 | 3300025933 | Ga0207706_10029593 | Ga0207706_100295932 | 87 |
| 369 | 3300025933 | Ga0207706_10054855 | Ga0207706_100548553 | 87 |
| 370 | 3300025933 | Ga0207706_10191182 | Ga0207706_101911823 | 87 |
| 371 | 3300025934 | Ga0207686_10285395 | Ga0207686_102853952 | 87 |
| 372 | 3300025935 | Ga0207709_10103479 | Ga0207709_101034794 | 87 |
| 373 | 3300025936 | Ga0207670_11421197 | Ga0207670_114211971 | 87 |
| 374 | 3300025937 | Ga0207669_10024719 | Ga0207669_100247192 | 87 |
| 375 | 3300025938 | Ga0207704_10177715 | Ga0207704_101777152 | 87 |
| 376 | 3300025938 | Ga0207704_10204778 | Ga0207704_102047781 | 87 |
| 377 | 3300025938 | Ga0207704_10856027 | Ga0207704_108560271 | 87 |
| 378 | 3300025939 | Ga0207665_10119914 | Ga0207665_101199141 | 87 |
| 379 | 3300025939 | Ga0207665_10346763 | Ga0207665_103467632 | 87 |
| 380 | 3300025939 | Ga0207665_10751261 | Ga0207665_107512612 | 87 |
| 381 | 3300025940 | Ga0207691_10065733 | Ga0207691_100657332 | 87 |
| 382 | 3300025940 | Ga0207691_10105734 | Ga0207691_101057342 | 87 |
| 383 | 3300025940 | Ga0207691_10156887 | Ga0207691_101568873 | 87 |
| 384 | 3300025940 | Ga0207691_10439969 | Ga0207691_104399691 | 87 |
| 385 | 3300025940 | Ga0207691_10467883 | Ga0207691_104678832 | 87 |
| 386 | 3300025941 | Ga0207711_10306598 | Ga0207711_103065983 | 87 |
| 387 | 3300025941 | Ga0207711_10370582 | Ga0207711_103705822 | 87 |
| 388 | 3300025941 | Ga0207711_10970237 | Ga0207711_109702372 | 87 |
| 389 | 3300025942 | Ga0207689_10056670 | Ga0207689_100566704 | 87 |
| 390 | 3300025942 | Ga0207689_10542085 | Ga0207689_105420852 | 87 |
| 391 | 3300025944 | Ga0207661_10024178 | Ga0207661_100241784 | 87 |
| 392 | 3300025944 | Ga0207661_10815919 | Ga0207661_108159191 | 87 |
| 393 | 3300025945 | Ga0207679_10322145 | Ga0207679_103221452 | 87 |
| 394 | 3300025945 | Ga0207679_10376087 | Ga0207679_103760872 | 87 |
| 395 | 3300025949 | Ga0207667_10555515 | Ga0207667_105555152 | 87 |
| 396 | 3300025960 | Ga0207651_10001418 | Ga0207651_100014186 | 87 |
| 397 | 3300025960 | Ga0207651_10566421 | Ga0207651_105664212 | 87 |
| 398 | 3300025960 | Ga0207651_10783398 | Ga0207651_107833982 | 87 |
| 399 | 3300025961 | Ga0207712_10370020 | Ga0207712_103700202 | 87 |
| 400 | 3300025961 | Ga0207712_10834588 | Ga0207712_108345881 | 87 |
| 401 | 3300025961 | Ga0207712_10894689 | Ga0207712_108946891 | 87 |
| 402 | 3300025972 | Ga0207668_10065856 | Ga0207668_100658562 | 87 |
| 403 | 3300025972 | Ga0207668_10375320 | Ga0207668_103753201 | 87 |
| 404 | 3300025981 | Ga0207640_10002548 | Ga0207640_1000254812 | 87 |
| 405 | 3300025986 | Ga0207658_10000007 | Ga0207658_1000000779 | 87 |
| 406 | 3300025986 | Ga0207658_10396196 | Ga0207658_103961962 | 87 |
| 407 | 3300026023 | Ga0207677_10253214 | Ga0207677_102532142 | 87 |
| 408 | 3300026035 | Ga0207703_10095406 | Ga0207703_100954063 | 87 |
| 409 | 3300026035 | Ga0207703_11032360 | Ga0207703_110323602 | 87 |
| 410 | 3300026041 | Ga0207639_10109338 | Ga0207639_101093383 | 87 |
| 411 | 3300026041 | Ga0207639_11817955 | Ga0207639_118179551 | 87 |
| 412 | 3300026067 | Ga0207678_10103686 | Ga0207678_101036862 | 87 |
| 413 | 3300026075 | Ga0207708_10348805 | Ga0207708_103488052 | 87 |
| 414 | 3300026078 | Ga0207702_10423557 | Ga0207702_104235572 | 87 |
| 415 | 3300026078 | Ga0207702_10984777 | Ga0207702_109847771 | 87 |
| 416 | 3300026078 | Ga0207702_11689315 | Ga0207702_116893152 | 87 |
| 417 | 3300026088 | Ga0207641_10001670 | Ga0207641_100016706 | 87 |
| 418 | 3300026088 | Ga0207641_10077683 | Ga0207641_100776832 | 87 |
| 419 | 3300026089 | Ga0207648_10017451 | Ga0207648_100174513 | 87 |
| 420 | 3300026089 | Ga0207648_10036740 | Ga0207648_100367402 | 87 |
| 421 | 3300026095 | Ga0207676_10000003 | Ga0207676_10000003805 | 87 |
| 422 | 3300026095 | Ga0207676_10302644 | Ga0207676_103026441 | 87 |
| 423 | 3300026116 | Ga0207674_10728386 | Ga0207674_107283862 | 87 |
| 424 | 3300026116 | Ga0207674_11169880 | Ga0207674_111698801 | 87 |
| 425 | 3300026118 | Ga0207675_100012950 | Ga0207675_1000129506 | 87 |
| 426 | 3300026118 | Ga0207675_100345890 | Ga0207675_1003458901 | 87 |
| 427 | 3300026121 | Ga0207683_10002093 | Ga0207683_1000209316 | 87 |
| 428 | 3300026121 | Ga0207683_10062230 | Ga0207683_100622302 | 87 |
| 429 | 3300026121 | Ga0207683_10953062 | Ga0207683_109530621 | 87 |
| 430 | 3300026121 | Ga0207683_11615368 | Ga0207683_116153682 | 87 |
| 431 | 3300026142 | Ga0207698_10128210 | Ga0207698_101282104 | 87 |
| 432 | 3300026142 | Ga0207698_10273890 | Ga0207698_102738902 | 87 |
| 433 | 3300027252 | Ga0209973_1016096 | Ga0209973_10160962 | 87 |
| 434 | 3300027552 | Ga0209982_1001027 | Ga0209982_10010273 | 87 |
| 435 | 3300027617 | Ga0210002_1002097 | Ga0210002_10020973 | 87 |
| 436 | 3300027695 | Ga0209966_1055626 | Ga0209966_10556262 | 87 |
| 437 | 3300027695 | Ga0209966_1142412 | Ga0209966_11424121 | 87 |
| 438 | 3300027717 | Ga0209998_10004632 | Ga0209998_100046322 | 87 |
| 439 | 3300027717 | Ga0209998_10067297 | Ga0209998_100672972 | 87 |
| 440 | 3300027866 | Ga0209813_10319353 | Ga0209813_103193532 | 87 |
| 441 | 3300027876 | Ga0209974_10027166 | Ga0209974_100271662 | 87 |
| 442 | 3300027907 | Ga0207428_10002309 | Ga0207428_1000230913 | 87 |
| 443 | 3300028379 | Ga0268266_10001450 | Ga0268266_100014505 | 87 |
| 444 | 3300028379 | Ga0268266_10457039 | Ga0268266_104570391 | 87 |
| 445 | 3300028379 | Ga0268266_10852897 | Ga0268266_108528972 | 87 |
| 446 | 3300028379 | Ga0268266_11663248 | Ga0268266_116632482 | 87 |
| 447 | 3300028380 | Ga0268265_10020118 | Ga0268265_100201184 | 87 |
| 448 | 3300028380 | Ga0268265_10293369 | Ga0268265_102933691 | 87 |
| 449 | 3300028380 | Ga0268265_10784502 | Ga0268265_107845022 | 87 |
| 450 | 3300028380 | Ga0268265_10871457 | Ga0268265_108714571 | 87 |
| 451 | 3300028381 | Ga0268264_10010705 | Ga0268264_100107052 | 87 |
| 452 | 3300028381 | Ga0268264_10463759 | Ga0268264_104637591 | 87 |
| 453 | 3300028381 | Ga0268264_11167430 | Ga0268264_111674302 | 87 |
| 454 | 3300028381 | Ga0268264_12245970 | Ga0268264_122459702 | 87 |
| 455 | 3300028381 | Ga0268264_12364174 | Ga0268264_123641742 | 87 |
| 456 | 3300028573 | Ga0265334_10005070 | Ga0265334_100050706 | 87 |
| 457 | 3300031240 | Ga0265320_10188426 | Ga0265320_101884261 | 87 |
| 458 | 3300031250 | Ga0265331_10318015 | Ga0265331_103180151 | 87 |
| 459 | 3300031344 | Ga0265316_10726650 | Ga0265316_107266502 | 87 |
| 460 | 3300031507 | Ga0307509_10003642 | Ga0307509_1000364221 | 87 |
| 461 | 3300031507 | Ga0307509_10140810 | Ga0307509_101408104 | 87 |
| 462 | 3300031548 | Ga0307408_100265336 | Ga0307408_1002653362 | 87 |
| 463 | 3300031548 | Ga0307408_101645007 | Ga0307408_1016450072 | 87 |
| 464 | 3300031616 | Ga0307508_10385855 | Ga0307508_103858551 | 87 |
| 465 | 3300031616 | Ga0307508_10556787 | Ga0307508_105567871 | 87 |
| 466 | 3300031691 | Ga0316579_10119057 | Ga0316579_101190572 | 87 |
| 467 | 3300031691 | Ga0316579_10244750 | Ga0316579_102447501 | 87 |
| 468 | 3300031727 | Ga0316576_10231338 | Ga0316576_102313382 | 87 |
| 469 | 3300031727 | Ga0316576_10242936 | Ga0316576_102429361 | 87 |
| 470 | 3300031728 | Ga0316578_10129092 | Ga0316578_101290923 | 87 |
| 471 | 3300031728 | Ga0316578_10597301 | Ga0316578_105973011 | 87 |
| 472 | 3300031728 | Ga0316578_10930557 | Ga0316578_109305572 | 87 |
| 473 | 3300031731 | Ga0307405_10499898 | Ga0307405_104998982 | 87 |
| 474 | 3300031733 | Ga0316577_10016985 | Ga0316577_100169852 | 87 |
| 475 | 3300031824 | Ga0307413_10776593 | Ga0307413_107765931 | 87 |
| 476 | 3300031903 | Ga0307407_10176144 | Ga0307407_101761442 | 87 |
| 477 | 3300031911 | Ga0307412_11379192 | Ga0307412_113791921 | 87 |
| 478 | 3300032002 | Ga0307416_100941439 | Ga0307416_1009414392 | 87 |
| 479 | 3300032002 | Ga0307416_101151637 | Ga0307416_1011516372 | 87 |
| 480 | 3300032002 | Ga0307416_102706938 | Ga0307416_1027069381 | 87 |
| 481 | 3300032004 | Ga0307414_12105431 | Ga0307414_121054312 | 87 |
| 482 | 3300032005 | Ga0307411_10152781 | Ga0307411_101527813 | 87 |
| 483 | 3300032005 | Ga0307411_10540202 | Ga0307411_105402022 | 87 |
| 484 | 3300032126 | Ga0307415_100188462 | Ga0307415_1001884623 | 87 |
| 485 | 3300032126 | Ga0307415_100798326 | Ga0307415_1007983262 | 87 |
| 486 | 3300032126 | Ga0307415_101549627 | Ga0307415_1015496271 | 87 |
| 487 | 3300032137 | Ga0316585_10011187 | Ga0316585_100111873 | 87 |
| 488 | 3300032139 | Ga0316580_10043601 | Ga0316580_100436013 | 87 |
| 489 | 3300035089 | Ga0373944_0057126 | Ga0373944_0057126_902_1165 | 87 |
| 490 | 3300035091 | Ga0373951_0130023 | Ga0373951_0130023_370_633 | 87 |
| 491 | 3300035113 | Ga0373936_0125949 | Ga0373936_0125949_252_515 | 87 |
| 492 | 3300035115 | Ga0373941_0190214 | Ga0373941_0190214_147_410 | 87 |
| 493 | 3300035116 | Ga0373945_0049408 | Ga0373945_0049408_312_575 | 87 |
| 494 | 3300035170 | Ga0373943_0132876 | Ga0373943_0132876_174_437 | 87 |
| 495 | 3300035172 | Ga0373955_0811996 | Ga0373955_0811996_145_414 | 87 |
| 496 | 3300035241 | Ga0373961_0231631 | Ga0373961_0231631_325_588 | 87 |
| 497 | 3300035398 | Ga0316574_0105059 | Ga0316574_0105059_664_933 | 87 |
| 498 | 3300035398 | Ga0316574_0137169 | Ga0316574_0137169_1096_1359 | 87 |
| 499 | 3300035398 | Ga0316574_0223937 | Ga0316574_0223937_850_1113 | 87 |
| 500 | 3300035691 | Ga0373931_0124858 | Ga0373931_0124858_77_340 | 87 |
| 501 | 3300035692 | Ga0373935_0250511 | Ga0373935_0250511_891_1160 | 87 |
| 502 | 3300035695 | Ga0373927_0121099 | Ga0373927_0121099_1286_1549 | 87 |
| 503 | 3300035725 | Ga0373947_0139014 | Ga0373947_0139014_335_598 | 87 |
| 504 | 3300036647 | Ga0316582_0224958 | Ga0316582_0224958_118_387 | 87 |
| 505 | 3300036647 | Ga0316582_0922937 | Ga0316582_0922937_276_545 | 87 |
| 506 | 3300036647 | Ga0316582_1067784 | Ga0316582_1067784_124_387 | 87 |
| 507 | 3300036712 | Ga0316584_0205954 | Ga0316584_0205954_142_411 | 87 |
| 508 | 3300036712 | Ga0316584_0258095 | Ga0316584_0258095_898_1161 | 87 |
| 509 | 3300036712 | Ga0316584_0375225 | Ga0316584_0375225_631_894 | 87 |
| 510 | 3300037068 | Ga0373925_0644977 | Ga0373925_0644977_510_773 | 87 |
| 511 | 3300037312 | Ga0395899_0220296 | Ga0395899_0220296_991_1260 | 87 |
| 512 | 3300037418 | Ga0395900_1774263 | Ga0395900_1774263_94_357 | 87 |
| 513 | 3300037466 | Ga0395898_0198512 | Ga0395898_0198512_902_1171 | 87 |
| 514 | 3300037588 | Ga0316581_0094564 | Ga0316581_0094564_492_761 | 87 |
| 515 | 3300039438 | Ga0436360_0817650 | Ga0436360_0817650_210_479 | 87 |
| 516 | 3300039447 | Ga0436361_0147800 | Ga0436361_0147800_874_1143 | 87 |
| 517 | 3300039447 | Ga0436361_0519472 | Ga0436361_0519472_15_278 | 87 |
| 518 | 3300039447 | Ga0436361_0765718 | Ga0436361_0765718_219_482 | 87 |
| 519 | 3300039447 | Ga0436361_1008104 | Ga0436361_1008104_937_1206 | 87 |
| 520 | 3300041407 | Ga0439447_036003 | Ga0439447_036003_91_354 | 87 |
| 521 | 3300041413 | Ga0439465_0057306 | Ga0439465_0057306_40_309 | 87 |
| 522 | 3300041443 | Ga0451789_0630838 | Ga0451789_0630838_1183_1446 | 87 |
| 523 | 3300041452 | Ga0451793_0316792 | Ga0451793_0316792_349_612 | 87 |
| 524 | 3300041456 | Ga0451795_1495749 | Ga0451795_1495749_473_736 | 87 |
| 525 | 3300041458 | Ga0451798_0317467 | Ga0451798_0317467_892_1155 | 87 |
| 526 | 3300041459 | Ga0451800_1612496 | Ga0451800_1612496_1236_1499 | 87 |
| 527 | 3300041460 | Ga0451802_0332722 | Ga0451802_0332722_194_457 | 87 |
| 528 | 3300041463 | Ga0451804_0634357 | Ga0451804_0634357_265_528 | 87 |
| 529 | 3300041486 | Ga0451807_0915961 | Ga0451807_0915961_2880_3143 | 87 |
| 530 | 3300041491 | Ga0451833_1092509 | Ga0451833_1092509_261_524 | 87 |
| 531 | 3300041491 | Ga0451833_1477764 | Ga0451833_1477764_255_518 | 87 |
| 532 | 3300041492 | Ga0451835_0175095 | Ga0451835_0175095_232_495 | 87 |
| 533 | 3300041492 | Ga0451835_0580138 | Ga0451835_0580138_989_1252 | 87 |
| 534 | 3300041496 | Ga0451839_1509357 | Ga0451839_1509357_238_501 | 87 |
| 535 | 3300041496 | Ga0451839_1586213 | Ga0451839_1586213_749_1012 | 87 |
| 536 | 3300041498 | Ga0451841_0268182 | Ga0451841_0268182_289_552 | 87 |
| 537 | 3300041498 | Ga0451841_0396150 | Ga0451841_0396150_243_506 | 87 |
| 538 | 3300041501 | Ga0451845_0350209 | Ga0451845_0350209_344_607 | 87 |
| 539 | 3300041501 | Ga0451845_0609513 | Ga0451845_0609513_70_333 | 87 |
| 540 | 3300041505 | Ga0451849_1066439 | Ga0451849_1066439_979_1242 | 87 |
| 541 | 3300041509 | Ga0451843_0475333 | Ga0451843_0475333_766_1029 | 87 |
| 542 | 3300041509 | Ga0451843_1603629 | Ga0451843_1603629_179_442 | 87 |
| 543 | 3300041509 | Ga0451843_1653883 | Ga0451843_1653883_562_825 | 87 |
| 544 | 3300041511 | Ga0451855_1179725 | Ga0451855_1179725_222_485 | 87 |
| 545 | 3300041512 | Ga0451853_1111132 | Ga0451853_1111132_254_517 | 87 |
| 546 | 3300041512 | Ga0451853_1258382 | Ga0451853_1258382_70_333 | 87 |
| 547 | 3300041512 | Ga0451853_1282000 | Ga0451853_1282000_762_1025 | 87 |
| 548 | 3300041997 | Ga0439431_0071722 | Ga0439431_0071722_156_419 | 87 |
| 549 | 3300041999 | Ga0439433_0189252 | Ga0439433_0189252_115_378 | 87 |
| 550 | 3300042002 | Ga0439442_069599 | Ga0439442_069599_435_698 | 87 |
| 551 | 3300042004 | Ga0439445_0019339 | Ga0439445_0019339_1335_1604 | 87 |
| 552 | 3300042008 | Ga0439450_028295 | Ga0439450_028295_922_1185 | 87 |
| 553 | 3300042015 | Ga0439462_0128788 | Ga0439462_0128788_400_663 | 87 |
| 554 | 3300042118 | Ga0450914_038093 | Ga0450914_038093_142_501 | 87 |
| 555 | 3300042122 | Ga0450920_039975 | Ga0450920_039975_115_384 | 87 |
| 556 | 3300042123 | Ga0450921_000892 | Ga0450921_000892_890_1159 | 87 |
| 557 | 3300042124 | Ga0450922_004681 | Ga0450922_004681_175_444 | 87 |
| 558 | 3300042125 | Ga0450923_018352 | Ga0450923_018352_742_1011 | 87 |
| 559 | 3300042126 | Ga0450888_061148 | Ga0450888_061148_175_444 | 87 |
| 560 | 3300042132 | Ga0450895_003188 | Ga0450895_003188_915_1184 | 87 |
| 561 | 3300042133 | Ga0450896_005254 | Ga0450896_005254_852_1121 | 87 |
| 562 | 3300042135 | Ga0450899_012271 | Ga0450899_012271_73_342 | 87 |
| 563 | 3300042145 | Ga0450906_079179 | Ga0450906_079179_184_453 | 87 |
| 564 | 3300042146 | Ga0450907_034213 | Ga0450907_034213_438_707 | 87 |
| 565 | 3300042147 | Ga0450910_016818 | Ga0450910_016818_669_938 | 87 |
| 566 | 3300042435 | Ga0439434_0114377 | Ga0439434_0114377_377_640 | 87 |
| 567 | 3300042435 | Ga0439434_0173014 | Ga0439434_0173014_414_683 | 87 |
| 568 | 3300042435 | Ga0439434_0366258 | Ga0439434_0366258_190_459 | 87 |
| 569 | 3300042436 | Ga0439435_0006907 | Ga0439435_0006907_1711_1974 | 87 |
| 570 | 3300042439 | Ga0439464_0161221 | Ga0439464_0161221_141_404 | 87 |
| 571 | 3300042461 | Ga0439460_0042769 | Ga0439460_0042769_174_437 | 87 |
| 572 | 3300042531 | Ga0450918_034442 | Ga0450918_034442_62_331 | 87 |
| 573 | 3300042532 | Ga0450893_0065962 | Ga0450893_0065962_271_534 | 87 |
| 574 | 3300042876 | Ga0451577_0269634 | Ga0451577_0269634_69_332 | 87 |
| 575 | 3300042876 | Ga0451577_0537059 | Ga0451577_0537059_712_975 | 87 |
| 576 | 3300044658 | Ga0466972_0623410 | Ga0466972_0623410_141_407 | 87 |
| 577 | 3300044666 | Ga0466977_0018143 | Ga0466977_0018143_3187_3456 | 87 |
| 578 | 3300044673 | Ga0453683_1061433 | Ga0453683_1061433_103_366 | 87 |
| 579 | 3300044712 | Ga0453684_0019721 | Ga0453684_0019721_4738_5001 | 87 |
| 580 | 3300044712 | Ga0453684_0624448 | Ga0453684_0624448_547_810 | 87 |
| 581 | 3300044712 | Ga0453684_1251833 | Ga0453684_1251833_119_382 | 87 |
| 582 | 3300045051 | Ga0451576_0341292 | Ga0451576_0341292_1160_1423 | 87 |
| 583 | 3300045051 | Ga0451576_0715996 | Ga0451576_0715996_52_315 | 87 |
| 584 | 3300045051 | Ga0451576_1740716 | Ga0451576_1740716_98_361 | 87 |
| 585 | 3300046459 | Ga0495629_0193831 | Ga0495629_0193831_952_1215 | 87 |
| 586 | 3300046513 | Ga0495616_0100144 | Ga0495616_0100144_117_380 | 87 |
| 587 | 3300046515 | Ga0495620_0054158 | Ga0495620_0054158_961_1224 | 87 |
| 588 | 3300046528 | Ga0495642_0179618 | Ga0495642_0179618_27_290 | 87 |
| 589 | 3300046539 | Ga0495621_0117575 | Ga0495621_0117575_740_1009 | 87 |
| 590 | 3300046558 | Ga0495633_0297774 | Ga0495633_0297774_281_550 | 87 |
| 591 | 3300046681 | Ga0495647_0074700 | Ga0495647_0074700_291_554 | 87 |
| 592 | 3300046681 | Ga0495647_0479337 | Ga0495647_0479337_76_345 | 87 |
| 593 | 3300046683 | Ga0495658_0677730 | Ga0495658_0677730_332_595 | 87 |
| 594 | 3300046684 | Ga0495669_0131114 | Ga0495669_0131114_782_1051 | 87 |
| 595 | 3300046692 | Ga0495671_0379464 | Ga0495671_0379464_15_278 | 87 |
| 596 | 3300047315 | Ga0495581_0202894 | Ga0495581_0202894_19_282 | 87 |
| 597 | 3300047318 | Ga0495636_0149061 | Ga0495636_0149061_622_891 | 87 |
| 598 | 3300048903 | Ga0496100_0119135 | Ga0496100_0119135_564_827 | 87 |
| 599 | 3300048904 | Ga0496101_0128753 | Ga0496101_0128753_81_344 | 87 |
| 600 | 3300048905 | Ga0496102_0202043 | Ga0496102_0202043_1348_1611 | 87 |
| 601 | 3300048906 | Ga0496103_0173132 | Ga0496103_0173132_1053_1316 | 87 |
| 602 | 3300048907 | Ga0496104_0219728 | Ga0496104_0219728_982_1251 | 87 |
| 603 | 3300048907 | Ga0496104_0359853 | Ga0496104_0359853_317_580 | 87 |
| 604 | 3300048908 | Ga0496105_0090171 | Ga0496105_0090171_2193_2456 | 87 |
| 605 | 3300048908 | Ga0496105_0278089 | Ga0496105_0278089_979_1248 | 87 |
| 606 | 3300048909 | Ga0496106_0119184 | Ga0496106_0119184_816_1079 | 87 |
| 607 | 3300048909 | Ga0496106_0713414 | Ga0496106_0713414_214_477 | 87 |
| 608 | 3300048910 | Ga0496107_0194423 | Ga0496107_0194423_594_857 | 87 |
| 609 | 3300048911 | Ga0496108_0058854 | Ga0496108_0058854_568_831 | 87 |
| 610 | 3300048912 | Ga0496109_0285161 | Ga0496109_0285161_378_641 | 87 |
| 611 | 3300048913 | Ga0496110_0341672 | Ga0496110_0341672_533_796 | 87 |
| 612 | 3300048914 | Ga0496111_0196479 | Ga0496111_0196479_326_589 | 87 |
| 613 | 3300048915 | Ga0496112_0365141 | Ga0496112_0365141_176_439 | 87 |
| 614 | 3300048916 | Ga0496113_0340650 | Ga0496113_0340650_863_1126 | 87 |
| 615 | 3300048917 | Ga0496114_0422694 | Ga0496114_0422694_75_338 | 87 |
| 616 | 3300048917 | Ga0496114_0844743 | Ga0496114_0844743_98_361 | 87 |
| 617 | 3300048918 | Ga0496115_0232625 | Ga0496115_0232625_267_530 | 87 |
| 618 | 3300048918 | Ga0496115_0711787 | Ga0496115_0711787_129_392 | 87 |
| 619 | 3300048923 | Ga0496120_0097084 | Ga0496120_0097084_498_767 | 87 |
| 620 | 3300048927 | Ga0496124_0378901 | Ga0496124_0378901_649_912 | 87 |
| 621 | 3300048928 | Ga0496125_0012461 | Ga0496125_0012461_2074_2337 | 87 |
| 622 | 3300048928 | Ga0496125_0666626 | Ga0496125_0666626_240_503 | 87 |
| 623 | 3300049459 | Ga0495678_236402 | Ga0495678_236402_48_311 | 87 |
| 624 | 3300049518 | Ga0501295_014961 | Ga0501295_014961_526_795 | 87 |
| 625 | 3300049570 | Ga0501033_0253218 | Ga0501033_0253218_813_1082 | 87 |
| 626 | 3300049573 | Ga0501037_0099910 | Ga0501037_0099910_865_1134 | 87 |
| 627 | 3300049574 | Ga0501038_0980916 | Ga0501038_0980916_229_492 | 87 |
| 628 | 3300049579 | Ga0501043_0232923 | Ga0501043_0232923_1009_1272 | 87 |
| 629 | 3300049583 | Ga0501067_0375740 | Ga0501067_0375740_419_685 | 87 |
| 630 | 3300049586 | Ga0501070_1506285 | Ga0501070_1506285_234_497 | 87 |
| 631 | 3300049758 | Ga0501241_079638 | Ga0501241_079638_175_444 | 87 |
| 632 | 3300049822 | Ga0501035_0083596 | Ga0501035_0083596_1776_2045 | 87 |
| 633 | 3300049823 | Ga0501044_0025921 | Ga0501044_0025921_325_594 | 87 |
| 634 | 3300050489 | nmdc:mga03683_132531_c1 | nmdc:mga03683_132531_c1_794_1057 | 87 |
| 635 | 3300050491 | nmdc:mga00v17_473230_c1 | nmdc:mga00v17_473230_c1_312_575 | 87 |
| 636 | 3300050493 | nmdc:mga0k408_622973_c1 | nmdc:mga0k408_622973_c1_35_298 | 87 |
| 637 | 3300050495 | nmdc:mga04h51_281546_c1 | nmdc:mga04h51_281546_c1_259_522 | 87 |
| 638 | 3300050496 | nmdc:mga07m45_109960_c1 | nmdc:mga07m45_109960_c1_166_429 | 87 |
| 639 | 3300050507 | nmdc:mga05p37_452451_c1 | nmdc:mga05p37_452451_c1_1154_1417 | 87 |
| 640 | 3300050508 | nmdc:mga09592_367723_c1 | nmdc:mga09592_367723_c1_604_867 | 87 |
| 641 | 3300050508 | nmdc:mga09592_480111_c1 | nmdc:mga09592_480111_c1_659_922 | 87 |
| 642 | 3300050509 | nmdc:mga0qj67_887419_c1 | nmdc:mga0qj67_887419_c1_305_574 | 87 |
| 643 | 3300050510 | nmdc:mga06r32_231085_c1 | nmdc:mga06r32_231085_c1_362_628 | 87 |
| 644 | 3300050510 | nmdc:mga06r32_404245_c1 | nmdc:mga06r32_404245_c1_73_336 | 87 |
| 645 | 3300050510 | nmdc:mga06r32_710321_c1 | nmdc:mga06r32_710321_c1_566_835 | 87 |
| 646 | 3300050511 | nmdc:mga08y16_1977340_c1 | nmdc:mga08y16_1977340_c1_158_421 | 87 |
| 647 | 3300050511 | nmdc:mga08y16_473316_c1 | nmdc:mga08y16_473316_c1_918_1184 | 87 |
| 648 | 3300050511 | nmdc:mga08y16_57762_c1 | nmdc:mga08y16_57762_c1_2660_2926 | 87 |
| 649 | 3300050512 | nmdc:mga0n895_1227744_c1 | nmdc:mga0n895_1227744_c1_408_671 | 87 |
| 650 | 3300050514 | nmdc:mga08x19_47707_c1 | nmdc:mga08x19_47707_c1_1591_1854 | 87 |
| 651 | 3300053078 | Ga0495612_0152216 | Ga0495612_0152216_212_475 | 87 |
| 652 | 3300053119 | Ga0500595_055337 | Ga0500595_055337_69_338 | 87 |
| 653 | 3300053131 | Ga0500652_063406 | Ga0500652_063406_10_282 | 87 |
| 654 | 3300053139 | Ga0500568_0121623 | Ga0500568_0121623_102_365 | 87 |
| 655 | 3300053140 | Ga0500573_0467875 | Ga0500573_0467875_113_382 | 87 |
| 656 | 3300053156 | Ga0500622_0022194 | Ga0500622_0022194_878_1156 | 87 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8b4h-assembly1.cif.gz_D | ista transposase cleaved donor complex | 0.9083 | 4 | 40 |
| 2elh-assembly1.cif.gz_A | solution structure of the cenp-b n-terminal dna-binding domain of fruit fly distal antenna cg11849-pa | 0.8643 | 3 | 43 |
| 5af3-assembly1.cif.gz_B | x-ray crystal structure of rv2018 from mycobacterium tuberculosis | 0.8266 | 10 | 38 |
| 5af3-assembly1.cif.gz_A | x-ray crystal structure of rv2018 from mycobacterium tuberculosis | 0.8253 | 10 | 38 |
| 1hlv-assembly1.cif.gz_A | crystal structure of cenp-b(1-129) complexed with the cenp-b box dna | 0.8215 | 1 | 40 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2elhA01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8643 | 3 | 43 | 1.10.10.10 |
| af_P0AED5_2_210_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.8301 | 8 | 43 | 3.40.50.2300 |
| 2r0qF02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.8153 | 10 | 42 | 1.10.10.60 |
| af_Q2G2N6_1_70_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8149 | 8 | 43 | 1.10.10.10 |
| af_A0A1D8PUB1_3_238_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8107 | 10 | 45 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-Q9I4Y3-F1-model_v4 | Transposase | 0.9673 | 1 | 87 |
GO:0003677
GO:0004803 GO:0006313 |
| AF-U9SRC7-F1-model_v4 | Pogo transposable element with krab domain | 0.9626 | 1 | 43 |
GO:0003677
GO:0005634 |
| AF-A0A7U9IXE8-F1-model_v4 | Transposase | 0.9621 | 1 | 87 |
GO:0003677
GO:0004803 GO:0006313 |
| AF-A0A316G3R5-F1-model_v4 | Putative transposase | 0.9604 | 6 | 71 |
GO:0003677
GO:0004803 GO:0006313 |
| AF-A0A1T1ZZQ5-F1-model_v4 | Transposase | 0.9595 | 11 | 87 |
GO:0003677
GO:0004803 GO:0006313 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar