F473000

General Info

Members Datasets Scaffolds Average Seq Length
656 249 656 140

Family's Representative Sequence

Representative Sequence 3300005843|Ga0068860_100092019|Ga0068860_1000920192
Length 163
Sequence LIESAGSGTTLTKSGWRDELVKAEKIELERHEPTPSSAWLIGAVAWFVPGAGHLLLKKWWRALLMGGAVWLCFFLGLAMGGHMFDLSTGQGSSTILQVPPMIANLGTGILYVLSWLMGAGFADDPERARLATYEYGNTFLLIAGLLNYLTMLDAFDVAAGRKP

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
72 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
110 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
111 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
163 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
167 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
168 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
169 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
170 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
171 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
172 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
173 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
174 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
175 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
176 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
177 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
178 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
179 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
180 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
181 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
182 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
183 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
184 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
185 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
186 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
187 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
188 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
189 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
190 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
191 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
192 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
193 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
194 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
195 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
196 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
197 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
198 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
199 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
200 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
201 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
202 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
203 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
204 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
205 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
206 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
207 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
208 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
209 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
210 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
211 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
212 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
213 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
214 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
215 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
216 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
217 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
218 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
219 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
220 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
221 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
222 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
223 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
224 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
225 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
226 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
227 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
228 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
229 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
230 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
231 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
232 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
233 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
234 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
235 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
236 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
237 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
238 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
239 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
240 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
241 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
242 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
243 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
244 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
245 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
246 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
247 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
248 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
249 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.76
Rhizosphere 98.93
Stem 0
Stem Tuber 0
Unclassified 0.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2530518 2162886007 Bacteria 1153
2 MRS1b_contig_2703841 2162886011 Unclassified 855
3 CNAas_1000066 3300000532 Bacteria 7808
4 JGI25406J46586_10192407 3300003203 Bacteria 595
5 rootH2_10324948 3300003320 Unclassified 1147
6 Ga0065704_10320087 3300005289 Unclassified 844
7 Ga0065712_10067736 3300005290 Bacteria 94196
8 Ga0065715_10008821 3300005293 Unclassified 3975
9 Ga0065715_10088966 3300005293 Bacteria 19365
10 Ga0065707_10028325 3300005295 Unclassified 1805
11 Ga0065707_10085415 3300005295 Bacteria 6171
12 Ga0065707_10416361 3300005295 Bacteria 815
13 Ga0070676_10081137 3300005328 Bacteria 1968
14 Ga0070690_100000641 3300005330 Bacteria 17773
15 Ga0070690_100008709 3300005330 Bacteria 5854
16 Ga0070690_100224665 3300005330 Bacteria 1317
17 Ga0070690_100248578 3300005330 Unclassified 1257
18 Ga0070670_100000793 3300005331 Bacteria 24611
19 Ga0070670_100079128 3300005331 Bacteria 2825
20 Ga0070670_100162578 3300005331 Bacteria 1935
21 Ga0070670_100548069 3300005331 Bacteria 1032
22 Ga0070677_10899614 3300005333 Unclassified 511
23 Ga0068869_100016120 3300005334 Bacteria 5032
24 Ga0068869_100019378 3300005334 Bacteria 4647
25 Ga0068869_100370603 3300005334 Unclassified 1172
26 Ga0068869_100603803 3300005334 Unclassified 927
27 Ga0068869_100637793 3300005334 Unclassified 903
28 Ga0068869_101279315 3300005334 Unclassified 646
29 Ga0070666_10066704 3300005335 Unclassified 2443
30 Ga0070680_100000578 3300005336 Bacteria 25221
31 Ga0070680_100001718 3300005336 Bacteria 16067
32 Ga0070680_100634463 3300005336 Unclassified 918
33 Ga0070680_101022813 3300005336 Unclassified 714
34 Ga0070682_100000570 3300005337 Bacteria 22750
35 Ga0070682_100036312 3300005337 Bacteria 3012
36 Ga0070682_100960538 3300005337 Bacteria 706
37 Ga0068868_100012352 3300005338 Bacteria 6240
38 Ga0070660_100017641 3300005339 Bacteria 5205
39 Ga0070689_100000548 3300005340 Bacteria 22434
40 Ga0070689_100169150 3300005340 Bacteria 1770
41 Ga0070689_100232297 3300005340 Bacteria 1516
42 Ga0070689_100526376 3300005340 Bacteria 1016
43 Ga0070689_100878207 3300005340 Unclassified 792
44 Ga0070687_100084542 3300005343 Bacteria 1740
45 Ga0070687_100289367 3300005343 Bacteria 1035
46 Ga0070687_101018361 3300005343 Unclassified 601
47 Ga0070661_100028303 3300005344 Bacteria 4041
48 Ga0070668_100008962 3300005347 Bacteria 7429
49 Ga0070669_100063902 3300005353 Bacteria 2710
50 Ga0070669_101512706 3300005353 Unclassified 583
51 Ga0070669_101586992 3300005353 Unclassified 569
52 Ga0070675_100058200 3300005354 Bacteria 3188
53 Ga0070675_100189659 3300005354 Unclassified 1781
54 Ga0070671_101740523 3300005355 Bacteria 553
55 Ga0070674_100341855 3300005356 Bacteria 1206
56 Ga0070674_100431220 3300005356 Unclassified 1084
57 Ga0070674_100896555 3300005356 Unclassified 772
58 Ga0070673_100104662 3300005364 Bacteria 2337
59 Ga0070673_101427151 3300005364 Bacteria 652
60 Ga0070688_100300094 3300005365 Bacteria 1161
61 Ga0070688_100924312 3300005365 Unclassified 689
62 Ga0070659_102061226 3300005366 Unclassified 513
63 Ga0070667_100136627 3300005367 Unclassified 2144
64 Ga0070703_10055771 3300005406 Unclassified 1277
65 Ga0070709_10226472 3300005434 Bacteria 1336
66 Ga0070701_10026534 3300005438 Unclassified 2826
67 Ga0070701_10426939 3300005438 Unclassified 845
68 Ga0070705_100004570 3300005440 Bacteria 6739
69 Ga0070705_100032957 3300005440 Bacteria 2884
70 Ga0070705_100045622 3300005440 Unclassified 2522
71 Ga0070705_100315713 3300005440 Bacteria 1126
72 Ga0070705_100506344 3300005440 Bacteria 917
73 Ga0070705_100704986 3300005440 Unclassified 793
74 Ga0070700_100037694 3300005441 Unclassified 2942
75 Ga0070700_100077902 3300005441 Bacteria 2133
76 Ga0070700_100080890 3300005441 Unclassified 2098
77 Ga0070700_100333174 3300005441 Bacteria 1119
78 Ga0070700_100725404 3300005441 Unclassified 793
79 Ga0070694_100006659 3300005444 Bacteria 7019
80 Ga0070694_100026410 3300005444 Bacteria 3762
81 Ga0070694_100039808 3300005444 Unclassified 3131
82 Ga0070694_100069167 3300005444 Bacteria 2428
83 Ga0070694_100131146 3300005444 Bacteria 1811
84 Ga0070694_100165906 3300005444 Unclassified 1624
85 Ga0070694_100237112 3300005444 Unclassified 1374
86 Ga0070694_100334412 3300005444 Unclassified 1169
87 Ga0070678_100701219 3300005456 Unclassified 912
88 Ga0070662_100500609 3300005457 Bacteria 1013
89 Ga0070662_100842867 3300005457 Unclassified 780
90 Ga0070681_10000041 3300005458 Bacteria 89178
91 Ga0070681_10138085 3300005458 Bacteria 2367
92 Ga0068867_100077179 3300005459 Bacteria 2502
93 Ga0068867_100146826 3300005459 Bacteria 1849
94 Ga0068867_100449758 3300005459 Bacteria 1097
95 Ga0068867_100993495 3300005459 Unclassified 760
96 Ga0070706_100005960 3300005467 Bacteria 11529
97 Ga0070706_100018070 3300005467 Bacteria 6504
98 Ga0070706_100506473 3300005467 Bacteria 1123
99 Ga0070707_100008507 3300005468 Bacteria 9532
100 Ga0070707_100286367 3300005468 Unclassified 1601
101 Ga0070707_101434671 3300005468 Unclassified 657
102 Ga0070698_100001570 3300005471 Bacteria 25378
103 Ga0070698_100007923 3300005471 Bacteria 11497
104 Ga0070698_100011352 3300005471 Bacteria 9458
105 Ga0070698_100017792 3300005471 Bacteria 7486
106 Ga0070698_100018168 3300005471 Bacteria 7402
107 Ga0070698_100075584 3300005471 Unclassified 3372
108 Ga0070699_100000169 3300005518 Bacteria 63052
109 Ga0070699_100000980 3300005518 Bacteria 26618
110 Ga0070699_100020613 3300005518 Bacteria 5688
111 Ga0070699_100051065 3300005518 Unclassified 3580
112 Ga0070699_100246450 3300005518 Bacteria 1596
113 Ga0070699_100952777 3300005518 Bacteria 787
114 Ga0070679_100000955 3300005530 Bacteria 25142
115 Ga0070679_100613928 3300005530 Unclassified 1031
116 Ga0070697_100001249 3300005536 Bacteria 19212
117 Ga0070697_100015909 3300005536 Bacteria 5911
118 Ga0070697_100051765 3300005536 Bacteria 3337
119 Ga0070697_100077341 3300005536 Bacteria 2737
120 Ga0070697_100290497 3300005536 Bacteria 1404
121 Ga0070697_100301139 3300005536 Unclassified 1378
122 Ga0068853_100023276 3300005539 Bacteria 5183
123 Ga0068853_100237913 3300005539 Unclassified 1668
124 Ga0070672_100078538 3300005543 Bacteria 2641
125 Ga0070686_100001371 3300005544 Bacteria 13763
126 Ga0070686_100005585 3300005544 Bacteria 6965
127 Ga0070686_100015302 3300005544 Bacteria 4440
128 Ga0070686_100133826 3300005544 Bacteria 1717
129 Ga0070695_100033194 3300005545 Bacteria 3229
130 Ga0070695_100033440 3300005545 Unclassified 3217
131 Ga0070695_100148354 3300005545 Unclassified 1634
132 Ga0070695_100207067 3300005545 Unclassified 1405
133 Ga0070695_100312936 3300005545 Bacteria 1164
134 Ga0070695_100522003 3300005545 Unclassified 921
135 Ga0070695_100526977 3300005545 Bacteria 918
136 Ga0070695_100680878 3300005545 Unclassified 815
137 Ga0070695_101168978 3300005545 Unclassified 632
138 Ga0070696_100038719 3300005546 Unclassified 3291
139 Ga0070696_100071082 3300005546 Bacteria 2448
140 Ga0070696_100080442 3300005546 Bacteria 2307
141 Ga0070696_100497681 3300005546 Bacteria 969
142 Ga0070696_100556121 3300005546 Unclassified 920
143 Ga0070696_100616561 3300005546 Bacteria 876
144 Ga0070696_100677561 3300005546 Bacteria 839
145 Ga0070696_100742564 3300005546 Bacteria 803
146 Ga0070696_101362650 3300005546 Unclassified 604
147 Ga0070696_101521236 3300005546 Unclassified 573
148 Ga0070696_101744563 3300005546 Unclassified 537
149 Ga0070693_100020783 3300005547 Unclassified 3469
150 Ga0070693_100027954 3300005547 Bacteria 3062
151 Ga0070693_100044478 3300005547 Bacteria 2512
152 Ga0070693_100057943 3300005547 Bacteria 2241
153 Ga0070693_100104883 3300005547 Bacteria 1728
154 Ga0070693_100252258 3300005547 Bacteria 1170
155 Ga0070693_100537418 3300005547 Unclassified 835
156 Ga0070693_100845542 3300005547 Bacteria 682
157 Ga0070693_100882560 3300005547 Unclassified 669
158 Ga0070693_101469292 3300005547 Unclassified 532
159 Ga0070665_100237253 3300005548 Bacteria 1824
160 Ga0070665_100331573 3300005548 Unclassified 1526
161 Ga0070665_102332044 3300005548 Unclassified 538
162 Ga0070704_100102689 3300005549 Bacteria 2158
163 Ga0070704_100182498 3300005549 Bacteria 1680
164 Ga0070704_100226739 3300005549 Bacteria 1522
165 Ga0070704_100280816 3300005549 Bacteria 1379
166 Ga0070704_100459256 3300005549 Unclassified 1098
167 Ga0068855_100452441 3300005563 Bacteria 1401
168 Ga0068855_100528694 3300005563 Unclassified 1279
169 Ga0068855_100893551 3300005563 Bacteria 939
170 Ga0070664_100000280 3300005564 Bacteria 36774
171 Ga0070664_100119898 3300005564 Unclassified 2302
172 Ga0070664_102175883 3300005564 Bacteria 526
173 Ga0068857_100122099 3300005577 Bacteria 2346
174 Ga0068857_100212738 3300005577 Bacteria 1764
175 Ga0068857_100349003 3300005577 Unclassified 1370
176 Ga0068857_100653258 3300005577 Unclassified 997
177 Ga0068857_100760759 3300005577 Unclassified 923
178 Ga0068857_100836303 3300005577 Unclassified 880
179 Ga0068857_102321465 3300005577 Unclassified 527
180 Ga0068854_100032703 3300005578 Bacteria 3620
181 Ga0068854_100164158 3300005578 Bacteria 1723
182 Ga0068854_101715774 3300005578 Bacteria 574
183 Ga0070702_100006101 3300005615 Bacteria 5680
184 Ga0070702_100033570 3300005615 Unclassified 2823
185 Ga0070702_100101099 3300005615 Bacteria 1768
186 Ga0070702_100447637 3300005615 Unclassified 936
187 Ga0068852_100701405 3300005616 Bacteria 1022
188 Ga0068859_100025877 3300005617 Bacteria 5887
189 Ga0068859_100029302 3300005617 Bacteria 5523
190 Ga0068859_100070298 3300005617 Bacteria 3536
191 Ga0068859_100133157 3300005617 Bacteria 2558
192 Ga0068859_100303936 3300005617 Bacteria 1689
193 Ga0068859_100365645 3300005617 Bacteria 1538
194 Ga0068859_100766061 3300005617 Unclassified 1054
195 Ga0068859_101277854 3300005617 Bacteria 809
196 Ga0068864_100006535 3300005618 Bacteria 9549
197 Ga0068864_100008450 3300005618 Bacteria 8495
198 Ga0068864_100061563 3300005618 Bacteria 3251
199 Ga0068864_100084118 3300005618 Bacteria 2795
200 Ga0068864_100280836 3300005618 Unclassified 1554
201 Ga0068861_100014624 3300005719 Bacteria 5510
202 Ga0068861_100016533 3300005719 Bacteria 5222
203 Ga0068861_100139219 3300005719 Bacteria 1979
204 Ga0068861_100227236 3300005719 Unclassified 1581
205 Ga0068861_100381937 3300005719 Unclassified 1245
206 Ga0068861_100418111 3300005719 Bacteria 1194
207 Ga0068861_100908791 3300005719 Bacteria 834
208 Ga0068851_10001259 3300005834 Bacteria 11028
209 Ga0068851_10237553 3300005834 Unclassified 1029
210 Ga0068870_10020860 3300005840 Bacteria 3197
211 Ga0068870_10135920 3300005840 Bacteria 1433
212 Ga0068863_100038388 3300005841 Bacteria 4556
213 Ga0068863_100478103 3300005841 Unclassified 1225
214 Ga0068858_100135158 3300005842 Unclassified 2313
215 Ga0068858_100169903 3300005842 Bacteria 2055
216 Ga0068858_100530465 3300005842 Unclassified 1139
217 Ga0068860_100044023 3300005843 Unclassified 4256
218 Ga0068860_100092019 3300005843 Bacteria 2889
219 Ga0068860_100093365 3300005843 Bacteria 2868
220 Ga0068860_100510401 3300005843 Unclassified 1201
221 Ga0068860_101756984 3300005843 Unclassified 642
222 Ga0068862_100003102 3300005844 Archaea 14486
223 Ga0068862_100085631 3300005844 Unclassified 2739
224 Ga0068862_100124211 3300005844 Bacteria 2278
225 Ga0068862_100707901 3300005844 Bacteria 976
226 Ga0068862_101070959 3300005844 Bacteria 800
227 Ga0081539_10006263 3300005985 Bacteria 11516
228 Ga0070716_100000012 3300006173 Bacteria 104713
229 Ga0070716_100795099 3300006173 Unclassified 732
230 Ga0097621_100122322 3300006237 Unclassified 2208
231 Ga0068871_100004614 3300006358 Bacteria 9619
232 Ga0068871_100524317 3300006358 Unclassified 1070
233 Ga0075428_100198369 3300006844 Bacteria 2170
234 Ga0075428_101920198 3300006844 Unclassified 615
235 Ga0075430_100210691 3300006846 Unclassified 1612
236 Ga0075431_100259055 3300006847 Bacteria 1765
237 Ga0075433_10080606 3300006852 Bacteria 2870
238 Ga0075433_10222188 3300006852 Unclassified 1678
239 Ga0075433_10311108 3300006852 Bacteria 1394
240 Ga0075433_10380265 3300006852 Bacteria 1247
241 Ga0075433_10407300 3300006852 Unclassified 1200
242 Ga0075433_10555238 3300006852 Unclassified 1009
243 Ga0075433_10607392 3300006852 Unclassified 960
244 Ga0075433_10639284 3300006852 Bacteria 933
245 Ga0075433_11112375 3300006852 Unclassified 687
246 Ga0075433_11203234 3300006852 Unclassified 657
247 Ga0075434_100141130 3300006871 Bacteria 2429
248 Ga0075434_100248628 3300006871 Bacteria 1797
249 Ga0075434_100267820 3300006871 Bacteria 1728
250 Ga0075434_100445819 3300006871 Bacteria 1315
251 Ga0075434_100555824 3300006871 Bacteria 1167
252 Ga0075434_101531921 3300006871 Unclassified 676
253 Ga0075429_101712404 3300006880 Unclassified 546
254 Ga0068865_100169397 3300006881 Bacteria 1673
255 Ga0068865_100834728 3300006881 Bacteria 797
256 Ga0068865_101082388 3300006881 Unclassified 705
257 Ga0075436_100000008 3300006914 Bacteria 279288
258 Ga0097620_100022921 3300006931 Bacteria 6261
259 Ga0097620_100025876 3300006931 Bacteria 5887
260 Ga0097620_100029302 3300006931 Bacteria 5523
261 Ga0097620_100070298 3300006931 Bacteria 3536
262 Ga0097620_100133147 3300006931 Bacteria 2558
263 Ga0097620_100303954 3300006931 Bacteria 1689
264 Ga0097620_100365624 3300006931 Bacteria 1538
265 Ga0097620_100766002 3300006931 Unclassified 1054
266 Ga0097620_101277914 3300006931 Bacteria 809
267 Ga0075435_100000657 3300007076 Bacteria 21295
268 Ga0075435_100333078 3300007076 Bacteria 1300
269 Ga0075435_100518848 3300007076 Bacteria 1031
270 Ga0075435_100623357 3300007076 Bacteria 936
271 Ga0105250_10237989 3300009092 Bacteria 776
272 Ga0105240_10033105 3300009093 Bacteria 6682
273 Ga0105240_11672592 3300009093 Unclassified 665
274 Ga0111539_10066768 3300009094 Bacteria 4249
275 Ga0111539_10075347 3300009094 Bacteria 3975
276 Ga0111539_10407401 3300009094 Unclassified 1584
277 Ga0111539_10791953 3300009094 Bacteria 1103
278 Ga0111539_11332911 3300009094 Bacteria 833
279 Ga0111539_11632552 3300009094 Unclassified 748
280 Ga0105245_10031484 3300009098 Bacteria 4695
281 Ga0105245_10243687 3300009098 Bacteria 1744
282 Ga0105247_10000022 3300009101 Bacteria 219796
283 Ga0105247_10050406 3300009101 Unclassified 2562
284 Ga0105247_10050783 3300009101 Bacteria 2552
285 Ga0114129_10010729 3300009147 Bacteria 13061
286 Ga0114129_10012953 3300009147 Bacteria 11870
287 Ga0114129_10024247 3300009147 Bacteria 8595
288 Ga0114129_10032222 3300009147 Bacteria 7407
289 Ga0114129_10071099 3300009147 Unclassified 4852
290 Ga0114129_10148006 3300009147 Unclassified 3215
291 Ga0114129_10287436 3300009147 Bacteria 2195
292 Ga0114129_10295788 3300009147 Bacteria 2160
293 Ga0114129_10523028 3300009147 Bacteria 1546
294 Ga0114129_10632452 3300009147 Bacteria 1383
295 Ga0105243_10089093 3300009148 Bacteria 2536
296 Ga0105243_10123361 3300009148 Bacteria 2188
297 Ga0105243_10137616 3300009148 Bacteria 2080
298 Ga0105243_10281928 3300009148 Bacteria 1497
299 Ga0105241_10035999 3300009174 Bacteria 3724
300 Ga0105241_10151114 3300009174 Bacteria 1900
301 Ga0105241_10399327 3300009174 Bacteria 1205
302 Ga0105241_10447469 3300009174 Unclassified 1142
303 Ga0105242_10030053 3300009176 Bacteria 4337
304 Ga0105242_11175649 3300009176 Unclassified 785
305 Ga0105248_10009310 3300009177 Bacteria 10815
306 Ga0105248_10014875 3300009177 Bacteria 8571
307 Ga0105248_10017565 3300009177 Bacteria 7890
308 Ga0105248_10017834 3300009177 Bacteria 7835
309 Ga0105248_10019260 3300009177 Bacteria 7552
310 Ga0105248_10376981 3300009177 Bacteria 1597
311 Ga0105237_10002331 3300009545 Bacteria 23574
312 Ga0105237_10023809 3300009545 Bacteria 6268
313 Ga0105249_10003383 3300009553 Bacteria 13814
314 Ga0105249_10063590 3300009553 Unclassified 3391
315 Ga0105249_10180662 3300009553 Bacteria 2052
316 Ga0105249_10441316 3300009553 Unclassified 1339
317 Ga0105249_11240701 3300009553 Unclassified 817
318 Ga0105249_11375886 3300009553 Unclassified 778
319 Ga0105239_10169708 3300010375 Bacteria 2439
320 Ga0105239_10689382 3300010375 Unclassified 1168
321 Ga0105239_11038816 3300010375 Unclassified 943
322 Ga0105239_11075455 3300010375 Bacteria 926
323 Ga0157373_10006812 3300013100 Bacteria 8510
324 Ga0157373_10074546 3300013100 Bacteria 2394
325 Ga0157373_10940040 3300013100 Bacteria 643
326 Ga0157374_10214858 3300013296 Bacteria 1886
327 Ga0157374_10361457 3300013296 Bacteria 1444
328 Ga0157378_10015696 3300013297 Bacteria 6632
329 Ga0157378_10042680 3300013297 Bacteria 4025
330 Ga0157378_10083853 3300013297 Bacteria 2885
331 Ga0157378_10132132 3300013297 Bacteria 2312
332 Ga0157378_10169726 3300013297 Bacteria 2045
333 Ga0157378_10307048 3300013297 Unclassified 1537
334 Ga0157378_10310127 3300013297 Bacteria 1530
335 Ga0157378_11043065 3300013297 Bacteria 853
336 Ga0157378_11187219 3300013297 Unclassified 802
337 Ga0157378_11688129 3300013297 Unclassified 680
338 Ga0157378_12214839 3300013297 Unclassified 601
339 Ga0163162_10000211 3300013306 Bacteria 54106
340 Ga0163162_10016961 3300013306 Bacteria 7124
341 Ga0163162_10065551 3300013306 Bacteria 3679
342 Ga0163162_10140917 3300013306 Bacteria 2524
343 Ga0163162_10647944 3300013306 Bacteria 1180
344 Ga0163162_11186863 3300013306 Unclassified 866
345 Ga0163162_11928368 3300013306 Unclassified 676
346 Ga0157372_10106832 3300013307 Bacteria 3202
347 Ga0157372_10723993 3300013307 Bacteria 1157
348 Ga0157375_10026487 3300013308 Bacteria 5404
349 Ga0157375_10139066 3300013308 Bacteria 2554
350 Ga0157375_10194525 3300013308 Bacteria 2183
351 Ga0157375_10402460 3300013308 Unclassified 1535
352 Ga0157375_10694618 3300013308 Bacteria 1171
353 Ga0157375_11374088 3300013308 Unclassified 832
354 Ga0157375_12394264 3300013308 Unclassified 630
355 Ga0163163_10106971 3300014325 Unclassified 2823
356 Ga0163163_10115482 3300014325 Bacteria 2716
357 Ga0163163_10121817 3300014325 Bacteria 2643
358 Ga0163163_10131326 3300014325 Bacteria 2545
359 Ga0163163_10339077 3300014325 Bacteria 1558
360 Ga0163163_10559558 3300014325 Unclassified 1206
361 Ga0163163_10729900 3300014325 Bacteria 1054
362 Ga0157380_10000458 3300014326 Bacteria 24909
363 Ga0157380_10004242 3300014326 Bacteria 9917
364 Ga0157380_10017254 3300014326 Bacteria 5341
365 Ga0157380_10106964 3300014326 Bacteria 2342
366 Ga0157380_10450837 3300014326 Unclassified 1235
367 Ga0157380_10979145 3300014326 Bacteria 878
368 Ga0157380_11082871 3300014326 Unclassified 839
369 Ga0157380_11083649 3300014326 Unclassified 839
370 Ga0157380_13266517 3300014326 Unclassified 518
371 Ga0157377_10026346 3300014745 Bacteria 3111
372 Ga0157377_10197640 3300014745 Bacteria 1275
373 Ga0157377_11259257 3300014745 Unclassified 576
374 Ga0157377_11360540 3300014745 Unclassified 558
375 Ga0157379_10253503 3300014968 Unclassified 1598
376 Ga0157379_10433325 3300014968 Bacteria 1212
377 Ga0157379_10560298 3300014968 Bacteria 1064
378 Ga0157376_10023487 3300014969 Unclassified 4825
379 Ga0182007_10047454 3300015262 Bacteria 1420
380 Ga0163161_10184212 3300017792 Unclassified 1602
381 Ga0207656_10001046 3300025321 Bacteria 9052
382 Ga0207656_10256353 3300025321 Unclassified 858
383 Ga0207642_10052144 3300025899 Bacteria 1854
384 Ga0207710_10085947 3300025900 Bacteria 1465
385 Ga0207688_10063821 3300025901 Bacteria 2078
386 Ga0207680_10284890 3300025903 Bacteria 1149
387 Ga0207647_10103692 3300025904 Bacteria 1686
388 Ga0207699_10644239 3300025906 Unclassified 774
389 Ga0207643_10000647 3300025908 Bacteria 21741
390 Ga0207643_10225307 3300025908 Bacteria 1149
391 Ga0207643_10410547 3300025908 Unclassified 857
392 Ga0207684_10000076 3300025910 Bacteria 183107
393 Ga0207684_10136755 3300025910 Bacteria 2104
394 Ga0207654_10248765 3300025911 Unclassified 1191
395 Ga0207654_10377527 3300025911 Unclassified 981
396 Ga0207654_11097219 3300025911 Unclassified 580
397 Ga0207707_10000077 3300025912 Bacteria 100255
398 Ga0207707_10132876 3300025912 Bacteria 2176
399 Ga0207707_10783846 3300025912 Unclassified 795
400 Ga0207707_11233302 3300025912 Bacteria 604
401 Ga0207695_10035380 3300025913 Bacteria 5417
402 Ga0207695_10497787 3300025913 Unclassified 1101
403 Ga0207671_10013536 3300025914 Bacteria 6496
404 Ga0207671_10065685 3300025914 Bacteria 2699
405 Ga0207660_10003294 3300025917 Bacteria 10566
406 Ga0207660_10054506 3300025917 Bacteria 2854
407 Ga0207660_11344826 3300025917 Unclassified 580
408 Ga0207660_11622150 3300025917 Unclassified 521
409 Ga0207649_10434713 3300025920 Unclassified 988
410 Ga0207652_10000096 3300025921 Bacteria 96047
411 Ga0207652_10052088 3300025921 Bacteria 3511
412 Ga0207652_11136367 3300025921 Unclassified 682
413 Ga0207646_10037160 3300025922 Bacteria 4392
414 Ga0207646_10117585 3300025922 Unclassified 2388
415 Ga0207646_10297368 3300025922 Bacteria 1458
416 Ga0207646_10515361 3300025922 Bacteria 1077
417 Ga0207646_10589550 3300025922 Bacteria 998
418 Ga0207681_10012688 3300025923 Bacteria 5203
419 Ga0207681_10066931 3300025923 Bacteria 2488
420 Ga0207681_10447159 3300025923 Unclassified 1051
421 Ga0207681_10823485 3300025923 Unclassified 776
422 Ga0207681_11014575 3300025923 Bacteria 696
423 Ga0207650_10000046 3300025925 Bacteria 178190
424 Ga0207650_10051485 3300025925 Bacteria 3048
425 Ga0207650_10067177 3300025925 Unclassified 2690
426 Ga0207650_10213375 3300025925 Bacteria 1551
427 Ga0207659_10133275 3300025926 Bacteria 1921
428 Ga0207659_10180294 3300025926 Bacteria 1673
429 Ga0207644_10085138 3300025931 Bacteria 2344
430 Ga0207644_10350548 3300025931 Unclassified 1198
431 Ga0207644_10559365 3300025931 Bacteria 947
432 Ga0207690_10273905 3300025932 Unclassified 1312
433 Ga0207706_10093709 3300025933 Bacteria 2641
434 Ga0207706_10440014 3300025933 Bacteria 1129
435 Ga0207706_10769731 3300025933 Bacteria 819
436 Ga0207706_10849966 3300025933 Unclassified 773
437 Ga0207686_10676344 3300025934 Unclassified 818
438 Ga0207686_11102442 3300025934 Bacteria 647
439 Ga0207709_10264476 3300025935 Bacteria 1263
440 Ga0207670_10000763 3300025936 Bacteria 16922
441 Ga0207670_10012111 3300025936 Bacteria 5032
442 Ga0207670_10803206 3300025936 Unclassified 784
443 Ga0207669_10454225 3300025937 Bacteria 1016
444 Ga0207704_10046662 3300025938 Bacteria 2584
445 Ga0207665_10000083 3300025939 Bacteria 61629
446 Ga0207665_10305231 3300025939 Bacteria 1191
447 Ga0207665_10740284 3300025939 Bacteria 775
448 Ga0207691_11005150 3300025940 Bacteria 696
449 Ga0207711_10011687 3300025941 Bacteria 7295
450 Ga0207711_10039251 3300025941 Unclassified 4027
451 Ga0207711_10049360 3300025941 Bacteria 3603
452 Ga0207711_10106759 3300025941 Bacteria 2485
453 Ga0207711_10457213 3300025941 Bacteria 1189
454 Ga0207689_10001656 3300025942 Archaea 21117
455 Ga0207689_10032217 3300025942 Bacteria 4361
456 Ga0207689_10033563 3300025942 Bacteria 4264
457 Ga0207689_10214880 3300025942 Unclassified 1589
458 Ga0207689_10659302 3300025942 Bacteria 882
459 Ga0207689_10880028 3300025942 Unclassified 756
460 Ga0207689_11061889 3300025942 Unclassified 683
461 Ga0207679_10092924 3300025945 Bacteria 2338
462 Ga0207679_10116393 3300025945 Unclassified 2119
463 Ga0207679_10465659 3300025945 Unclassified 1123
464 Ga0207679_10814893 3300025945 Unclassified 851
465 Ga0207667_10486139 3300025949 Unclassified 1253
466 Ga0207651_10135034 3300025960 Bacteria 1896
467 Ga0207651_11802035 3300025960 Bacteria 551
468 Ga0207712_10000180 3300025961 Bacteria 65420
469 Ga0207712_11854099 3300025961 Unclassified 540
470 Ga0207668_10005528 3300025972 Bacteria 7453
471 Ga0207640_10190588 3300025981 Unclassified 1545
472 Ga0207640_10628401 3300025981 Unclassified 912
473 Ga0207658_10340553 3300025986 Bacteria 1303
474 Ga0207677_10968582 3300026023 Bacteria 770
475 Ga0207703_10063880 3300026035 Bacteria 3020
476 Ga0207703_10112040 3300026035 Bacteria 2330
477 Ga0207703_10159045 3300026035 Unclassified 1977
478 Ga0207703_10275022 3300026035 Unclassified 1527
479 Ga0207639_10226276 3300026041 Bacteria 1618
480 Ga0207708_10001596 3300026075 Bacteria 16898
481 Ga0207708_10002110 3300026075 Archaea 14647
482 Ga0207708_10049837 3300026075 Unclassified 3189
483 Ga0207708_10287383 3300026075 Unclassified 1334
484 Ga0207702_11352997 3300026078 Bacteria 706
485 Ga0207641_10029830 3300026088 Bacteria 4511
486 Ga0207641_11350037 3300026088 Unclassified 714
487 Ga0207648_10100305 3300026089 Bacteria 2536
488 Ga0207648_10194024 3300026089 Unclassified 1800
489 Ga0207648_10402158 3300026089 Bacteria 1241
490 Ga0207676_10027189 3300026095 Bacteria 4259
491 Ga0207676_10036154 3300026095 Bacteria 3755
492 Ga0207676_10566753 3300026095 Unclassified 1087
493 Ga0207676_10686951 3300026095 Unclassified 990
494 Ga0207674_10000525 3300026116 Bacteria 50323
495 Ga0207674_10333436 3300026116 Unclassified 1467
496 Ga0207674_10554132 3300026116 Unclassified 1111
497 Ga0207674_11345543 3300026116 Bacteria 684
498 Ga0207674_11388719 3300026116 Unclassified 672
499 Ga0207674_12120573 3300026116 Bacteria 526
500 Ga0207675_100002078 3300026118 Bacteria 19905
501 Ga0207675_100008022 3300026118 Bacteria 9948
502 Ga0207675_100042397 3300026118 Bacteria 4249
503 Ga0207675_100094682 3300026118 Unclassified 2809
504 Ga0207675_100135471 3300026118 Bacteria 2337
505 Ga0207675_100314590 3300026118 Bacteria 1527
506 Ga0207675_100890079 3300026118 Unclassified 906
507 Ga0207675_101983361 3300026118 Unclassified 600
508 Ga0207683_10816234 3300026121 Unclassified 866
509 Ga0207698_10298801 3300026142 Bacteria 1498
510 Ga0207428_11008619 3300027907 Unclassified 585
511 Ga0268266_10272964 3300028379 Unclassified 1570
512 Ga0268265_10044278 3300028380 Bacteria 3313
513 Ga0268265_10121529 3300028380 Unclassified 2152
514 Ga0268265_10134589 3300028380 Bacteria 2060
515 Ga0268265_10312769 3300028380 Unclassified 1419
516 Ga0268265_12482769 3300028380 Unclassified 524
517 Ga0268264_10204624 3300028381 Bacteria 1808
518 Ga0268264_10296213 3300028381 Unclassified 1521
519 Ga0268264_10310489 3300028381 Unclassified 1488
520 Ga0268264_11250357 3300028381 Bacteria 752
521 Ga0314311_1182293 3300030733 Unclassified 897
522 Ga0316182_1226790 3300030745 Bacteria 1269
523 Ga0307513_10379700 3300031456 Bacteria 1153
524 Ga0307408_100001826 3300031548 Bacteria 15513
525 Ga0307405_10313060 3300031731 Unclassified 1196
526 Ga0307405_10371494 3300031731 Unclassified 1110
527 Ga0307413_10132294 3300031824 Bacteria 1710
528 Ga0307413_11132243 3300031824 Unclassified 677
529 Ga0307410_10295896 3300031852 Unclassified 1275
530 Ga0307410_10934100 3300031852 Unclassified 745
531 Ga0307406_10098592 3300031901 Bacteria 1984
532 Ga0307412_10008770 3300031911 Bacteria 5788
533 Ga0307412_10061834 3300031911 Unclassified 2519
534 Ga0307412_10086405 3300031911 Bacteria 2182
535 Ga0307412_10136563 3300031911 Bacteria 1790
536 Ga0307412_10411338 3300031911 Bacteria 1104
537 Ga0307409_101193563 3300031995 Bacteria 784
538 Ga0307416_100096334 3300032002 Bacteria 2558
539 Ga0307416_100214558 3300032002 Bacteria 1839
540 Ga0307416_101105258 3300032002 Unclassified 897
541 Ga0307414_10061215 3300032004 Bacteria 2665
542 Ga0307414_10110428 3300032004 Bacteria 2092
543 Ga0307414_10257688 3300032004 Unclassified 1454
544 Ga0307415_100014139 3300032126 Bacteria 4681
545 Ga0307415_100064647 3300032126 Bacteria 2546
546 Ga0307415_100262921 3300032126 Bacteria 1409
547 Ga0373948_0084537 3300034817 Bacteria 729
548 Ga0373932_0120749 3300035112 Unclassified 874
549 Ga0373941_0127320 3300035115 Bacteria 914
550 Ga0373955_0262993 3300035172 Bacteria 1036
551 Ga0373937_0363148 3300036401 Unclassified 1372
552 Ga0395899_0593758 3300037312 Unclassified 706
553 Ga0395900_0715596 3300037418 Bacteria 934
554 Ga0395900_0794110 3300037418 Unclassified 875
555 Ga0395898_0094590 3300037466 Unclassified 2872
556 Ga0395901_0270921 3300038443 Bacteria 1766
557 Ga0395901_0328652 3300038443 Bacteria 1581
558 Ga0395901_0884954 3300038443 Bacteria 876
559 Ga0242420_019812 3300038996 Unclassified 1193
560 Ga0439433_0046014 3300041999 Unclassified 1022
561 Ga0439448_0083464 3300042005 Bacteria 1075
562 Ga0439455_0099901 3300042012 Bacteria 801
563 Ga0450888_019589 3300042126 Unclassified 854
564 Ga0439458_0023958 3300042157 Bacteria 1425
565 Ga0439464_0061793 3300042439 Bacteria 1097
566 Ga0495663_0000636 3300046525 Bacteria 12174
567 Ga0495640_0973082 3300046533 Unclassified 501
568 Ga0495598_0000339 3300046537 Bacteria 8340
569 Ga0495621_0001370 3300046539 Bacteria 6311
570 Ga0495636_0182103 3300047318 Bacteria 954
571 Ga0496104_0142126 3300048907 Bacteria 2306
572 Ga0496107_0061191 3300048910 Unclassified 2726
573 Ga0496108_0161836 3300048911 Unclassified 1935
574 Ga0496110_0593813 3300048913 Bacteria 1005
575 Ga0496112_0236170 3300048915 Bacteria 1782
576 Ga0501291_001731 3300049514 Unclassified 2547
577 Ga0501291_034570 3300049514 Unclassified 866
578 Ga0501298_002776 3300049521 Unclassified 2678
579 Ga0501299_019221 3300049522 Unclassified 1234
580 Ga0501300_027137 3300049523 Unclassified 841
581 Ga0501198_004315 3300049649 Unclassified 1970
582 Ga0501198_084040 3300049649 Bacteria 621
583 Ga0501199_009127 3300049650 Bacteria 1046
584 Ga0501201_005143 3300049651 Unclassified 1220
585 Ga0501202_019797 3300049652 Unclassified 1333
586 Ga0501202_127312 3300049652 Unclassified 646
587 Ga0501207_007766 3300049654 Bacteria 1537
588 Ga0501208_140957 3300049655 Unclassified 543
589 Ga0501214_007509 3300049659 Bacteria 1119
590 Ga0501216_007629 3300049660 Bacteria 1688
591 Ga0501217_023767 3300049661 Bacteria 1462
592 Ga0501223_005860 3300049663 Bacteria 2565
593 Ga0501224_010073 3300049664 Unclassified 1385
594 Ga0501227_022977 3300049665 Bacteria 1446
595 Ga0501227_026886 3300049665 Unclassified 1359
596 Ga0501227_034899 3300049665 Unclassified 1222
597 Ga0501233_007158 3300049668 Bacteria 2118
598 Ga0501233_018233 3300049668 Bacteria 1474
599 Ga0501235_029867 3300049669 Bacteria 1228
600 Ga0501235_078570 3300049669 Unclassified 787
601 Ga0501243_004218 3300049675 Bacteria 2152
602 Ga0501247_034983 3300049677 Bacteria 700
603 Ga0501256_012121 3300049685 Unclassified 838
604 Ga0501257_070119 3300049686 Unclassified 895
605 Ga0501260_000603 3300049689 Bacteria 2780
606 Ga0501260_005180 3300049689 Bacteria 1221
607 Ga0501261_023683 3300049690 Bacteria 895
608 Ga0501225_0006653 3300049705 Unclassified 3370
609 Ga0501225_0013154 3300049705 Bacteria 2318
610 Ga0501225_0014486 3300049705 Bacteria 2202
611 Ga0501229_011982 3300049706 Bacteria 1103
612 Ga0501234_003604 3300049707 Bacteria 2433
613 Ga0501234_048558 3300049707 Unclassified 704
614 Ga0501245_032846 3300049708 Unclassified 864
615 Ga0501245_162982 3300049708 Unclassified 501
616 Ga0501266_045456 3300049763 Bacteria 665
617 Ga0501268_008749 3300049765 Bacteria 1542
618 Ga0501270_018536 3300049767 Bacteria 1032
619 Ga0501273_003402 3300049770 Bacteria 1688
620 Ga0501280_122909 3300049776 Bacteria 516
621 Ga0501283_001262 3300049779 Unclassified 3341
622 Ga0501283_004329 3300049779 Bacteria 1914
623 Ga0501212_002532 3300049851 Bacteria 2212
624 Ga0501212_003304 3300049851 Bacteria 2015
625 Ga0501226_005410 3300049853 Bacteria 1458
626 Ga0501226_006765 3300049853 Bacteria 1293
627 nmdc:mga05p37_131935_c1 3300050507 Bacteria 3065
628 nmdc:mga05p37_15875_c1 3300050507 Bacteria 9058
629 nmdc:mga05p37_187251_c1 3300050507 Bacteria 2516
630 nmdc:mga05p37_219182_c1 3300050507 Unclassified 2297
631 nmdc:mga05p37_286014_c1 3300050507 Unclassified 1964
632 nmdc:mga05p37_320707_c1 3300050507 Unclassified 1834
633 nmdc:mga05p37_45836_c1 3300050507 Bacteria 5377
634 nmdc:mga05p37_527028_c1 3300050507 Bacteria 1350
635 nmdc:mga05p37_70907_c1 3300050507 Bacteria 4286
636 nmdc:mga0qj67_227233_c1 3300050509 Bacteria 1515
637 nmdc:mga06r32_303513_c1 3300050510 Bacteria 1582
638 nmdc:mga06r32_321541_c1 3300050510 Bacteria 1533
639 nmdc:mga08y16_135452_c1 3300050511 Unclassified 2560
640 nmdc:mga08y16_323049_c1 3300050511 Unclassified 1588
641 nmdc:mga08y16_440686_c1 3300050511 Unclassified 1330
642 nmdc:mga08y16_479522_c1 3300050511 Unclassified 1266
643 nmdc:mga0n895_84297_c1 3300050512 Bacteria 3171
644 nmdc:mga0n895_85872_c1 3300050512 Bacteria 3142
645 nmdc:mga0rr50_1013525_c1 3300050513 Unclassified 707
646 nmdc:mga0rr50_490209_c1 3300050513 Unclassified 1044
647 nmdc:mga0rr50_910668_c1 3300050513 Unclassified 750
648 nmdc:mga08x19_582478_c1 3300050514 Bacteria 792
649 nmdc:mga0a205_13111_c1 3300050515 Bacteria 7699
650 nmdc:mga0a205_14052_c1 3300050515 Bacteria 7468
651 nmdc:mga0a205_43154_c1 3300050515 Unclassified 4348
652 nmdc:mga0a205_550247_c1 3300050515 Unclassified 1009
653 nmdc:mga0a205_582513_c1 3300050515 Bacteria 973
654 nmdc:mga0a205_70579_c1 3300050515 Unclassified 3372
655 nmdc:mga0a205_9683_c1 3300050515 Bacteria 8824
656 Ga0501082_1340016 3300060353 Unclassified 625

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025922 Ga0207646_10037160 Ga0207646_100371602 109
2 3300028380 Ga0268265_10121529 Ga0268265_101215294 112
3 3300005577 Ga0068857_100122099 Ga0068857_1001220993 114
4 3300005333 Ga0070677_10899614 Ga0070677_108996141 115
5 3300005471 Ga0070698_100017792 Ga0070698_1000177926 115
6 3300005471 Ga0070698_100007923 Ga0070698_1000079235 116
7 3300005719 Ga0068861_100139219 Ga0068861_1001392192 116
8 3300026118 Ga0207675_100135471 Ga0207675_1001354712 116
9 3300013306 Ga0163162_11186863 Ga0163162_111868631 117
10 3300005546 Ga0070696_100038719 Ga0070696_1000387192 118
11 3300032002 Ga0307416_101105258 Ga0307416_1011052582 118
12 3300005518 Ga0070699_100051065 Ga0070699_1000510653 119
13 3300005440 Ga0070705_100506344 Ga0070705_1005063441 120
14 3300005467 Ga0070706_100005960 Ga0070706_10000596012 120
15 3300006358 Ga0068871_100524317 Ga0068871_1005243171 120
16 3300046533 Ga0495640_0973082 Ga0495640_0973082_78_443 120
17 3300005440 Ga0070705_100045622 Ga0070705_1000456222 121
18 3300005546 Ga0070696_100677561 Ga0070696_1006775611 121
19 3300005549 Ga0070704_100182498 Ga0070704_1001824982 121
20 3300031456 Ga0307513_10379700 Ga0307513_103797002 121
21 3300038996 Ga0242420_019812 Ga0242420_019812_752_1120 121
22 3300005289 Ga0065704_10320087 Ga0065704_103200871 123
23 3300005293 Ga0065715_10008821 Ga0065715_100088214 123
24 3300005356 Ga0070674_100896555 Ga0070674_1008965551 123
25 3300005441 Ga0070700_100333174 Ga0070700_1003331741 123
26 3300005468 Ga0070707_101434671 Ga0070707_1014346711 123
27 3300005544 Ga0070686_100005585 Ga0070686_1000055856 123
28 3300005548 Ga0070665_102332044 Ga0070665_1023320441 123
29 3300005564 Ga0070664_100119898 Ga0070664_1001198981 123
30 3300005577 Ga0068857_100349003 Ga0068857_1003490033 123
31 3300005618 Ga0068864_100280836 Ga0068864_1002808362 123
32 3300009147 Ga0114129_10523028 Ga0114129_105230281 123
33 3300009148 Ga0105243_10089093 Ga0105243_100890934 123
34 3300009174 Ga0105241_10399327 Ga0105241_103993273 123
35 3300013297 Ga0157378_11688129 Ga0157378_116881291 123
36 3300014326 Ga0157380_10000458 Ga0157380_1000045813 123
37 3300025922 Ga0207646_10589550 Ga0207646_105895503 123
38 3300025936 Ga0207670_10012111 Ga0207670_100121115 123
39 3300025942 Ga0207689_10032217 Ga0207689_100322174 123
40 3300025945 Ga0207679_10465659 Ga0207679_104656591 123
41 3300025960 Ga0207651_11802035 Ga0207651_118020351 123
42 3300026088 Ga0207641_11350037 Ga0207641_113500372 123
43 3300026116 Ga0207674_10554132 Ga0207674_105541321 123
44 3300042126 Ga0450888_019589 Ga0450888_019589_442_816 123
45 3300046525 Ga0495663_0000636 Ga0495663_0000636_3303_3677 123
46 3300046539 Ga0495621_0001370 Ga0495621_0001370_1563_1937 123
47 3300047318 Ga0495636_0182103 Ga0495636_0182103_226_600 123
48 3300049652 Ga0501202_127312 Ga0501202_127312_56_430 123
49 3300009553 Ga0105249_10063590 Ga0105249_100635904 124
50 3300013297 Ga0157378_12214839 Ga0157378_122148391 124
51 3300013308 Ga0157375_10139066 Ga0157375_101390663 124
52 3300005545 Ga0070695_100033440 Ga0070695_1000334402 126
53 3300005330 Ga0070690_100008709 Ga0070690_1000087094 127
54 3300005338 Ga0068868_100012352 Ga0068868_1000123524 127
55 3300005343 Ga0070687_100289367 Ga0070687_1002893673 127
56 3300005444 Ga0070694_100026410 Ga0070694_1000264104 127
57 3300005459 Ga0068867_100077179 Ga0068867_1000771792 127
58 3300005536 Ga0070697_100001249 Ga0070697_10000124918 127
59 3300005564 Ga0070664_102175883 Ga0070664_1021758831 127
60 3300009092 Ga0105250_10237989 Ga0105250_102379892 127
61 3300009098 Ga0105245_10031484 Ga0105245_100314844 127
62 3300009148 Ga0105243_10137616 Ga0105243_101376164 127
63 3300009176 Ga0105242_10030053 Ga0105242_100300532 127
64 3300009177 Ga0105248_10017834 Ga0105248_100178342 127
65 3300009553 Ga0105249_10180662 Ga0105249_101806621 127
66 3300010375 Ga0105239_10169708 Ga0105239_101697082 127
67 3300013296 Ga0157374_10214858 Ga0157374_102148584 127
68 3300013297 Ga0157378_10015696 Ga0157378_100156965 127
69 3300013306 Ga0163162_10647944 Ga0163162_106479442 127
70 3300013308 Ga0157375_10694618 Ga0157375_106946182 127
71 3300014325 Ga0163163_10115482 Ga0163163_101154824 127
72 3300014326 Ga0157380_10979145 Ga0157380_109791452 127
73 3300014745 Ga0157377_10197640 Ga0157377_101976403 127
74 3300014968 Ga0157379_10433325 Ga0157379_104333253 127
75 3300014969 Ga0157376_10023487 Ga0157376_100234875 127
76 3300025901 Ga0207688_10063821 Ga0207688_100638212 127
77 3300025931 Ga0207644_10559365 Ga0207644_105593653 127
78 3300025934 Ga0207686_11102442 Ga0207686_111024422 127
79 3300025942 Ga0207689_10001656 Ga0207689_1000165622 127
80 3300026035 Ga0207703_10112040 Ga0207703_101120403 127
81 3300026118 Ga0207675_100002078 Ga0207675_10000207820 127
82 3300013308 Ga0157375_11374088 Ga0157375_113740881 129
83 3300014325 Ga0163163_10339077 Ga0163163_103390772 129
84 3300005330 Ga0070690_100224665 Ga0070690_1002246652 131
85 3300005334 Ga0068869_100019378 Ga0068869_1000193784 131
86 3300005337 Ga0070682_100960538 Ga0070682_1009605381 131
87 3300026095 Ga0207676_10686951 Ga0207676_106869512 131
88 3300006173 Ga0070716_100795099 Ga0070716_1007950991 132
89 3300025906 Ga0207699_10644239 Ga0207699_106442393 132
90 3300031911 Ga0307412_10136563 Ga0307412_101365632 132
91 3300005335 Ga0070666_10066704 Ga0070666_100667043 133
92 3300005340 Ga0070689_100000548 Ga0070689_10000054815 133
93 3300005354 Ga0070675_100058200 Ga0070675_1000582003 133
94 3300005356 Ga0070674_100431220 Ga0070674_1004312201 133
95 3300005365 Ga0070688_100924312 Ga0070688_1009243121 133
96 3300005434 Ga0070709_10226472 Ga0070709_102264723 133
97 3300005438 Ga0070701_10026534 Ga0070701_100265344 133
98 3300005438 Ga0070701_10426939 Ga0070701_104269391 133
99 3300005441 Ga0070700_100725404 Ga0070700_1007254043 133
100 3300005459 Ga0068867_100146826 Ga0068867_1001468262 133
101 3300005518 Ga0070699_100246450 Ga0070699_1002464502 133
102 3300005544 Ga0070686_100015302 Ga0070686_1000153022 133
103 3300005549 Ga0070704_100459256 Ga0070704_1004592562 133
104 3300005578 Ga0068854_100164158 Ga0068854_1001641582 133
105 3300005615 Ga0070702_100033570 Ga0070702_1000335703 133
106 3300005617 Ga0068859_100303936 Ga0068859_1003039362 133
107 3300005617 Ga0068859_100766061 Ga0068859_1007660613 133
108 3300005618 Ga0068864_100061563 Ga0068864_1000615633 133
109 3300005840 Ga0068870_10020860 Ga0068870_100208603 133
110 3300005841 Ga0068863_100038388 Ga0068863_1000383884 133
111 3300005841 Ga0068863_100478103 Ga0068863_1004781032 133
112 3300005842 Ga0068858_100169903 Ga0068858_1001699034 133
113 3300005843 Ga0068860_100093365 Ga0068860_1000933652 133
114 3300005843 Ga0068860_100510401 Ga0068860_1005104012 133
115 3300005844 Ga0068862_100124211 Ga0068862_1001242111 133
116 3300006914 Ga0075436_100000008 Ga0075436_10000000868 133
117 3300006931 Ga0097620_100303954 Ga0097620_1003039542 133
118 3300006931 Ga0097620_100766002 Ga0097620_1007660023 133
119 3300007076 Ga0075435_100000657 Ga0075435_10000065715 133
120 3300009177 Ga0105248_10017565 Ga0105248_100175654 133
121 3300009177 Ga0105248_10376981 Ga0105248_103769812 133
122 3300009553 Ga0105249_10441316 Ga0105249_104413161 133
123 3300013297 Ga0157378_10169726 Ga0157378_101697263 133
124 3300013297 Ga0157378_10307048 Ga0157378_103070482 133
125 3300013297 Ga0157378_11043065 Ga0157378_110430652 133
126 3300013297 Ga0157378_11187219 Ga0157378_111872192 133
127 3300013306 Ga0163162_10140917 Ga0163162_101409172 133
128 3300014325 Ga0163163_10106971 Ga0163163_101069714 133
129 3300014325 Ga0163163_10729900 Ga0163163_107299003 133
130 3300014326 Ga0157380_10106964 Ga0157380_101069641 133
131 3300014326 Ga0157380_11082871 Ga0157380_110828712 133
132 3300014326 Ga0157380_11083649 Ga0157380_110836492 133
133 3300014745 Ga0157377_11259257 Ga0157377_112592572 133
134 3300025899 Ga0207642_10052144 Ga0207642_100521443 133
135 3300025908 Ga0207643_10000647 Ga0207643_100006472 133
136 3300025908 Ga0207643_10225307 Ga0207643_102253073 133
137 3300025923 Ga0207681_10066931 Ga0207681_100669312 133
138 3300025925 Ga0207650_10213375 Ga0207650_102133752 133
139 3300025926 Ga0207659_10133275 Ga0207659_101332752 133
140 3300025936 Ga0207670_10000763 Ga0207670_1000076311 133
141 3300025939 Ga0207665_10305231 Ga0207665_103052312 133
142 3300025941 Ga0207711_10106759 Ga0207711_101067593 133
143 3300025941 Ga0207711_10457213 Ga0207711_104572133 133
144 3300025981 Ga0207640_10628401 Ga0207640_106284011 133
145 3300026035 Ga0207703_10063880 Ga0207703_100638804 133
146 3300026088 Ga0207641_10029830 Ga0207641_100298304 133
147 3300026089 Ga0207648_10100305 Ga0207648_101003053 133
148 3300026095 Ga0207676_10036154 Ga0207676_100361544 133
149 3300026116 Ga0207674_11345543 Ga0207674_113455431 133
150 3300028380 Ga0268265_12482769 Ga0268265_124827691 133
151 3300028381 Ga0268264_10310489 Ga0268264_103104893 133
152 3300005330 Ga0070690_100248578 Ga0070690_1002485782 134
153 3300005334 Ga0068869_100016120 Ga0068869_1000161202 134
154 3300005471 Ga0070698_100001570 Ga0070698_1000015707 134
155 3300005518 Ga0070699_100020613 Ga0070699_1000206135 134
156 3300005545 Ga0070695_100148354 Ga0070695_1001483542 134
157 3300005615 Ga0070702_100447637 Ga0070702_1004476371 134
158 3300005719 Ga0068861_100016533 Ga0068861_1000165334 134
159 3300006173 Ga0070716_100000012 Ga0070716_10000001213 134
160 3300006852 Ga0075433_10222188 Ga0075433_102221882 134
161 3300006852 Ga0075433_10555238 Ga0075433_105552381 134
162 3300006871 Ga0075434_101531921 Ga0075434_1015319211 134
163 3300006881 Ga0068865_100169397 Ga0068865_1001693972 134
164 3300009101 Ga0105247_10000022 Ga0105247_10000022108 134
165 3300009147 Ga0114129_10012953 Ga0114129_1001295310 134
166 3300009148 Ga0105243_10281928 Ga0105243_102819283 134
167 3300009174 Ga0105241_10151114 Ga0105241_101511144 134
168 3300009553 Ga0105249_10003383 Ga0105249_100033839 134
169 3300013297 Ga0157378_10132132 Ga0157378_101321322 134
170 3300013297 Ga0157378_10310127 Ga0157378_103101271 134
171 3300025922 Ga0207646_10117585 Ga0207646_101175852 134
172 3300025935 Ga0207709_10264476 Ga0207709_102644763 134
173 3300025938 Ga0207704_10046662 Ga0207704_100466623 134
174 3300025939 Ga0207665_10000083 Ga0207665_1000008346 134
175 3300025942 Ga0207689_10033563 Ga0207689_100335634 134
176 3300049655 Ga0501208_140957 Ga0501208_140957_23_427 134
177 3300050507 nmdc:mga05p37_15875_c1 nmdc:mga05p37_15875_c1_4751_5176 134
178 3300050513 nmdc:mga0rr50_1013525_c1 nmdc:mga0rr50_1013525_c1_81_506 134
179 3300050514 nmdc:mga08x19_582478_c1 nmdc:mga08x19_582478_c1_308_733 134
180 3300050515 nmdc:mga0a205_550247_c1 nmdc:mga0a205_550247_c1_150_575 134
181 3300050515 nmdc:mga0a205_9683_c1 nmdc:mga0a205_9683_c1_7407_7832 134
182 3300005347 Ga0070668_100008962 Ga0070668_1000089626 135
183 3300006852 Ga0075433_10080606 Ga0075433_100806064 135
184 3300009147 Ga0114129_10295788 Ga0114129_102957883 135
185 3300013306 Ga0163162_10000211 Ga0163162_100002115 135
186 3300014326 Ga0157380_13266517 Ga0157380_132665171 135
187 3300025961 Ga0207712_10000180 Ga0207712_100001806 135
188 3300025972 Ga0207668_10005528 Ga0207668_100055283 135
189 3300050507 nmdc:mga05p37_320707_c1 nmdc:mga05p37_320707_c1_694_1125 135
190 3300005331 Ga0070670_100000793 Ga0070670_10000079325 136
191 3300005331 Ga0070670_100548069 Ga0070670_1005480693 136
192 3300005337 Ga0070682_100000570 Ga0070682_10000057014 136
193 3300005340 Ga0070689_100169150 Ga0070689_1001691502 136
194 3300005343 Ga0070687_101018361 Ga0070687_1010183612 136
195 3300005353 Ga0070669_100063902 Ga0070669_1000639023 136
196 3300005354 Ga0070675_100189659 Ga0070675_1001896591 136
197 3300005355 Ga0070671_101740523 Ga0070671_1017405231 136
198 3300005364 Ga0070673_101427151 Ga0070673_1014271511 136
199 3300005365 Ga0070688_100300094 Ga0070688_1003000941 136
200 3300005548 Ga0070665_100237253 Ga0070665_1002372533 136
201 3300005577 Ga0068857_102321465 Ga0068857_1023214651 136
202 3300009093 Ga0105240_11672592 Ga0105240_116725921 136
203 3300009147 Ga0114129_10010729 Ga0114129_1001072910 136
204 3300009147 Ga0114129_10287436 Ga0114129_102874362 136
205 3300009147 Ga0114129_10632452 Ga0114129_106324521 136
206 3300009176 Ga0105242_11175649 Ga0105242_111756491 136
207 3300013306 Ga0163162_11928368 Ga0163162_119283682 136
208 3300013308 Ga0157375_10402460 Ga0157375_104024603 136
209 3300025913 Ga0207695_10497787 Ga0207695_104977873 136
210 3300025923 Ga0207681_10012688 Ga0207681_100126881 136
211 3300025923 Ga0207681_10447159 Ga0207681_104471593 136
212 3300025926 Ga0207659_10180294 Ga0207659_101802941 136
213 3300025934 Ga0207686_10676344 Ga0207686_106763441 136
214 3300035172 Ga0373955_0262993 Ga0373955_0262993_547_957 136
215 3300036401 Ga0373937_0363148 Ga0373937_0363148_520_930 136
216 3300046537 Ga0495598_0000339 Ga0495598_0000339_1496_1927 136
217 3300050507 nmdc:mga05p37_45836_c1 nmdc:mga05p37_45836_c1_3085_3495 136
218 3300050507 nmdc:mga05p37_527028_c1 nmdc:mga05p37_527028_c1_816_1226 136
219 3300000532 CNAas_1000066 CNAas_10000667 137
220 3300005295 Ga0065707_10085415 Ga0065707_100854154 137
221 3300005295 Ga0065707_10416361 Ga0065707_104163612 137
222 3300005334 Ga0068869_101279315 Ga0068869_1012793151 137
223 3300005336 Ga0070680_100000578 Ga0070680_1000005785 137
224 3300005340 Ga0070689_100232297 Ga0070689_1002322971 137
225 3300005340 Ga0070689_100526376 Ga0070689_1005263761 137
226 3300005353 Ga0070669_101586992 Ga0070669_1015869921 137
227 3300005356 Ga0070674_100341855 Ga0070674_1003418551 137
228 3300005367 Ga0070667_100136627 Ga0070667_1001366273 137
229 3300005440 Ga0070705_100315713 Ga0070705_1003157132 137
230 3300005440 Ga0070705_100704986 Ga0070705_1007049861 137
231 3300005441 Ga0070700_100080890 Ga0070700_1000808903 137
232 3300005444 Ga0070694_100334412 Ga0070694_1003344121 137
233 3300005456 Ga0070678_100701219 Ga0070678_1007012192 137
234 3300005458 Ga0070681_10000041 Ga0070681_100000414 137
235 3300005467 Ga0070706_100506473 Ga0070706_1005064731 137
236 3300005468 Ga0070707_100286367 Ga0070707_1002863671 137
237 3300005471 Ga0070698_100011352 Ga0070698_10001135210 137
238 3300005518 Ga0070699_100952777 Ga0070699_1009527772 137
239 3300005530 Ga0070679_100000955 Ga0070679_10000095512 137
240 3300005536 Ga0070697_100077341 Ga0070697_1000773414 137
241 3300005536 Ga0070697_100301139 Ga0070697_1003011393 137
242 3300005544 Ga0070686_100133826 Ga0070686_1001338263 137
243 3300005545 Ga0070695_100526977 Ga0070695_1005269771 137
244 3300005546 Ga0070696_100071082 Ga0070696_1000710823 137
245 3300005546 Ga0070696_100080442 Ga0070696_1000804422 137
246 3300005546 Ga0070696_100497681 Ga0070696_1004976812 137
247 3300005546 Ga0070696_100616561 Ga0070696_1006165612 137
248 3300005546 Ga0070696_101521236 Ga0070696_1015212361 137
249 3300005547 Ga0070693_100020783 Ga0070693_1000207832 137
250 3300005547 Ga0070693_100057943 Ga0070693_1000579432 137
251 3300005547 Ga0070693_100252258 Ga0070693_1002522581 137
252 3300005547 Ga0070693_100537418 Ga0070693_1005374181 137
253 3300005547 Ga0070693_101469292 Ga0070693_1014692921 137
254 3300005549 Ga0070704_100226739 Ga0070704_1002267393 137
255 3300005563 Ga0068855_100452441 Ga0068855_1004524411 137
256 3300005563 Ga0068855_100893551 Ga0068855_1008935511 137
257 3300005615 Ga0070702_100006101 Ga0070702_1000061013 137
258 3300005617 Ga0068859_100025877 Ga0068859_1000258773 137
259 3300005617 Ga0068859_100365645 Ga0068859_1003656452 137
260 3300005618 Ga0068864_100006535 Ga0068864_1000065352 137
261 3300005719 Ga0068861_100227236 Ga0068861_1002272363 137
262 3300005834 Ga0068851_10237553 Ga0068851_102375532 137
263 3300005842 Ga0068858_100135158 Ga0068858_1001351583 137
264 3300005843 Ga0068860_100044023 Ga0068860_1000440234 137
265 3300006237 Ga0097621_100122322 Ga0097621_1001223222 137
266 3300006358 Ga0068871_100004614 Ga0068871_1000046147 137
267 3300006852 Ga0075433_10380265 Ga0075433_103802652 137
268 3300006852 Ga0075433_11203234 Ga0075433_112032342 137
269 3300006871 Ga0075434_100267820 Ga0075434_1002678202 137
270 3300006871 Ga0075434_100445819 Ga0075434_1004458191 137
271 3300006871 Ga0075434_100555824 Ga0075434_1005558242 137
272 3300006881 Ga0068865_100834728 Ga0068865_1008347281 137
273 3300006881 Ga0068865_101082388 Ga0068865_1010823881 137
274 3300006931 Ga0097620_100025876 Ga0097620_1000258763 137
275 3300006931 Ga0097620_100365624 Ga0097620_1003656242 137
276 3300007076 Ga0075435_100333078 Ga0075435_1003330782 137
277 3300007076 Ga0075435_100518848 Ga0075435_1005188482 137
278 3300007076 Ga0075435_100623357 Ga0075435_1006233572 137
279 3300009094 Ga0111539_10407401 Ga0111539_104074012 137
280 3300009098 Ga0105245_10243687 Ga0105245_102436871 137
281 3300009147 Ga0114129_10024247 Ga0114129_100242471 137
282 3300009147 Ga0114129_10032222 Ga0114129_100322226 137
283 3300009147 Ga0114129_10071099 Ga0114129_100710994 137
284 3300013100 Ga0157373_10940040 Ga0157373_109400402 137
285 3300014745 Ga0157377_11360540 Ga0157377_113605401 137
286 3300017792 Ga0163161_10184212 Ga0163161_101842123 137
287 3300025321 Ga0207656_10256353 Ga0207656_102563533 137
288 3300025903 Ga0207680_10284890 Ga0207680_102848901 137
289 3300025908 Ga0207643_10410547 Ga0207643_104105472 137
290 3300025911 Ga0207654_11097219 Ga0207654_110972192 137
291 3300025912 Ga0207707_10000077 Ga0207707_1000007712 137
292 3300025914 Ga0207671_10065685 Ga0207671_100656852 137
293 3300025917 Ga0207660_10003294 Ga0207660_100032945 137
294 3300025920 Ga0207649_10434713 Ga0207649_104347133 137
295 3300025921 Ga0207652_10000096 Ga0207652_1000009610 137
296 3300025922 Ga0207646_10297368 Ga0207646_102973682 137
297 3300025922 Ga0207646_10515361 Ga0207646_105153611 137
298 3300025923 Ga0207681_11014575 Ga0207681_110145752 137
299 3300025925 Ga0207650_10000046 Ga0207650_1000004627 137
300 3300025931 Ga0207644_10085138 Ga0207644_100851382 137
301 3300025931 Ga0207644_10350548 Ga0207644_103505482 137
302 3300025937 Ga0207669_10454225 Ga0207669_104542252 137
303 3300025940 Ga0207691_11005150 Ga0207691_110051501 137
304 3300025941 Ga0207711_10011687 Ga0207711_100116874 137
305 3300025942 Ga0207689_11061889 Ga0207689_110618891 137
306 3300025945 Ga0207679_10116393 Ga0207679_101163932 137
307 3300025981 Ga0207640_10190588 Ga0207640_101905881 137
308 3300025986 Ga0207658_10340553 Ga0207658_103405531 137
309 3300026035 Ga0207703_10159045 Ga0207703_101590452 137
310 3300026035 Ga0207703_10275022 Ga0207703_102750222 137
311 3300026075 Ga0207708_10049837 Ga0207708_100498373 137
312 3300026078 Ga0207702_11352997 Ga0207702_113529972 137
313 3300026089 Ga0207648_10194024 Ga0207648_101940242 137
314 3300026089 Ga0207648_10402158 Ga0207648_104021581 137
315 3300026116 Ga0207674_10333436 Ga0207674_103334362 137
316 3300026118 Ga0207675_100890079 Ga0207675_1008900792 137
317 3300026121 Ga0207683_10816234 Ga0207683_108162342 137
318 3300028379 Ga0268266_10272964 Ga0268266_102729643 137
319 3300028381 Ga0268264_10296213 Ga0268264_102962133 137
320 3300028381 Ga0268264_11250357 Ga0268264_112503572 137
321 3300042012 Ga0439455_0099901 Ga0439455_0099901_213_659 137
322 3300042439 Ga0439464_0061793 Ga0439464_0061793_277_723 137
323 3300049686 Ga0501257_070119 Ga0501257_070119_175_606 137
324 3300049705 Ga0501225_0014486 Ga0501225_0014486_1271_1702 137
325 3300049763 Ga0501266_045456 Ga0501266_045456_217_648 137
326 3300050507 nmdc:mga05p37_131935_c1 nmdc:mga05p37_131935_c1_1234_1647 137
327 3300050507 nmdc:mga05p37_187251_c1 nmdc:mga05p37_187251_c1_1855_2289 137
328 3300050507 nmdc:mga05p37_70907_c1 nmdc:mga05p37_70907_c1_1956_2387 137
329 3300050511 nmdc:mga08y16_323049_c1 nmdc:mga08y16_323049_c1_908_1339 137
330 3300050513 nmdc:mga0rr50_490209_c1 nmdc:mga0rr50_490209_c1_277_711 137
331 3300050513 nmdc:mga0rr50_910668_c1 nmdc:mga0rr50_910668_c1_181_675 137
332 3300050515 nmdc:mga0a205_14052_c1 nmdc:mga0a205_14052_c1_6015_6446 137
333 3300050515 nmdc:mga0a205_43154_c1 nmdc:mga0a205_43154_c1_1926_2339 137
334 3300050515 nmdc:mga0a205_582513_c1 nmdc:mga0a205_582513_c1_439_870 137
335 2162886007 SwRhRL2b_contig_2530518 SwRhRL2b_0111.00006640 138
336 2162886011 MRS1b_contig_2703841 MRS1b_0947.00001110 138
337 3300003203 JGI25406J46586_10192407 JGI25406J46586_101924071 138
338 3300003320 rootH2_10324948 rootH2_103249483 138
339 3300005290 Ga0065712_10067736 Ga0065712_1006773653 138
340 3300005293 Ga0065715_10088966 Ga0065715_1008896610 138
341 3300005295 Ga0065707_10028325 Ga0065707_100283252 138
342 3300005328 Ga0070676_10081137 Ga0070676_100811373 138
343 3300005330 Ga0070690_100000641 Ga0070690_1000006414 138
344 3300005331 Ga0070670_100079128 Ga0070670_1000791281 138
345 3300005331 Ga0070670_100162578 Ga0070670_1001625783 138
346 3300005334 Ga0068869_100370603 Ga0068869_1003706033 138
347 3300005334 Ga0068869_100603803 Ga0068869_1006038033 138
348 3300005334 Ga0068869_100637793 Ga0068869_1006377931 138
349 3300005336 Ga0070680_100001718 Ga0070680_1000017181 138
350 3300005336 Ga0070680_100634463 Ga0070680_1006344633 138
351 3300005336 Ga0070680_101022813 Ga0070680_1010228131 138
352 3300005337 Ga0070682_100036312 Ga0070682_1000363123 138
353 3300005339 Ga0070660_100017641 Ga0070660_1000176415 138
354 3300005340 Ga0070689_100878207 Ga0070689_1008782072 138
355 3300005343 Ga0070687_100084542 Ga0070687_1000845422 138
356 3300005344 Ga0070661_100028303 Ga0070661_1000283034 138
357 3300005353 Ga0070669_101512706 Ga0070669_1015127061 138
358 3300005364 Ga0070673_100104662 Ga0070673_1001046622 138
359 3300005366 Ga0070659_102061226 Ga0070659_1020612261 138
360 3300005406 Ga0070703_10055771 Ga0070703_100557713 138
361 3300005440 Ga0070705_100004570 Ga0070705_1000045705 138
362 3300005440 Ga0070705_100032957 Ga0070705_1000329573 138
363 3300005441 Ga0070700_100037694 Ga0070700_1000376942 138
364 3300005441 Ga0070700_100077902 Ga0070700_1000779022 138
365 3300005444 Ga0070694_100006659 Ga0070694_1000066592 138
366 3300005444 Ga0070694_100039808 Ga0070694_1000398083 138
367 3300005444 Ga0070694_100069167 Ga0070694_1000691672 138
368 3300005444 Ga0070694_100131146 Ga0070694_1001311462 138
369 3300005444 Ga0070694_100165906 Ga0070694_1001659062 138
370 3300005444 Ga0070694_100237112 Ga0070694_1002371121 138
371 3300005457 Ga0070662_100500609 Ga0070662_1005006091 138
372 3300005457 Ga0070662_100842867 Ga0070662_1008428672 138
373 3300005458 Ga0070681_10138085 Ga0070681_101380854 138
374 3300005459 Ga0068867_100449758 Ga0068867_1004497583 138
375 3300005459 Ga0068867_100993495 Ga0068867_1009934951 138
376 3300005467 Ga0070706_100018070 Ga0070706_1000180705 138
377 3300005468 Ga0070707_100008507 Ga0070707_1000085073 138
378 3300005471 Ga0070698_100018168 Ga0070698_1000181685 138
379 3300005471 Ga0070698_100075584 Ga0070698_1000755842 138
380 3300005518 Ga0070699_100000169 Ga0070699_10000016913 138
381 3300005518 Ga0070699_100000980 Ga0070699_10000098015 138
382 3300005530 Ga0070679_100613928 Ga0070679_1006139283 138
383 3300005536 Ga0070697_100015909 Ga0070697_1000159093 138
384 3300005536 Ga0070697_100051765 Ga0070697_1000517654 138
385 3300005536 Ga0070697_100290497 Ga0070697_1002904972 138
386 3300005539 Ga0068853_100023276 Ga0068853_1000232761 138
387 3300005539 Ga0068853_100237913 Ga0068853_1002379134 138
388 3300005543 Ga0070672_100078538 Ga0070672_1000785382 138
389 3300005544 Ga0070686_100001371 Ga0070686_10000137112 138
390 3300005545 Ga0070695_100033194 Ga0070695_1000331944 138
391 3300005545 Ga0070695_100207067 Ga0070695_1002070672 138
392 3300005545 Ga0070695_100312936 Ga0070695_1003129361 138
393 3300005545 Ga0070695_100522003 Ga0070695_1005220031 138
394 3300005545 Ga0070695_100680878 Ga0070695_1006808782 138
395 3300005545 Ga0070695_101168978 Ga0070695_1011689781 138
396 3300005546 Ga0070696_100556121 Ga0070696_1005561211 138
397 3300005546 Ga0070696_100742564 Ga0070696_1007425642 138
398 3300005546 Ga0070696_101362650 Ga0070696_1013626501 138
399 3300005546 Ga0070696_101744563 Ga0070696_1017445631 138
400 3300005547 Ga0070693_100027954 Ga0070693_1000279541 138
401 3300005547 Ga0070693_100044478 Ga0070693_1000444782 138
402 3300005547 Ga0070693_100104883 Ga0070693_1001048832 138
403 3300005547 Ga0070693_100845542 Ga0070693_1008455422 138
404 3300005547 Ga0070693_100882560 Ga0070693_1008825601 138
405 3300005548 Ga0070665_100331573 Ga0070665_1003315733 138
406 3300005549 Ga0070704_100102689 Ga0070704_1001026892 138
407 3300005549 Ga0070704_100280816 Ga0070704_1002808163 138
408 3300005563 Ga0068855_100528694 Ga0068855_1005286942 138
409 3300005564 Ga0070664_100000280 Ga0070664_1000002803 138
410 3300005577 Ga0068857_100212738 Ga0068857_1002127382 138
411 3300005577 Ga0068857_100653258 Ga0068857_1006532582 138
412 3300005577 Ga0068857_100760759 Ga0068857_1007607592 138
413 3300005577 Ga0068857_100836303 Ga0068857_1008363032 138
414 3300005578 Ga0068854_100032703 Ga0068854_1000327033 138
415 3300005578 Ga0068854_101715774 Ga0068854_1017157741 138
416 3300005615 Ga0070702_100101099 Ga0070702_1001010992 138
417 3300005616 Ga0068852_100701405 Ga0068852_1007014052 138
418 3300005617 Ga0068859_100029302 Ga0068859_1000293026 138
419 3300005617 Ga0068859_100070298 Ga0068859_1000702984 138
420 3300005617 Ga0068859_100133157 Ga0068859_1001331572 138
421 3300005617 Ga0068859_101277854 Ga0068859_1012778542 138
422 3300005618 Ga0068864_100008450 Ga0068864_1000084507 138
423 3300005618 Ga0068864_100084118 Ga0068864_1000841183 138
424 3300005719 Ga0068861_100014624 Ga0068861_1000146245 138
425 3300005719 Ga0068861_100381937 Ga0068861_1003819372 138
426 3300005719 Ga0068861_100418111 Ga0068861_1004181113 138
427 3300005719 Ga0068861_100908791 Ga0068861_1009087912 138
428 3300005834 Ga0068851_10001259 Ga0068851_100012597 138
429 3300005840 Ga0068870_10135920 Ga0068870_101359202 138
430 3300005842 Ga0068858_100530465 Ga0068858_1005304652 138
431 3300005843 Ga0068860_100092019 Ga0068860_1000920192 138
432 3300005843 Ga0068860_101756984 Ga0068860_1017569841 138
433 3300005844 Ga0068862_100003102 Ga0068862_1000031024 138
434 3300005844 Ga0068862_100085631 Ga0068862_1000856311 138
435 3300005844 Ga0068862_100707901 Ga0068862_1007079013 138
436 3300005844 Ga0068862_101070959 Ga0068862_1010709591 138
437 3300005985 Ga0081539_10006263 Ga0081539_100062632 138
438 3300006844 Ga0075428_100198369 Ga0075428_1001983693 138
439 3300006844 Ga0075428_101920198 Ga0075428_1019201982 138
440 3300006846 Ga0075430_100210691 Ga0075430_1002106912 138
441 3300006847 Ga0075431_100259055 Ga0075431_1002590554 138
442 3300006852 Ga0075433_10311108 Ga0075433_103111081 138
443 3300006852 Ga0075433_10407300 Ga0075433_104073002 138
444 3300006852 Ga0075433_10607392 Ga0075433_106073922 138
445 3300006852 Ga0075433_10639284 Ga0075433_106392841 138
446 3300006852 Ga0075433_11112375 Ga0075433_111123752 138
447 3300006871 Ga0075434_100141130 Ga0075434_1001411303 138
448 3300006871 Ga0075434_100248628 Ga0075434_1002486283 138
449 3300006880 Ga0075429_101712404 Ga0075429_1017124041 138
450 3300006931 Ga0097620_100022921 Ga0097620_1000229213 138
451 3300006931 Ga0097620_100029302 Ga0097620_1000293026 138
452 3300006931 Ga0097620_100070298 Ga0097620_1000702984 138
453 3300006931 Ga0097620_100133147 Ga0097620_1001331472 138
454 3300006931 Ga0097620_101277914 Ga0097620_1012779142 138
455 3300009093 Ga0105240_10033105 Ga0105240_100331051 138
456 3300009094 Ga0111539_10066768 Ga0111539_100667684 138
457 3300009094 Ga0111539_10075347 Ga0111539_100753474 138
458 3300009094 Ga0111539_10791953 Ga0111539_107919532 138
459 3300009094 Ga0111539_11332911 Ga0111539_113329111 138
460 3300009094 Ga0111539_11632552 Ga0111539_116325523 138
461 3300009101 Ga0105247_10050406 Ga0105247_100504064 138
462 3300009101 Ga0105247_10050783 Ga0105247_100507832 138
463 3300009147 Ga0114129_10148006 Ga0114129_101480061 138
464 3300009148 Ga0105243_10123361 Ga0105243_101233613 138
465 3300009174 Ga0105241_10035999 Ga0105241_100359994 138
466 3300009174 Ga0105241_10447469 Ga0105241_104474692 138
467 3300009177 Ga0105248_10009310 Ga0105248_100093104 138
468 3300009177 Ga0105248_10014875 Ga0105248_100148754 138
469 3300009177 Ga0105248_10019260 Ga0105248_100192606 138
470 3300009545 Ga0105237_10002331 Ga0105237_1000233125 138
471 3300009545 Ga0105237_10023809 Ga0105237_100238096 138
472 3300009553 Ga0105249_11240701 Ga0105249_112407013 138
473 3300009553 Ga0105249_11375886 Ga0105249_113758861 138
474 3300010375 Ga0105239_10689382 Ga0105239_106893822 138
475 3300010375 Ga0105239_11038816 Ga0105239_110388162 138
476 3300010375 Ga0105239_11075455 Ga0105239_110754552 138
477 3300013100 Ga0157373_10006812 Ga0157373_100068129 138
478 3300013100 Ga0157373_10074546 Ga0157373_100745464 138
479 3300013296 Ga0157374_10361457 Ga0157374_103614572 138
480 3300013297 Ga0157378_10042680 Ga0157378_100426805 138
481 3300013297 Ga0157378_10083853 Ga0157378_100838532 138
482 3300013306 Ga0163162_10016961 Ga0163162_100169616 138
483 3300013306 Ga0163162_10065551 Ga0163162_100655514 138
484 3300013307 Ga0157372_10106832 Ga0157372_101068322 138
485 3300013307 Ga0157372_10723993 Ga0157372_107239933 138
486 3300013308 Ga0157375_10026487 Ga0157375_100264875 138
487 3300013308 Ga0157375_10194525 Ga0157375_101945254 138
488 3300013308 Ga0157375_12394264 Ga0157375_123942642 138
489 3300014325 Ga0163163_10121817 Ga0163163_101218172 138
490 3300014325 Ga0163163_10131326 Ga0163163_101313263 138
491 3300014325 Ga0163163_10559558 Ga0163163_105595582 138
492 3300014326 Ga0157380_10004242 Ga0157380_1000424211 138
493 3300014326 Ga0157380_10017254 Ga0157380_100172544 138
494 3300014326 Ga0157380_10450837 Ga0157380_104508373 138
495 3300014745 Ga0157377_10026346 Ga0157377_100263462 138
496 3300014968 Ga0157379_10253503 Ga0157379_102535032 138
497 3300014968 Ga0157379_10560298 Ga0157379_105602981 138
498 3300015262 Ga0182007_10047454 Ga0182007_100474541 138
499 3300025321 Ga0207656_10001046 Ga0207656_100010466 138
500 3300025900 Ga0207710_10085947 Ga0207710_100859471 138
501 3300025904 Ga0207647_10103692 Ga0207647_101036924 138
502 3300025910 Ga0207684_10000076 Ga0207684_1000007621 138
503 3300025910 Ga0207684_10136755 Ga0207684_101367554 138
504 3300025911 Ga0207654_10248765 Ga0207654_102487652 138
505 3300025911 Ga0207654_10377527 Ga0207654_103775272 138
506 3300025912 Ga0207707_10132876 Ga0207707_101328762 138
507 3300025912 Ga0207707_10783846 Ga0207707_107838461 138
508 3300025912 Ga0207707_11233302 Ga0207707_112333021 138
509 3300025913 Ga0207695_10035380 Ga0207695_100353805 138
510 3300025914 Ga0207671_10013536 Ga0207671_100135366 138
511 3300025917 Ga0207660_10054506 Ga0207660_100545063 138
512 3300025917 Ga0207660_11344826 Ga0207660_113448262 138
513 3300025917 Ga0207660_11622150 Ga0207660_116221501 138
514 3300025921 Ga0207652_10052088 Ga0207652_100520884 138
515 3300025921 Ga0207652_11136367 Ga0207652_111363672 138
516 3300025923 Ga0207681_10823485 Ga0207681_108234851 138
517 3300025925 Ga0207650_10051485 Ga0207650_100514852 138
518 3300025925 Ga0207650_10067177 Ga0207650_100671774 138
519 3300025932 Ga0207690_10273905 Ga0207690_102739052 138
520 3300025933 Ga0207706_10093709 Ga0207706_100937092 138
521 3300025933 Ga0207706_10440014 Ga0207706_104400142 138
522 3300025933 Ga0207706_10769731 Ga0207706_107697311 138
523 3300025933 Ga0207706_10849966 Ga0207706_108499662 138
524 3300025936 Ga0207670_10803206 Ga0207670_108032061 138
525 3300025939 Ga0207665_10740284 Ga0207665_107402841 138
526 3300025941 Ga0207711_10039251 Ga0207711_100392514 138
527 3300025941 Ga0207711_10049360 Ga0207711_100493604 138
528 3300025942 Ga0207689_10214880 Ga0207689_102148803 138
529 3300025942 Ga0207689_10659302 Ga0207689_106593021 138
530 3300025942 Ga0207689_10880028 Ga0207689_108800281 138
531 3300025945 Ga0207679_10092924 Ga0207679_100929242 138
532 3300025945 Ga0207679_10814893 Ga0207679_108148931 138
533 3300025949 Ga0207667_10486139 Ga0207667_104861392 138
534 3300025960 Ga0207651_10135034 Ga0207651_101350342 138
535 3300025961 Ga0207712_11854099 Ga0207712_118540992 138
536 3300026023 Ga0207677_10968582 Ga0207677_109685822 138
537 3300026041 Ga0207639_10226276 Ga0207639_102262762 138
538 3300026075 Ga0207708_10001596 Ga0207708_100015962 138
539 3300026075 Ga0207708_10002110 Ga0207708_100021104 138
540 3300026075 Ga0207708_10287383 Ga0207708_102873832 138
541 3300026095 Ga0207676_10027189 Ga0207676_100271892 138
542 3300026095 Ga0207676_10566753 Ga0207676_105667531 138
543 3300026116 Ga0207674_10000525 Ga0207674_1000052540 138
544 3300026116 Ga0207674_11388719 Ga0207674_113887192 138
545 3300026116 Ga0207674_12120573 Ga0207674_121205731 138
546 3300026118 Ga0207675_100008022 Ga0207675_10000802211 138
547 3300026118 Ga0207675_100042397 Ga0207675_1000423974 138
548 3300026118 Ga0207675_100094682 Ga0207675_1000946823 138
549 3300026118 Ga0207675_100314590 Ga0207675_1003145902 138
550 3300026118 Ga0207675_101983361 Ga0207675_1019833611 138
551 3300026142 Ga0207698_10298801 Ga0207698_102988011 138
552 3300027907 Ga0207428_11008619 Ga0207428_110086191 138
553 3300028380 Ga0268265_10044278 Ga0268265_100442783 138
554 3300028380 Ga0268265_10134589 Ga0268265_101345893 138
555 3300028380 Ga0268265_10312769 Ga0268265_103127693 138
556 3300028381 Ga0268264_10204624 Ga0268264_102046242 138
557 3300030733 Ga0314311_1182293 Ga0314311_11822931 138
558 3300030745 Ga0316182_1226790 Ga0316182_12267902 138
559 3300031548 Ga0307408_100001826 Ga0307408_10000182611 138
560 3300031731 Ga0307405_10313060 Ga0307405_103130602 138
561 3300031731 Ga0307405_10371494 Ga0307405_103714941 138
562 3300031824 Ga0307413_10132294 Ga0307413_101322944 138
563 3300031824 Ga0307413_11132243 Ga0307413_111322431 138
564 3300031852 Ga0307410_10295896 Ga0307410_102958963 138
565 3300031852 Ga0307410_10934100 Ga0307410_109341001 138
566 3300031901 Ga0307406_10098592 Ga0307406_100985922 138
567 3300031911 Ga0307412_10008770 Ga0307412_100087701 138
568 3300031911 Ga0307412_10061834 Ga0307412_100618343 138
569 3300031911 Ga0307412_10086405 Ga0307412_100864053 138
570 3300031911 Ga0307412_10411338 Ga0307412_104113383 138
571 3300031995 Ga0307409_101193563 Ga0307409_1011935631 138
572 3300032002 Ga0307416_100096334 Ga0307416_1000963341 138
573 3300032002 Ga0307416_100214558 Ga0307416_1002145582 138
574 3300032004 Ga0307414_10061215 Ga0307414_100612153 138
575 3300032004 Ga0307414_10110428 Ga0307414_101104284 138
576 3300032004 Ga0307414_10257688 Ga0307414_102576882 138
577 3300032126 Ga0307415_100014139 Ga0307415_1000141392 138
578 3300032126 Ga0307415_100064647 Ga0307415_1000646472 138
579 3300032126 Ga0307415_100262921 Ga0307415_1002629212 138
580 3300034817 Ga0373948_0084537 Ga0373948_0084537_43_477 138
581 3300035112 Ga0373932_0120749 Ga0373932_0120749_19_453 138
582 3300035115 Ga0373941_0127320 Ga0373941_0127320_177_611 138
583 3300037312 Ga0395899_0593758 Ga0395899_0593758_148_582 138
584 3300037418 Ga0395900_0715596 Ga0395900_0715596_156_590 138
585 3300037418 Ga0395900_0794110 Ga0395900_0794110_159_593 138
586 3300037466 Ga0395898_0094590 Ga0395898_0094590_437_871 138
587 3300038443 Ga0395901_0270921 Ga0395901_0270921_943_1377 138
588 3300038443 Ga0395901_0328652 Ga0395901_0328652_197_631 138
589 3300038443 Ga0395901_0884954 Ga0395901_0884954_355_789 138
590 3300041999 Ga0439433_0046014 Ga0439433_0046014_258_692 138
591 3300042005 Ga0439448_0083464 Ga0439448_0083464_543_959 138
592 3300042157 Ga0439458_0023958 Ga0439458_0023958_850_1266 138
593 3300048907 Ga0496104_0142126 Ga0496104_0142126_441_875 138
594 3300048910 Ga0496107_0061191 Ga0496107_0061191_1333_1749 138
595 3300048911 Ga0496108_0161836 Ga0496108_0161836_1249_1665 138
596 3300048913 Ga0496110_0593813 Ga0496110_0593813_498_932 138
597 3300048915 Ga0496112_0236170 Ga0496112_0236170_473_907 138
598 3300049514 Ga0501291_001731 Ga0501291_001731_501_935 138
599 3300049514 Ga0501291_034570 Ga0501291_034570_50_484 138
600 3300049521 Ga0501298_002776 Ga0501298_002776_728_1162 138
601 3300049522 Ga0501299_019221 Ga0501299_019221_572_1006 138
602 3300049523 Ga0501300_027137 Ga0501300_027137_309_743 138
603 3300049649 Ga0501198_004315 Ga0501198_004315_1294_1728 138
604 3300049649 Ga0501198_084040 Ga0501198_084040_136_564 138
605 3300049650 Ga0501199_009127 Ga0501199_009127_275_709 138
606 3300049651 Ga0501201_005143 Ga0501201_005143_738_1172 138
607 3300049652 Ga0501202_019797 Ga0501202_019797_538_972 138
608 3300049654 Ga0501207_007766 Ga0501207_007766_668_1096 138
609 3300049659 Ga0501214_007509 Ga0501214_007509_527_961 138
610 3300049660 Ga0501216_007629 Ga0501216_007629_421_855 138
611 3300049661 Ga0501217_023767 Ga0501217_023767_135_563 138
612 3300049663 Ga0501223_005860 Ga0501223_005860_854_1288 138
613 3300049664 Ga0501224_010073 Ga0501224_010073_902_1363 138
614 3300049665 Ga0501227_022977 Ga0501227_022977_832_1260 138
615 3300049665 Ga0501227_026886 Ga0501227_026886_13_447 138
616 3300049665 Ga0501227_034899 Ga0501227_034899_226_660 138
617 3300049668 Ga0501233_007158 Ga0501233_007158_121_549 138
618 3300049668 Ga0501233_018233 Ga0501233_018233_921_1382 138
619 3300049669 Ga0501235_029867 Ga0501235_029867_700_1134 138
620 3300049669 Ga0501235_078570 Ga0501235_078570_197_631 138
621 3300049675 Ga0501243_004218 Ga0501243_004218_735_1169 138
622 3300049677 Ga0501247_034983 Ga0501247_034983_38_466 138
623 3300049685 Ga0501256_012121 Ga0501256_012121_134_568 138
624 3300049689 Ga0501260_000603 Ga0501260_000603_762_1190 138
625 3300049689 Ga0501260_005180 Ga0501260_005180_608_1069 138
626 3300049690 Ga0501261_023683 Ga0501261_023683_247_675 138
627 3300049705 Ga0501225_0006653 Ga0501225_0006653_208_642 138
628 3300049705 Ga0501225_0013154 Ga0501225_0013154_817_1245 138
629 3300049706 Ga0501229_011982 Ga0501229_011982_152_586 138
630 3300049707 Ga0501234_003604 Ga0501234_003604_296_724 138
631 3300049707 Ga0501234_048558 Ga0501234_048558_237_671 138
632 3300049708 Ga0501245_032846 Ga0501245_032846_85_519 138
633 3300049708 Ga0501245_162982 Ga0501245_162982_13_441 138
634 3300049765 Ga0501268_008749 Ga0501268_008749_742_1176 138
635 3300049767 Ga0501270_018536 Ga0501270_018536_277_705 138
636 3300049770 Ga0501273_003402 Ga0501273_003402_680_1141 138
637 3300049776 Ga0501280_122909 Ga0501280_122909_39_467 138
638 3300049779 Ga0501283_001262 Ga0501283_001262_1011_1445 138
639 3300049779 Ga0501283_004329 Ga0501283_004329_231_659 138
640 3300049851 Ga0501212_002532 Ga0501212_002532_203_631 138
641 3300049851 Ga0501212_003304 Ga0501212_003304_1064_1498 138
642 3300049853 Ga0501226_005410 Ga0501226_005410_447_875 138
643 3300049853 Ga0501226_006765 Ga0501226_006765_778_1212 138
644 3300050507 nmdc:mga05p37_219182_c1 nmdc:mga05p37_219182_c1_1614_2048 138
645 3300050507 nmdc:mga05p37_286014_c1 nmdc:mga05p37_286014_c1_1395_1829 138
646 3300050509 nmdc:mga0qj67_227233_c1 nmdc:mga0qj67_227233_c1_1045_1464 138
647 3300050510 nmdc:mga06r32_303513_c1 nmdc:mga06r32_303513_c1_712_1146 138
648 3300050510 nmdc:mga06r32_321541_c1 nmdc:mga06r32_321541_c1_656_1075 138
649 3300050511 nmdc:mga08y16_135452_c1 nmdc:mga08y16_135452_c1_253_669 138
650 3300050511 nmdc:mga08y16_440686_c1 nmdc:mga08y16_440686_c1_265_699 138
651 3300050511 nmdc:mga08y16_479522_c1 nmdc:mga08y16_479522_c1_625_1053 138
652 3300050512 nmdc:mga0n895_84297_c1 nmdc:mga0n895_84297_c1_1867_2283 138
653 3300050512 nmdc:mga0n895_85872_c1 nmdc:mga0n895_85872_c1_2642_3076 138
654 3300050515 nmdc:mga0a205_13111_c1 nmdc:mga0a205_13111_c1_246_662 138
655 3300050515 nmdc:mga0a205_70579_c1 nmdc:mga0a205_70579_c1_2691_3125 138
656 3300060353 Ga0501082_1340016 Ga0501082_1340016_106_543 138

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20382

DUF6677

Family of unknown function (DUF6677)

40

163

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2a9h-assembly1.cif.gz_C nmr structural studies of a potassium channel / charybdotoxin complex 0.4633 34 138
2a9h-assembly1.cif.gz_C nmr structural studies of a potassium channel / charybdotoxin complex 0.444 34 138
2a79-assembly1.cif.gz_B mammalian shaker kv1.2 potassium channel- beta subunit complex 0.3786 12 138
6wkn-assembly1.cif.gz_A pl-bound rat trpv2 in nanodiscs 0.3706 9 138
2a79-assembly1.cif.gz_B mammalian shaker kv1.2 potassium channel- beta subunit complex 0.3218 12 138
ID Description Score Start End Superfamily
2a9hD00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.4635 34 138 1.10.287.70
2a9hD00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.4444 34 138 1.10.287.70
af_A4HRG0_1_184_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.3981 12 134 1.20.1070.10
af_O88758_331_439_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.3916 16 138 1.10.287.70
af_O88758_331_439_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.387 16 138 1.10.287.70
ID Description Score Start End GO Terms
AF-A0A352F064-F1-model_v4 DUF6677 domain-containing protein 0.9471 7 138 GO:0016020
AF-A0A7Y4UIK9-F1-model_v4 DUF6677 domain-containing protein 0.9402 10 138 GO:0016020
AF-A0A2W0AZQ2-F1-model_v4 DUF6677 domain-containing protein 0.9324 13 138 GO:0016020
AF-A0A6L7U9Z2-F1-model_v4 deleted 0.9305 7 138
AF-A0A7V9URH7-F1-model_v4 DUF6677 domain-containing protein 0.9299 4 138 GO:0016020

Feature Viewer

pLDDT pTM Quality
88.34 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map