F473000
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 656 | 249 | 656 | 140 |
Family's Representative Sequence
| Representative Sequence | 3300005843|Ga0068860_100092019|Ga0068860_1000920192 |
| Length | 163 |
| Sequence | LIESAGSGTTLTKSGWRDELVKAEKIELERHEPTPSSAWLIGAVAWFVPGAGHLLLKKWWRALLMGGAVWLCFFLGLAMGGHMFDLSTGQGSSTILQVPPMIANLGTGILYVLSWLMGAGFADDPERARLATYEYGNTFLLIAGLLNYLTMLDAFDVAAGRKP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300000532 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled | Metagenome | Rhizosphere |
| 4 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 5 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 6 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 8 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 42 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 49 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 57 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 59 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 60 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 62 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 63 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 64 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 65 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 66 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 67 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 68 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 69 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 70 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 71 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 72 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 75 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 76 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 77 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 78 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 79 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 80 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 81 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 82 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 83 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 85 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 110 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 163 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 167 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 168 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 169 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 170 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 171 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 172 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 173 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 174 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 175 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 176 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 177 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 178 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 179 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 180 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 181 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 182 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 183 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 184 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 185 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 186 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 187 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 188 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 189 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 190 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 191 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 192 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 193 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 194 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 195 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 201 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 202 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 203 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 204 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 205 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 206 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 207 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 208 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 209 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 210 | 3300049650 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought | Metagenome | Rhizosphere |
| 211 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 212 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 213 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 214 | 3300049655 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought | Metagenome | Rhizosphere |
| 215 | 3300049659 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control | Metagenome | Rhizosphere |
| 216 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 217 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 218 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 219 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 220 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 221 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 222 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 223 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 224 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 225 | 3300049685 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control | Metagenome | Rhizosphere |
| 226 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 227 | 3300049689 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought | Metagenome | Rhizosphere |
| 228 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 229 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 230 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 231 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 232 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 233 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 234 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 235 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 236 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 237 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 238 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 239 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 240 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 241 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 242 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 243 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 244 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 245 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 246 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 247 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 248 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 249 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0.76 |
| Rhizosphere | 98.93 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.3 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_2530518 | 2162886007 | Bacteria | 1153 |
| 2 | MRS1b_contig_2703841 | 2162886011 | Unclassified | 855 |
| 3 | CNAas_1000066 | 3300000532 | Bacteria | 7808 |
| 4 | JGI25406J46586_10192407 | 3300003203 | Bacteria | 595 |
| 5 | rootH2_10324948 | 3300003320 | Unclassified | 1147 |
| 6 | Ga0065704_10320087 | 3300005289 | Unclassified | 844 |
| 7 | Ga0065712_10067736 | 3300005290 | Bacteria | 94196 |
| 8 | Ga0065715_10008821 | 3300005293 | Unclassified | 3975 |
| 9 | Ga0065715_10088966 | 3300005293 | Bacteria | 19365 |
| 10 | Ga0065707_10028325 | 3300005295 | Unclassified | 1805 |
| 11 | Ga0065707_10085415 | 3300005295 | Bacteria | 6171 |
| 12 | Ga0065707_10416361 | 3300005295 | Bacteria | 815 |
| 13 | Ga0070676_10081137 | 3300005328 | Bacteria | 1968 |
| 14 | Ga0070690_100000641 | 3300005330 | Bacteria | 17773 |
| 15 | Ga0070690_100008709 | 3300005330 | Bacteria | 5854 |
| 16 | Ga0070690_100224665 | 3300005330 | Bacteria | 1317 |
| 17 | Ga0070690_100248578 | 3300005330 | Unclassified | 1257 |
| 18 | Ga0070670_100000793 | 3300005331 | Bacteria | 24611 |
| 19 | Ga0070670_100079128 | 3300005331 | Bacteria | 2825 |
| 20 | Ga0070670_100162578 | 3300005331 | Bacteria | 1935 |
| 21 | Ga0070670_100548069 | 3300005331 | Bacteria | 1032 |
| 22 | Ga0070677_10899614 | 3300005333 | Unclassified | 511 |
| 23 | Ga0068869_100016120 | 3300005334 | Bacteria | 5032 |
| 24 | Ga0068869_100019378 | 3300005334 | Bacteria | 4647 |
| 25 | Ga0068869_100370603 | 3300005334 | Unclassified | 1172 |
| 26 | Ga0068869_100603803 | 3300005334 | Unclassified | 927 |
| 27 | Ga0068869_100637793 | 3300005334 | Unclassified | 903 |
| 28 | Ga0068869_101279315 | 3300005334 | Unclassified | 646 |
| 29 | Ga0070666_10066704 | 3300005335 | Unclassified | 2443 |
| 30 | Ga0070680_100000578 | 3300005336 | Bacteria | 25221 |
| 31 | Ga0070680_100001718 | 3300005336 | Bacteria | 16067 |
| 32 | Ga0070680_100634463 | 3300005336 | Unclassified | 918 |
| 33 | Ga0070680_101022813 | 3300005336 | Unclassified | 714 |
| 34 | Ga0070682_100000570 | 3300005337 | Bacteria | 22750 |
| 35 | Ga0070682_100036312 | 3300005337 | Bacteria | 3012 |
| 36 | Ga0070682_100960538 | 3300005337 | Bacteria | 706 |
| 37 | Ga0068868_100012352 | 3300005338 | Bacteria | 6240 |
| 38 | Ga0070660_100017641 | 3300005339 | Bacteria | 5205 |
| 39 | Ga0070689_100000548 | 3300005340 | Bacteria | 22434 |
| 40 | Ga0070689_100169150 | 3300005340 | Bacteria | 1770 |
| 41 | Ga0070689_100232297 | 3300005340 | Bacteria | 1516 |
| 42 | Ga0070689_100526376 | 3300005340 | Bacteria | 1016 |
| 43 | Ga0070689_100878207 | 3300005340 | Unclassified | 792 |
| 44 | Ga0070687_100084542 | 3300005343 | Bacteria | 1740 |
| 45 | Ga0070687_100289367 | 3300005343 | Bacteria | 1035 |
| 46 | Ga0070687_101018361 | 3300005343 | Unclassified | 601 |
| 47 | Ga0070661_100028303 | 3300005344 | Bacteria | 4041 |
| 48 | Ga0070668_100008962 | 3300005347 | Bacteria | 7429 |
| 49 | Ga0070669_100063902 | 3300005353 | Bacteria | 2710 |
| 50 | Ga0070669_101512706 | 3300005353 | Unclassified | 583 |
| 51 | Ga0070669_101586992 | 3300005353 | Unclassified | 569 |
| 52 | Ga0070675_100058200 | 3300005354 | Bacteria | 3188 |
| 53 | Ga0070675_100189659 | 3300005354 | Unclassified | 1781 |
| 54 | Ga0070671_101740523 | 3300005355 | Bacteria | 553 |
| 55 | Ga0070674_100341855 | 3300005356 | Bacteria | 1206 |
| 56 | Ga0070674_100431220 | 3300005356 | Unclassified | 1084 |
| 57 | Ga0070674_100896555 | 3300005356 | Unclassified | 772 |
| 58 | Ga0070673_100104662 | 3300005364 | Bacteria | 2337 |
| 59 | Ga0070673_101427151 | 3300005364 | Bacteria | 652 |
| 60 | Ga0070688_100300094 | 3300005365 | Bacteria | 1161 |
| 61 | Ga0070688_100924312 | 3300005365 | Unclassified | 689 |
| 62 | Ga0070659_102061226 | 3300005366 | Unclassified | 513 |
| 63 | Ga0070667_100136627 | 3300005367 | Unclassified | 2144 |
| 64 | Ga0070703_10055771 | 3300005406 | Unclassified | 1277 |
| 65 | Ga0070709_10226472 | 3300005434 | Bacteria | 1336 |
| 66 | Ga0070701_10026534 | 3300005438 | Unclassified | 2826 |
| 67 | Ga0070701_10426939 | 3300005438 | Unclassified | 845 |
| 68 | Ga0070705_100004570 | 3300005440 | Bacteria | 6739 |
| 69 | Ga0070705_100032957 | 3300005440 | Bacteria | 2884 |
| 70 | Ga0070705_100045622 | 3300005440 | Unclassified | 2522 |
| 71 | Ga0070705_100315713 | 3300005440 | Bacteria | 1126 |
| 72 | Ga0070705_100506344 | 3300005440 | Bacteria | 917 |
| 73 | Ga0070705_100704986 | 3300005440 | Unclassified | 793 |
| 74 | Ga0070700_100037694 | 3300005441 | Unclassified | 2942 |
| 75 | Ga0070700_100077902 | 3300005441 | Bacteria | 2133 |
| 76 | Ga0070700_100080890 | 3300005441 | Unclassified | 2098 |
| 77 | Ga0070700_100333174 | 3300005441 | Bacteria | 1119 |
| 78 | Ga0070700_100725404 | 3300005441 | Unclassified | 793 |
| 79 | Ga0070694_100006659 | 3300005444 | Bacteria | 7019 |
| 80 | Ga0070694_100026410 | 3300005444 | Bacteria | 3762 |
| 81 | Ga0070694_100039808 | 3300005444 | Unclassified | 3131 |
| 82 | Ga0070694_100069167 | 3300005444 | Bacteria | 2428 |
| 83 | Ga0070694_100131146 | 3300005444 | Bacteria | 1811 |
| 84 | Ga0070694_100165906 | 3300005444 | Unclassified | 1624 |
| 85 | Ga0070694_100237112 | 3300005444 | Unclassified | 1374 |
| 86 | Ga0070694_100334412 | 3300005444 | Unclassified | 1169 |
| 87 | Ga0070678_100701219 | 3300005456 | Unclassified | 912 |
| 88 | Ga0070662_100500609 | 3300005457 | Bacteria | 1013 |
| 89 | Ga0070662_100842867 | 3300005457 | Unclassified | 780 |
| 90 | Ga0070681_10000041 | 3300005458 | Bacteria | 89178 |
| 91 | Ga0070681_10138085 | 3300005458 | Bacteria | 2367 |
| 92 | Ga0068867_100077179 | 3300005459 | Bacteria | 2502 |
| 93 | Ga0068867_100146826 | 3300005459 | Bacteria | 1849 |
| 94 | Ga0068867_100449758 | 3300005459 | Bacteria | 1097 |
| 95 | Ga0068867_100993495 | 3300005459 | Unclassified | 760 |
| 96 | Ga0070706_100005960 | 3300005467 | Bacteria | 11529 |
| 97 | Ga0070706_100018070 | 3300005467 | Bacteria | 6504 |
| 98 | Ga0070706_100506473 | 3300005467 | Bacteria | 1123 |
| 99 | Ga0070707_100008507 | 3300005468 | Bacteria | 9532 |
| 100 | Ga0070707_100286367 | 3300005468 | Unclassified | 1601 |
| 101 | Ga0070707_101434671 | 3300005468 | Unclassified | 657 |
| 102 | Ga0070698_100001570 | 3300005471 | Bacteria | 25378 |
| 103 | Ga0070698_100007923 | 3300005471 | Bacteria | 11497 |
| 104 | Ga0070698_100011352 | 3300005471 | Bacteria | 9458 |
| 105 | Ga0070698_100017792 | 3300005471 | Bacteria | 7486 |
| 106 | Ga0070698_100018168 | 3300005471 | Bacteria | 7402 |
| 107 | Ga0070698_100075584 | 3300005471 | Unclassified | 3372 |
| 108 | Ga0070699_100000169 | 3300005518 | Bacteria | 63052 |
| 109 | Ga0070699_100000980 | 3300005518 | Bacteria | 26618 |
| 110 | Ga0070699_100020613 | 3300005518 | Bacteria | 5688 |
| 111 | Ga0070699_100051065 | 3300005518 | Unclassified | 3580 |
| 112 | Ga0070699_100246450 | 3300005518 | Bacteria | 1596 |
| 113 | Ga0070699_100952777 | 3300005518 | Bacteria | 787 |
| 114 | Ga0070679_100000955 | 3300005530 | Bacteria | 25142 |
| 115 | Ga0070679_100613928 | 3300005530 | Unclassified | 1031 |
| 116 | Ga0070697_100001249 | 3300005536 | Bacteria | 19212 |
| 117 | Ga0070697_100015909 | 3300005536 | Bacteria | 5911 |
| 118 | Ga0070697_100051765 | 3300005536 | Bacteria | 3337 |
| 119 | Ga0070697_100077341 | 3300005536 | Bacteria | 2737 |
| 120 | Ga0070697_100290497 | 3300005536 | Bacteria | 1404 |
| 121 | Ga0070697_100301139 | 3300005536 | Unclassified | 1378 |
| 122 | Ga0068853_100023276 | 3300005539 | Bacteria | 5183 |
| 123 | Ga0068853_100237913 | 3300005539 | Unclassified | 1668 |
| 124 | Ga0070672_100078538 | 3300005543 | Bacteria | 2641 |
| 125 | Ga0070686_100001371 | 3300005544 | Bacteria | 13763 |
| 126 | Ga0070686_100005585 | 3300005544 | Bacteria | 6965 |
| 127 | Ga0070686_100015302 | 3300005544 | Bacteria | 4440 |
| 128 | Ga0070686_100133826 | 3300005544 | Bacteria | 1717 |
| 129 | Ga0070695_100033194 | 3300005545 | Bacteria | 3229 |
| 130 | Ga0070695_100033440 | 3300005545 | Unclassified | 3217 |
| 131 | Ga0070695_100148354 | 3300005545 | Unclassified | 1634 |
| 132 | Ga0070695_100207067 | 3300005545 | Unclassified | 1405 |
| 133 | Ga0070695_100312936 | 3300005545 | Bacteria | 1164 |
| 134 | Ga0070695_100522003 | 3300005545 | Unclassified | 921 |
| 135 | Ga0070695_100526977 | 3300005545 | Bacteria | 918 |
| 136 | Ga0070695_100680878 | 3300005545 | Unclassified | 815 |
| 137 | Ga0070695_101168978 | 3300005545 | Unclassified | 632 |
| 138 | Ga0070696_100038719 | 3300005546 | Unclassified | 3291 |
| 139 | Ga0070696_100071082 | 3300005546 | Bacteria | 2448 |
| 140 | Ga0070696_100080442 | 3300005546 | Bacteria | 2307 |
| 141 | Ga0070696_100497681 | 3300005546 | Bacteria | 969 |
| 142 | Ga0070696_100556121 | 3300005546 | Unclassified | 920 |
| 143 | Ga0070696_100616561 | 3300005546 | Bacteria | 876 |
| 144 | Ga0070696_100677561 | 3300005546 | Bacteria | 839 |
| 145 | Ga0070696_100742564 | 3300005546 | Bacteria | 803 |
| 146 | Ga0070696_101362650 | 3300005546 | Unclassified | 604 |
| 147 | Ga0070696_101521236 | 3300005546 | Unclassified | 573 |
| 148 | Ga0070696_101744563 | 3300005546 | Unclassified | 537 |
| 149 | Ga0070693_100020783 | 3300005547 | Unclassified | 3469 |
| 150 | Ga0070693_100027954 | 3300005547 | Bacteria | 3062 |
| 151 | Ga0070693_100044478 | 3300005547 | Bacteria | 2512 |
| 152 | Ga0070693_100057943 | 3300005547 | Bacteria | 2241 |
| 153 | Ga0070693_100104883 | 3300005547 | Bacteria | 1728 |
| 154 | Ga0070693_100252258 | 3300005547 | Bacteria | 1170 |
| 155 | Ga0070693_100537418 | 3300005547 | Unclassified | 835 |
| 156 | Ga0070693_100845542 | 3300005547 | Bacteria | 682 |
| 157 | Ga0070693_100882560 | 3300005547 | Unclassified | 669 |
| 158 | Ga0070693_101469292 | 3300005547 | Unclassified | 532 |
| 159 | Ga0070665_100237253 | 3300005548 | Bacteria | 1824 |
| 160 | Ga0070665_100331573 | 3300005548 | Unclassified | 1526 |
| 161 | Ga0070665_102332044 | 3300005548 | Unclassified | 538 |
| 162 | Ga0070704_100102689 | 3300005549 | Bacteria | 2158 |
| 163 | Ga0070704_100182498 | 3300005549 | Bacteria | 1680 |
| 164 | Ga0070704_100226739 | 3300005549 | Bacteria | 1522 |
| 165 | Ga0070704_100280816 | 3300005549 | Bacteria | 1379 |
| 166 | Ga0070704_100459256 | 3300005549 | Unclassified | 1098 |
| 167 | Ga0068855_100452441 | 3300005563 | Bacteria | 1401 |
| 168 | Ga0068855_100528694 | 3300005563 | Unclassified | 1279 |
| 169 | Ga0068855_100893551 | 3300005563 | Bacteria | 939 |
| 170 | Ga0070664_100000280 | 3300005564 | Bacteria | 36774 |
| 171 | Ga0070664_100119898 | 3300005564 | Unclassified | 2302 |
| 172 | Ga0070664_102175883 | 3300005564 | Bacteria | 526 |
| 173 | Ga0068857_100122099 | 3300005577 | Bacteria | 2346 |
| 174 | Ga0068857_100212738 | 3300005577 | Bacteria | 1764 |
| 175 | Ga0068857_100349003 | 3300005577 | Unclassified | 1370 |
| 176 | Ga0068857_100653258 | 3300005577 | Unclassified | 997 |
| 177 | Ga0068857_100760759 | 3300005577 | Unclassified | 923 |
| 178 | Ga0068857_100836303 | 3300005577 | Unclassified | 880 |
| 179 | Ga0068857_102321465 | 3300005577 | Unclassified | 527 |
| 180 | Ga0068854_100032703 | 3300005578 | Bacteria | 3620 |
| 181 | Ga0068854_100164158 | 3300005578 | Bacteria | 1723 |
| 182 | Ga0068854_101715774 | 3300005578 | Bacteria | 574 |
| 183 | Ga0070702_100006101 | 3300005615 | Bacteria | 5680 |
| 184 | Ga0070702_100033570 | 3300005615 | Unclassified | 2823 |
| 185 | Ga0070702_100101099 | 3300005615 | Bacteria | 1768 |
| 186 | Ga0070702_100447637 | 3300005615 | Unclassified | 936 |
| 187 | Ga0068852_100701405 | 3300005616 | Bacteria | 1022 |
| 188 | Ga0068859_100025877 | 3300005617 | Bacteria | 5887 |
| 189 | Ga0068859_100029302 | 3300005617 | Bacteria | 5523 |
| 190 | Ga0068859_100070298 | 3300005617 | Bacteria | 3536 |
| 191 | Ga0068859_100133157 | 3300005617 | Bacteria | 2558 |
| 192 | Ga0068859_100303936 | 3300005617 | Bacteria | 1689 |
| 193 | Ga0068859_100365645 | 3300005617 | Bacteria | 1538 |
| 194 | Ga0068859_100766061 | 3300005617 | Unclassified | 1054 |
| 195 | Ga0068859_101277854 | 3300005617 | Bacteria | 809 |
| 196 | Ga0068864_100006535 | 3300005618 | Bacteria | 9549 |
| 197 | Ga0068864_100008450 | 3300005618 | Bacteria | 8495 |
| 198 | Ga0068864_100061563 | 3300005618 | Bacteria | 3251 |
| 199 | Ga0068864_100084118 | 3300005618 | Bacteria | 2795 |
| 200 | Ga0068864_100280836 | 3300005618 | Unclassified | 1554 |
| 201 | Ga0068861_100014624 | 3300005719 | Bacteria | 5510 |
| 202 | Ga0068861_100016533 | 3300005719 | Bacteria | 5222 |
| 203 | Ga0068861_100139219 | 3300005719 | Bacteria | 1979 |
| 204 | Ga0068861_100227236 | 3300005719 | Unclassified | 1581 |
| 205 | Ga0068861_100381937 | 3300005719 | Unclassified | 1245 |
| 206 | Ga0068861_100418111 | 3300005719 | Bacteria | 1194 |
| 207 | Ga0068861_100908791 | 3300005719 | Bacteria | 834 |
| 208 | Ga0068851_10001259 | 3300005834 | Bacteria | 11028 |
| 209 | Ga0068851_10237553 | 3300005834 | Unclassified | 1029 |
| 210 | Ga0068870_10020860 | 3300005840 | Bacteria | 3197 |
| 211 | Ga0068870_10135920 | 3300005840 | Bacteria | 1433 |
| 212 | Ga0068863_100038388 | 3300005841 | Bacteria | 4556 |
| 213 | Ga0068863_100478103 | 3300005841 | Unclassified | 1225 |
| 214 | Ga0068858_100135158 | 3300005842 | Unclassified | 2313 |
| 215 | Ga0068858_100169903 | 3300005842 | Bacteria | 2055 |
| 216 | Ga0068858_100530465 | 3300005842 | Unclassified | 1139 |
| 217 | Ga0068860_100044023 | 3300005843 | Unclassified | 4256 |
| 218 | Ga0068860_100092019 | 3300005843 | Bacteria | 2889 |
| 219 | Ga0068860_100093365 | 3300005843 | Bacteria | 2868 |
| 220 | Ga0068860_100510401 | 3300005843 | Unclassified | 1201 |
| 221 | Ga0068860_101756984 | 3300005843 | Unclassified | 642 |
| 222 | Ga0068862_100003102 | 3300005844 | Archaea | 14486 |
| 223 | Ga0068862_100085631 | 3300005844 | Unclassified | 2739 |
| 224 | Ga0068862_100124211 | 3300005844 | Bacteria | 2278 |
| 225 | Ga0068862_100707901 | 3300005844 | Bacteria | 976 |
| 226 | Ga0068862_101070959 | 3300005844 | Bacteria | 800 |
| 227 | Ga0081539_10006263 | 3300005985 | Bacteria | 11516 |
| 228 | Ga0070716_100000012 | 3300006173 | Bacteria | 104713 |
| 229 | Ga0070716_100795099 | 3300006173 | Unclassified | 732 |
| 230 | Ga0097621_100122322 | 3300006237 | Unclassified | 2208 |
| 231 | Ga0068871_100004614 | 3300006358 | Bacteria | 9619 |
| 232 | Ga0068871_100524317 | 3300006358 | Unclassified | 1070 |
| 233 | Ga0075428_100198369 | 3300006844 | Bacteria | 2170 |
| 234 | Ga0075428_101920198 | 3300006844 | Unclassified | 615 |
| 235 | Ga0075430_100210691 | 3300006846 | Unclassified | 1612 |
| 236 | Ga0075431_100259055 | 3300006847 | Bacteria | 1765 |
| 237 | Ga0075433_10080606 | 3300006852 | Bacteria | 2870 |
| 238 | Ga0075433_10222188 | 3300006852 | Unclassified | 1678 |
| 239 | Ga0075433_10311108 | 3300006852 | Bacteria | 1394 |
| 240 | Ga0075433_10380265 | 3300006852 | Bacteria | 1247 |
| 241 | Ga0075433_10407300 | 3300006852 | Unclassified | 1200 |
| 242 | Ga0075433_10555238 | 3300006852 | Unclassified | 1009 |
| 243 | Ga0075433_10607392 | 3300006852 | Unclassified | 960 |
| 244 | Ga0075433_10639284 | 3300006852 | Bacteria | 933 |
| 245 | Ga0075433_11112375 | 3300006852 | Unclassified | 687 |
| 246 | Ga0075433_11203234 | 3300006852 | Unclassified | 657 |
| 247 | Ga0075434_100141130 | 3300006871 | Bacteria | 2429 |
| 248 | Ga0075434_100248628 | 3300006871 | Bacteria | 1797 |
| 249 | Ga0075434_100267820 | 3300006871 | Bacteria | 1728 |
| 250 | Ga0075434_100445819 | 3300006871 | Bacteria | 1315 |
| 251 | Ga0075434_100555824 | 3300006871 | Bacteria | 1167 |
| 252 | Ga0075434_101531921 | 3300006871 | Unclassified | 676 |
| 253 | Ga0075429_101712404 | 3300006880 | Unclassified | 546 |
| 254 | Ga0068865_100169397 | 3300006881 | Bacteria | 1673 |
| 255 | Ga0068865_100834728 | 3300006881 | Bacteria | 797 |
| 256 | Ga0068865_101082388 | 3300006881 | Unclassified | 705 |
| 257 | Ga0075436_100000008 | 3300006914 | Bacteria | 279288 |
| 258 | Ga0097620_100022921 | 3300006931 | Bacteria | 6261 |
| 259 | Ga0097620_100025876 | 3300006931 | Bacteria | 5887 |
| 260 | Ga0097620_100029302 | 3300006931 | Bacteria | 5523 |
| 261 | Ga0097620_100070298 | 3300006931 | Bacteria | 3536 |
| 262 | Ga0097620_100133147 | 3300006931 | Bacteria | 2558 |
| 263 | Ga0097620_100303954 | 3300006931 | Bacteria | 1689 |
| 264 | Ga0097620_100365624 | 3300006931 | Bacteria | 1538 |
| 265 | Ga0097620_100766002 | 3300006931 | Unclassified | 1054 |
| 266 | Ga0097620_101277914 | 3300006931 | Bacteria | 809 |
| 267 | Ga0075435_100000657 | 3300007076 | Bacteria | 21295 |
| 268 | Ga0075435_100333078 | 3300007076 | Bacteria | 1300 |
| 269 | Ga0075435_100518848 | 3300007076 | Bacteria | 1031 |
| 270 | Ga0075435_100623357 | 3300007076 | Bacteria | 936 |
| 271 | Ga0105250_10237989 | 3300009092 | Bacteria | 776 |
| 272 | Ga0105240_10033105 | 3300009093 | Bacteria | 6682 |
| 273 | Ga0105240_11672592 | 3300009093 | Unclassified | 665 |
| 274 | Ga0111539_10066768 | 3300009094 | Bacteria | 4249 |
| 275 | Ga0111539_10075347 | 3300009094 | Bacteria | 3975 |
| 276 | Ga0111539_10407401 | 3300009094 | Unclassified | 1584 |
| 277 | Ga0111539_10791953 | 3300009094 | Bacteria | 1103 |
| 278 | Ga0111539_11332911 | 3300009094 | Bacteria | 833 |
| 279 | Ga0111539_11632552 | 3300009094 | Unclassified | 748 |
| 280 | Ga0105245_10031484 | 3300009098 | Bacteria | 4695 |
| 281 | Ga0105245_10243687 | 3300009098 | Bacteria | 1744 |
| 282 | Ga0105247_10000022 | 3300009101 | Bacteria | 219796 |
| 283 | Ga0105247_10050406 | 3300009101 | Unclassified | 2562 |
| 284 | Ga0105247_10050783 | 3300009101 | Bacteria | 2552 |
| 285 | Ga0114129_10010729 | 3300009147 | Bacteria | 13061 |
| 286 | Ga0114129_10012953 | 3300009147 | Bacteria | 11870 |
| 287 | Ga0114129_10024247 | 3300009147 | Bacteria | 8595 |
| 288 | Ga0114129_10032222 | 3300009147 | Bacteria | 7407 |
| 289 | Ga0114129_10071099 | 3300009147 | Unclassified | 4852 |
| 290 | Ga0114129_10148006 | 3300009147 | Unclassified | 3215 |
| 291 | Ga0114129_10287436 | 3300009147 | Bacteria | 2195 |
| 292 | Ga0114129_10295788 | 3300009147 | Bacteria | 2160 |
| 293 | Ga0114129_10523028 | 3300009147 | Bacteria | 1546 |
| 294 | Ga0114129_10632452 | 3300009147 | Bacteria | 1383 |
| 295 | Ga0105243_10089093 | 3300009148 | Bacteria | 2536 |
| 296 | Ga0105243_10123361 | 3300009148 | Bacteria | 2188 |
| 297 | Ga0105243_10137616 | 3300009148 | Bacteria | 2080 |
| 298 | Ga0105243_10281928 | 3300009148 | Bacteria | 1497 |
| 299 | Ga0105241_10035999 | 3300009174 | Bacteria | 3724 |
| 300 | Ga0105241_10151114 | 3300009174 | Bacteria | 1900 |
| 301 | Ga0105241_10399327 | 3300009174 | Bacteria | 1205 |
| 302 | Ga0105241_10447469 | 3300009174 | Unclassified | 1142 |
| 303 | Ga0105242_10030053 | 3300009176 | Bacteria | 4337 |
| 304 | Ga0105242_11175649 | 3300009176 | Unclassified | 785 |
| 305 | Ga0105248_10009310 | 3300009177 | Bacteria | 10815 |
| 306 | Ga0105248_10014875 | 3300009177 | Bacteria | 8571 |
| 307 | Ga0105248_10017565 | 3300009177 | Bacteria | 7890 |
| 308 | Ga0105248_10017834 | 3300009177 | Bacteria | 7835 |
| 309 | Ga0105248_10019260 | 3300009177 | Bacteria | 7552 |
| 310 | Ga0105248_10376981 | 3300009177 | Bacteria | 1597 |
| 311 | Ga0105237_10002331 | 3300009545 | Bacteria | 23574 |
| 312 | Ga0105237_10023809 | 3300009545 | Bacteria | 6268 |
| 313 | Ga0105249_10003383 | 3300009553 | Bacteria | 13814 |
| 314 | Ga0105249_10063590 | 3300009553 | Unclassified | 3391 |
| 315 | Ga0105249_10180662 | 3300009553 | Bacteria | 2052 |
| 316 | Ga0105249_10441316 | 3300009553 | Unclassified | 1339 |
| 317 | Ga0105249_11240701 | 3300009553 | Unclassified | 817 |
| 318 | Ga0105249_11375886 | 3300009553 | Unclassified | 778 |
| 319 | Ga0105239_10169708 | 3300010375 | Bacteria | 2439 |
| 320 | Ga0105239_10689382 | 3300010375 | Unclassified | 1168 |
| 321 | Ga0105239_11038816 | 3300010375 | Unclassified | 943 |
| 322 | Ga0105239_11075455 | 3300010375 | Bacteria | 926 |
| 323 | Ga0157373_10006812 | 3300013100 | Bacteria | 8510 |
| 324 | Ga0157373_10074546 | 3300013100 | Bacteria | 2394 |
| 325 | Ga0157373_10940040 | 3300013100 | Bacteria | 643 |
| 326 | Ga0157374_10214858 | 3300013296 | Bacteria | 1886 |
| 327 | Ga0157374_10361457 | 3300013296 | Bacteria | 1444 |
| 328 | Ga0157378_10015696 | 3300013297 | Bacteria | 6632 |
| 329 | Ga0157378_10042680 | 3300013297 | Bacteria | 4025 |
| 330 | Ga0157378_10083853 | 3300013297 | Bacteria | 2885 |
| 331 | Ga0157378_10132132 | 3300013297 | Bacteria | 2312 |
| 332 | Ga0157378_10169726 | 3300013297 | Bacteria | 2045 |
| 333 | Ga0157378_10307048 | 3300013297 | Unclassified | 1537 |
| 334 | Ga0157378_10310127 | 3300013297 | Bacteria | 1530 |
| 335 | Ga0157378_11043065 | 3300013297 | Bacteria | 853 |
| 336 | Ga0157378_11187219 | 3300013297 | Unclassified | 802 |
| 337 | Ga0157378_11688129 | 3300013297 | Unclassified | 680 |
| 338 | Ga0157378_12214839 | 3300013297 | Unclassified | 601 |
| 339 | Ga0163162_10000211 | 3300013306 | Bacteria | 54106 |
| 340 | Ga0163162_10016961 | 3300013306 | Bacteria | 7124 |
| 341 | Ga0163162_10065551 | 3300013306 | Bacteria | 3679 |
| 342 | Ga0163162_10140917 | 3300013306 | Bacteria | 2524 |
| 343 | Ga0163162_10647944 | 3300013306 | Bacteria | 1180 |
| 344 | Ga0163162_11186863 | 3300013306 | Unclassified | 866 |
| 345 | Ga0163162_11928368 | 3300013306 | Unclassified | 676 |
| 346 | Ga0157372_10106832 | 3300013307 | Bacteria | 3202 |
| 347 | Ga0157372_10723993 | 3300013307 | Bacteria | 1157 |
| 348 | Ga0157375_10026487 | 3300013308 | Bacteria | 5404 |
| 349 | Ga0157375_10139066 | 3300013308 | Bacteria | 2554 |
| 350 | Ga0157375_10194525 | 3300013308 | Bacteria | 2183 |
| 351 | Ga0157375_10402460 | 3300013308 | Unclassified | 1535 |
| 352 | Ga0157375_10694618 | 3300013308 | Bacteria | 1171 |
| 353 | Ga0157375_11374088 | 3300013308 | Unclassified | 832 |
| 354 | Ga0157375_12394264 | 3300013308 | Unclassified | 630 |
| 355 | Ga0163163_10106971 | 3300014325 | Unclassified | 2823 |
| 356 | Ga0163163_10115482 | 3300014325 | Bacteria | 2716 |
| 357 | Ga0163163_10121817 | 3300014325 | Bacteria | 2643 |
| 358 | Ga0163163_10131326 | 3300014325 | Bacteria | 2545 |
| 359 | Ga0163163_10339077 | 3300014325 | Bacteria | 1558 |
| 360 | Ga0163163_10559558 | 3300014325 | Unclassified | 1206 |
| 361 | Ga0163163_10729900 | 3300014325 | Bacteria | 1054 |
| 362 | Ga0157380_10000458 | 3300014326 | Bacteria | 24909 |
| 363 | Ga0157380_10004242 | 3300014326 | Bacteria | 9917 |
| 364 | Ga0157380_10017254 | 3300014326 | Bacteria | 5341 |
| 365 | Ga0157380_10106964 | 3300014326 | Bacteria | 2342 |
| 366 | Ga0157380_10450837 | 3300014326 | Unclassified | 1235 |
| 367 | Ga0157380_10979145 | 3300014326 | Bacteria | 878 |
| 368 | Ga0157380_11082871 | 3300014326 | Unclassified | 839 |
| 369 | Ga0157380_11083649 | 3300014326 | Unclassified | 839 |
| 370 | Ga0157380_13266517 | 3300014326 | Unclassified | 518 |
| 371 | Ga0157377_10026346 | 3300014745 | Bacteria | 3111 |
| 372 | Ga0157377_10197640 | 3300014745 | Bacteria | 1275 |
| 373 | Ga0157377_11259257 | 3300014745 | Unclassified | 576 |
| 374 | Ga0157377_11360540 | 3300014745 | Unclassified | 558 |
| 375 | Ga0157379_10253503 | 3300014968 | Unclassified | 1598 |
| 376 | Ga0157379_10433325 | 3300014968 | Bacteria | 1212 |
| 377 | Ga0157379_10560298 | 3300014968 | Bacteria | 1064 |
| 378 | Ga0157376_10023487 | 3300014969 | Unclassified | 4825 |
| 379 | Ga0182007_10047454 | 3300015262 | Bacteria | 1420 |
| 380 | Ga0163161_10184212 | 3300017792 | Unclassified | 1602 |
| 381 | Ga0207656_10001046 | 3300025321 | Bacteria | 9052 |
| 382 | Ga0207656_10256353 | 3300025321 | Unclassified | 858 |
| 383 | Ga0207642_10052144 | 3300025899 | Bacteria | 1854 |
| 384 | Ga0207710_10085947 | 3300025900 | Bacteria | 1465 |
| 385 | Ga0207688_10063821 | 3300025901 | Bacteria | 2078 |
| 386 | Ga0207680_10284890 | 3300025903 | Bacteria | 1149 |
| 387 | Ga0207647_10103692 | 3300025904 | Bacteria | 1686 |
| 388 | Ga0207699_10644239 | 3300025906 | Unclassified | 774 |
| 389 | Ga0207643_10000647 | 3300025908 | Bacteria | 21741 |
| 390 | Ga0207643_10225307 | 3300025908 | Bacteria | 1149 |
| 391 | Ga0207643_10410547 | 3300025908 | Unclassified | 857 |
| 392 | Ga0207684_10000076 | 3300025910 | Bacteria | 183107 |
| 393 | Ga0207684_10136755 | 3300025910 | Bacteria | 2104 |
| 394 | Ga0207654_10248765 | 3300025911 | Unclassified | 1191 |
| 395 | Ga0207654_10377527 | 3300025911 | Unclassified | 981 |
| 396 | Ga0207654_11097219 | 3300025911 | Unclassified | 580 |
| 397 | Ga0207707_10000077 | 3300025912 | Bacteria | 100255 |
| 398 | Ga0207707_10132876 | 3300025912 | Bacteria | 2176 |
| 399 | Ga0207707_10783846 | 3300025912 | Unclassified | 795 |
| 400 | Ga0207707_11233302 | 3300025912 | Bacteria | 604 |
| 401 | Ga0207695_10035380 | 3300025913 | Bacteria | 5417 |
| 402 | Ga0207695_10497787 | 3300025913 | Unclassified | 1101 |
| 403 | Ga0207671_10013536 | 3300025914 | Bacteria | 6496 |
| 404 | Ga0207671_10065685 | 3300025914 | Bacteria | 2699 |
| 405 | Ga0207660_10003294 | 3300025917 | Bacteria | 10566 |
| 406 | Ga0207660_10054506 | 3300025917 | Bacteria | 2854 |
| 407 | Ga0207660_11344826 | 3300025917 | Unclassified | 580 |
| 408 | Ga0207660_11622150 | 3300025917 | Unclassified | 521 |
| 409 | Ga0207649_10434713 | 3300025920 | Unclassified | 988 |
| 410 | Ga0207652_10000096 | 3300025921 | Bacteria | 96047 |
| 411 | Ga0207652_10052088 | 3300025921 | Bacteria | 3511 |
| 412 | Ga0207652_11136367 | 3300025921 | Unclassified | 682 |
| 413 | Ga0207646_10037160 | 3300025922 | Bacteria | 4392 |
| 414 | Ga0207646_10117585 | 3300025922 | Unclassified | 2388 |
| 415 | Ga0207646_10297368 | 3300025922 | Bacteria | 1458 |
| 416 | Ga0207646_10515361 | 3300025922 | Bacteria | 1077 |
| 417 | Ga0207646_10589550 | 3300025922 | Bacteria | 998 |
| 418 | Ga0207681_10012688 | 3300025923 | Bacteria | 5203 |
| 419 | Ga0207681_10066931 | 3300025923 | Bacteria | 2488 |
| 420 | Ga0207681_10447159 | 3300025923 | Unclassified | 1051 |
| 421 | Ga0207681_10823485 | 3300025923 | Unclassified | 776 |
| 422 | Ga0207681_11014575 | 3300025923 | Bacteria | 696 |
| 423 | Ga0207650_10000046 | 3300025925 | Bacteria | 178190 |
| 424 | Ga0207650_10051485 | 3300025925 | Bacteria | 3048 |
| 425 | Ga0207650_10067177 | 3300025925 | Unclassified | 2690 |
| 426 | Ga0207650_10213375 | 3300025925 | Bacteria | 1551 |
| 427 | Ga0207659_10133275 | 3300025926 | Bacteria | 1921 |
| 428 | Ga0207659_10180294 | 3300025926 | Bacteria | 1673 |
| 429 | Ga0207644_10085138 | 3300025931 | Bacteria | 2344 |
| 430 | Ga0207644_10350548 | 3300025931 | Unclassified | 1198 |
| 431 | Ga0207644_10559365 | 3300025931 | Bacteria | 947 |
| 432 | Ga0207690_10273905 | 3300025932 | Unclassified | 1312 |
| 433 | Ga0207706_10093709 | 3300025933 | Bacteria | 2641 |
| 434 | Ga0207706_10440014 | 3300025933 | Bacteria | 1129 |
| 435 | Ga0207706_10769731 | 3300025933 | Bacteria | 819 |
| 436 | Ga0207706_10849966 | 3300025933 | Unclassified | 773 |
| 437 | Ga0207686_10676344 | 3300025934 | Unclassified | 818 |
| 438 | Ga0207686_11102442 | 3300025934 | Bacteria | 647 |
| 439 | Ga0207709_10264476 | 3300025935 | Bacteria | 1263 |
| 440 | Ga0207670_10000763 | 3300025936 | Bacteria | 16922 |
| 441 | Ga0207670_10012111 | 3300025936 | Bacteria | 5032 |
| 442 | Ga0207670_10803206 | 3300025936 | Unclassified | 784 |
| 443 | Ga0207669_10454225 | 3300025937 | Bacteria | 1016 |
| 444 | Ga0207704_10046662 | 3300025938 | Bacteria | 2584 |
| 445 | Ga0207665_10000083 | 3300025939 | Bacteria | 61629 |
| 446 | Ga0207665_10305231 | 3300025939 | Bacteria | 1191 |
| 447 | Ga0207665_10740284 | 3300025939 | Bacteria | 775 |
| 448 | Ga0207691_11005150 | 3300025940 | Bacteria | 696 |
| 449 | Ga0207711_10011687 | 3300025941 | Bacteria | 7295 |
| 450 | Ga0207711_10039251 | 3300025941 | Unclassified | 4027 |
| 451 | Ga0207711_10049360 | 3300025941 | Bacteria | 3603 |
| 452 | Ga0207711_10106759 | 3300025941 | Bacteria | 2485 |
| 453 | Ga0207711_10457213 | 3300025941 | Bacteria | 1189 |
| 454 | Ga0207689_10001656 | 3300025942 | Archaea | 21117 |
| 455 | Ga0207689_10032217 | 3300025942 | Bacteria | 4361 |
| 456 | Ga0207689_10033563 | 3300025942 | Bacteria | 4264 |
| 457 | Ga0207689_10214880 | 3300025942 | Unclassified | 1589 |
| 458 | Ga0207689_10659302 | 3300025942 | Bacteria | 882 |
| 459 | Ga0207689_10880028 | 3300025942 | Unclassified | 756 |
| 460 | Ga0207689_11061889 | 3300025942 | Unclassified | 683 |
| 461 | Ga0207679_10092924 | 3300025945 | Bacteria | 2338 |
| 462 | Ga0207679_10116393 | 3300025945 | Unclassified | 2119 |
| 463 | Ga0207679_10465659 | 3300025945 | Unclassified | 1123 |
| 464 | Ga0207679_10814893 | 3300025945 | Unclassified | 851 |
| 465 | Ga0207667_10486139 | 3300025949 | Unclassified | 1253 |
| 466 | Ga0207651_10135034 | 3300025960 | Bacteria | 1896 |
| 467 | Ga0207651_11802035 | 3300025960 | Bacteria | 551 |
| 468 | Ga0207712_10000180 | 3300025961 | Bacteria | 65420 |
| 469 | Ga0207712_11854099 | 3300025961 | Unclassified | 540 |
| 470 | Ga0207668_10005528 | 3300025972 | Bacteria | 7453 |
| 471 | Ga0207640_10190588 | 3300025981 | Unclassified | 1545 |
| 472 | Ga0207640_10628401 | 3300025981 | Unclassified | 912 |
| 473 | Ga0207658_10340553 | 3300025986 | Bacteria | 1303 |
| 474 | Ga0207677_10968582 | 3300026023 | Bacteria | 770 |
| 475 | Ga0207703_10063880 | 3300026035 | Bacteria | 3020 |
| 476 | Ga0207703_10112040 | 3300026035 | Bacteria | 2330 |
| 477 | Ga0207703_10159045 | 3300026035 | Unclassified | 1977 |
| 478 | Ga0207703_10275022 | 3300026035 | Unclassified | 1527 |
| 479 | Ga0207639_10226276 | 3300026041 | Bacteria | 1618 |
| 480 | Ga0207708_10001596 | 3300026075 | Bacteria | 16898 |
| 481 | Ga0207708_10002110 | 3300026075 | Archaea | 14647 |
| 482 | Ga0207708_10049837 | 3300026075 | Unclassified | 3189 |
| 483 | Ga0207708_10287383 | 3300026075 | Unclassified | 1334 |
| 484 | Ga0207702_11352997 | 3300026078 | Bacteria | 706 |
| 485 | Ga0207641_10029830 | 3300026088 | Bacteria | 4511 |
| 486 | Ga0207641_11350037 | 3300026088 | Unclassified | 714 |
| 487 | Ga0207648_10100305 | 3300026089 | Bacteria | 2536 |
| 488 | Ga0207648_10194024 | 3300026089 | Unclassified | 1800 |
| 489 | Ga0207648_10402158 | 3300026089 | Bacteria | 1241 |
| 490 | Ga0207676_10027189 | 3300026095 | Bacteria | 4259 |
| 491 | Ga0207676_10036154 | 3300026095 | Bacteria | 3755 |
| 492 | Ga0207676_10566753 | 3300026095 | Unclassified | 1087 |
| 493 | Ga0207676_10686951 | 3300026095 | Unclassified | 990 |
| 494 | Ga0207674_10000525 | 3300026116 | Bacteria | 50323 |
| 495 | Ga0207674_10333436 | 3300026116 | Unclassified | 1467 |
| 496 | Ga0207674_10554132 | 3300026116 | Unclassified | 1111 |
| 497 | Ga0207674_11345543 | 3300026116 | Bacteria | 684 |
| 498 | Ga0207674_11388719 | 3300026116 | Unclassified | 672 |
| 499 | Ga0207674_12120573 | 3300026116 | Bacteria | 526 |
| 500 | Ga0207675_100002078 | 3300026118 | Bacteria | 19905 |
| 501 | Ga0207675_100008022 | 3300026118 | Bacteria | 9948 |
| 502 | Ga0207675_100042397 | 3300026118 | Bacteria | 4249 |
| 503 | Ga0207675_100094682 | 3300026118 | Unclassified | 2809 |
| 504 | Ga0207675_100135471 | 3300026118 | Bacteria | 2337 |
| 505 | Ga0207675_100314590 | 3300026118 | Bacteria | 1527 |
| 506 | Ga0207675_100890079 | 3300026118 | Unclassified | 906 |
| 507 | Ga0207675_101983361 | 3300026118 | Unclassified | 600 |
| 508 | Ga0207683_10816234 | 3300026121 | Unclassified | 866 |
| 509 | Ga0207698_10298801 | 3300026142 | Bacteria | 1498 |
| 510 | Ga0207428_11008619 | 3300027907 | Unclassified | 585 |
| 511 | Ga0268266_10272964 | 3300028379 | Unclassified | 1570 |
| 512 | Ga0268265_10044278 | 3300028380 | Bacteria | 3313 |
| 513 | Ga0268265_10121529 | 3300028380 | Unclassified | 2152 |
| 514 | Ga0268265_10134589 | 3300028380 | Bacteria | 2060 |
| 515 | Ga0268265_10312769 | 3300028380 | Unclassified | 1419 |
| 516 | Ga0268265_12482769 | 3300028380 | Unclassified | 524 |
| 517 | Ga0268264_10204624 | 3300028381 | Bacteria | 1808 |
| 518 | Ga0268264_10296213 | 3300028381 | Unclassified | 1521 |
| 519 | Ga0268264_10310489 | 3300028381 | Unclassified | 1488 |
| 520 | Ga0268264_11250357 | 3300028381 | Bacteria | 752 |
| 521 | Ga0314311_1182293 | 3300030733 | Unclassified | 897 |
| 522 | Ga0316182_1226790 | 3300030745 | Bacteria | 1269 |
| 523 | Ga0307513_10379700 | 3300031456 | Bacteria | 1153 |
| 524 | Ga0307408_100001826 | 3300031548 | Bacteria | 15513 |
| 525 | Ga0307405_10313060 | 3300031731 | Unclassified | 1196 |
| 526 | Ga0307405_10371494 | 3300031731 | Unclassified | 1110 |
| 527 | Ga0307413_10132294 | 3300031824 | Bacteria | 1710 |
| 528 | Ga0307413_11132243 | 3300031824 | Unclassified | 677 |
| 529 | Ga0307410_10295896 | 3300031852 | Unclassified | 1275 |
| 530 | Ga0307410_10934100 | 3300031852 | Unclassified | 745 |
| 531 | Ga0307406_10098592 | 3300031901 | Bacteria | 1984 |
| 532 | Ga0307412_10008770 | 3300031911 | Bacteria | 5788 |
| 533 | Ga0307412_10061834 | 3300031911 | Unclassified | 2519 |
| 534 | Ga0307412_10086405 | 3300031911 | Bacteria | 2182 |
| 535 | Ga0307412_10136563 | 3300031911 | Bacteria | 1790 |
| 536 | Ga0307412_10411338 | 3300031911 | Bacteria | 1104 |
| 537 | Ga0307409_101193563 | 3300031995 | Bacteria | 784 |
| 538 | Ga0307416_100096334 | 3300032002 | Bacteria | 2558 |
| 539 | Ga0307416_100214558 | 3300032002 | Bacteria | 1839 |
| 540 | Ga0307416_101105258 | 3300032002 | Unclassified | 897 |
| 541 | Ga0307414_10061215 | 3300032004 | Bacteria | 2665 |
| 542 | Ga0307414_10110428 | 3300032004 | Bacteria | 2092 |
| 543 | Ga0307414_10257688 | 3300032004 | Unclassified | 1454 |
| 544 | Ga0307415_100014139 | 3300032126 | Bacteria | 4681 |
| 545 | Ga0307415_100064647 | 3300032126 | Bacteria | 2546 |
| 546 | Ga0307415_100262921 | 3300032126 | Bacteria | 1409 |
| 547 | Ga0373948_0084537 | 3300034817 | Bacteria | 729 |
| 548 | Ga0373932_0120749 | 3300035112 | Unclassified | 874 |
| 549 | Ga0373941_0127320 | 3300035115 | Bacteria | 914 |
| 550 | Ga0373955_0262993 | 3300035172 | Bacteria | 1036 |
| 551 | Ga0373937_0363148 | 3300036401 | Unclassified | 1372 |
| 552 | Ga0395899_0593758 | 3300037312 | Unclassified | 706 |
| 553 | Ga0395900_0715596 | 3300037418 | Bacteria | 934 |
| 554 | Ga0395900_0794110 | 3300037418 | Unclassified | 875 |
| 555 | Ga0395898_0094590 | 3300037466 | Unclassified | 2872 |
| 556 | Ga0395901_0270921 | 3300038443 | Bacteria | 1766 |
| 557 | Ga0395901_0328652 | 3300038443 | Bacteria | 1581 |
| 558 | Ga0395901_0884954 | 3300038443 | Bacteria | 876 |
| 559 | Ga0242420_019812 | 3300038996 | Unclassified | 1193 |
| 560 | Ga0439433_0046014 | 3300041999 | Unclassified | 1022 |
| 561 | Ga0439448_0083464 | 3300042005 | Bacteria | 1075 |
| 562 | Ga0439455_0099901 | 3300042012 | Bacteria | 801 |
| 563 | Ga0450888_019589 | 3300042126 | Unclassified | 854 |
| 564 | Ga0439458_0023958 | 3300042157 | Bacteria | 1425 |
| 565 | Ga0439464_0061793 | 3300042439 | Bacteria | 1097 |
| 566 | Ga0495663_0000636 | 3300046525 | Bacteria | 12174 |
| 567 | Ga0495640_0973082 | 3300046533 | Unclassified | 501 |
| 568 | Ga0495598_0000339 | 3300046537 | Bacteria | 8340 |
| 569 | Ga0495621_0001370 | 3300046539 | Bacteria | 6311 |
| 570 | Ga0495636_0182103 | 3300047318 | Bacteria | 954 |
| 571 | Ga0496104_0142126 | 3300048907 | Bacteria | 2306 |
| 572 | Ga0496107_0061191 | 3300048910 | Unclassified | 2726 |
| 573 | Ga0496108_0161836 | 3300048911 | Unclassified | 1935 |
| 574 | Ga0496110_0593813 | 3300048913 | Bacteria | 1005 |
| 575 | Ga0496112_0236170 | 3300048915 | Bacteria | 1782 |
| 576 | Ga0501291_001731 | 3300049514 | Unclassified | 2547 |
| 577 | Ga0501291_034570 | 3300049514 | Unclassified | 866 |
| 578 | Ga0501298_002776 | 3300049521 | Unclassified | 2678 |
| 579 | Ga0501299_019221 | 3300049522 | Unclassified | 1234 |
| 580 | Ga0501300_027137 | 3300049523 | Unclassified | 841 |
| 581 | Ga0501198_004315 | 3300049649 | Unclassified | 1970 |
| 582 | Ga0501198_084040 | 3300049649 | Bacteria | 621 |
| 583 | Ga0501199_009127 | 3300049650 | Bacteria | 1046 |
| 584 | Ga0501201_005143 | 3300049651 | Unclassified | 1220 |
| 585 | Ga0501202_019797 | 3300049652 | Unclassified | 1333 |
| 586 | Ga0501202_127312 | 3300049652 | Unclassified | 646 |
| 587 | Ga0501207_007766 | 3300049654 | Bacteria | 1537 |
| 588 | Ga0501208_140957 | 3300049655 | Unclassified | 543 |
| 589 | Ga0501214_007509 | 3300049659 | Bacteria | 1119 |
| 590 | Ga0501216_007629 | 3300049660 | Bacteria | 1688 |
| 591 | Ga0501217_023767 | 3300049661 | Bacteria | 1462 |
| 592 | Ga0501223_005860 | 3300049663 | Bacteria | 2565 |
| 593 | Ga0501224_010073 | 3300049664 | Unclassified | 1385 |
| 594 | Ga0501227_022977 | 3300049665 | Bacteria | 1446 |
| 595 | Ga0501227_026886 | 3300049665 | Unclassified | 1359 |
| 596 | Ga0501227_034899 | 3300049665 | Unclassified | 1222 |
| 597 | Ga0501233_007158 | 3300049668 | Bacteria | 2118 |
| 598 | Ga0501233_018233 | 3300049668 | Bacteria | 1474 |
| 599 | Ga0501235_029867 | 3300049669 | Bacteria | 1228 |
| 600 | Ga0501235_078570 | 3300049669 | Unclassified | 787 |
| 601 | Ga0501243_004218 | 3300049675 | Bacteria | 2152 |
| 602 | Ga0501247_034983 | 3300049677 | Bacteria | 700 |
| 603 | Ga0501256_012121 | 3300049685 | Unclassified | 838 |
| 604 | Ga0501257_070119 | 3300049686 | Unclassified | 895 |
| 605 | Ga0501260_000603 | 3300049689 | Bacteria | 2780 |
| 606 | Ga0501260_005180 | 3300049689 | Bacteria | 1221 |
| 607 | Ga0501261_023683 | 3300049690 | Bacteria | 895 |
| 608 | Ga0501225_0006653 | 3300049705 | Unclassified | 3370 |
| 609 | Ga0501225_0013154 | 3300049705 | Bacteria | 2318 |
| 610 | Ga0501225_0014486 | 3300049705 | Bacteria | 2202 |
| 611 | Ga0501229_011982 | 3300049706 | Bacteria | 1103 |
| 612 | Ga0501234_003604 | 3300049707 | Bacteria | 2433 |
| 613 | Ga0501234_048558 | 3300049707 | Unclassified | 704 |
| 614 | Ga0501245_032846 | 3300049708 | Unclassified | 864 |
| 615 | Ga0501245_162982 | 3300049708 | Unclassified | 501 |
| 616 | Ga0501266_045456 | 3300049763 | Bacteria | 665 |
| 617 | Ga0501268_008749 | 3300049765 | Bacteria | 1542 |
| 618 | Ga0501270_018536 | 3300049767 | Bacteria | 1032 |
| 619 | Ga0501273_003402 | 3300049770 | Bacteria | 1688 |
| 620 | Ga0501280_122909 | 3300049776 | Bacteria | 516 |
| 621 | Ga0501283_001262 | 3300049779 | Unclassified | 3341 |
| 622 | Ga0501283_004329 | 3300049779 | Bacteria | 1914 |
| 623 | Ga0501212_002532 | 3300049851 | Bacteria | 2212 |
| 624 | Ga0501212_003304 | 3300049851 | Bacteria | 2015 |
| 625 | Ga0501226_005410 | 3300049853 | Bacteria | 1458 |
| 626 | Ga0501226_006765 | 3300049853 | Bacteria | 1293 |
| 627 | nmdc:mga05p37_131935_c1 | 3300050507 | Bacteria | 3065 |
| 628 | nmdc:mga05p37_15875_c1 | 3300050507 | Bacteria | 9058 |
| 629 | nmdc:mga05p37_187251_c1 | 3300050507 | Bacteria | 2516 |
| 630 | nmdc:mga05p37_219182_c1 | 3300050507 | Unclassified | 2297 |
| 631 | nmdc:mga05p37_286014_c1 | 3300050507 | Unclassified | 1964 |
| 632 | nmdc:mga05p37_320707_c1 | 3300050507 | Unclassified | 1834 |
| 633 | nmdc:mga05p37_45836_c1 | 3300050507 | Bacteria | 5377 |
| 634 | nmdc:mga05p37_527028_c1 | 3300050507 | Bacteria | 1350 |
| 635 | nmdc:mga05p37_70907_c1 | 3300050507 | Bacteria | 4286 |
| 636 | nmdc:mga0qj67_227233_c1 | 3300050509 | Bacteria | 1515 |
| 637 | nmdc:mga06r32_303513_c1 | 3300050510 | Bacteria | 1582 |
| 638 | nmdc:mga06r32_321541_c1 | 3300050510 | Bacteria | 1533 |
| 639 | nmdc:mga08y16_135452_c1 | 3300050511 | Unclassified | 2560 |
| 640 | nmdc:mga08y16_323049_c1 | 3300050511 | Unclassified | 1588 |
| 641 | nmdc:mga08y16_440686_c1 | 3300050511 | Unclassified | 1330 |
| 642 | nmdc:mga08y16_479522_c1 | 3300050511 | Unclassified | 1266 |
| 643 | nmdc:mga0n895_84297_c1 | 3300050512 | Bacteria | 3171 |
| 644 | nmdc:mga0n895_85872_c1 | 3300050512 | Bacteria | 3142 |
| 645 | nmdc:mga0rr50_1013525_c1 | 3300050513 | Unclassified | 707 |
| 646 | nmdc:mga0rr50_490209_c1 | 3300050513 | Unclassified | 1044 |
| 647 | nmdc:mga0rr50_910668_c1 | 3300050513 | Unclassified | 750 |
| 648 | nmdc:mga08x19_582478_c1 | 3300050514 | Bacteria | 792 |
| 649 | nmdc:mga0a205_13111_c1 | 3300050515 | Bacteria | 7699 |
| 650 | nmdc:mga0a205_14052_c1 | 3300050515 | Bacteria | 7468 |
| 651 | nmdc:mga0a205_43154_c1 | 3300050515 | Unclassified | 4348 |
| 652 | nmdc:mga0a205_550247_c1 | 3300050515 | Unclassified | 1009 |
| 653 | nmdc:mga0a205_582513_c1 | 3300050515 | Bacteria | 973 |
| 654 | nmdc:mga0a205_70579_c1 | 3300050515 | Unclassified | 3372 |
| 655 | nmdc:mga0a205_9683_c1 | 3300050515 | Bacteria | 8824 |
| 656 | Ga0501082_1340016 | 3300060353 | Unclassified | 625 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025922 | Ga0207646_10037160 | Ga0207646_100371602 | 109 |
| 2 | 3300028380 | Ga0268265_10121529 | Ga0268265_101215294 | 112 |
| 3 | 3300005577 | Ga0068857_100122099 | Ga0068857_1001220993 | 114 |
| 4 | 3300005333 | Ga0070677_10899614 | Ga0070677_108996141 | 115 |
| 5 | 3300005471 | Ga0070698_100017792 | Ga0070698_1000177926 | 115 |
| 6 | 3300005471 | Ga0070698_100007923 | Ga0070698_1000079235 | 116 |
| 7 | 3300005719 | Ga0068861_100139219 | Ga0068861_1001392192 | 116 |
| 8 | 3300026118 | Ga0207675_100135471 | Ga0207675_1001354712 | 116 |
| 9 | 3300013306 | Ga0163162_11186863 | Ga0163162_111868631 | 117 |
| 10 | 3300005546 | Ga0070696_100038719 | Ga0070696_1000387192 | 118 |
| 11 | 3300032002 | Ga0307416_101105258 | Ga0307416_1011052582 | 118 |
| 12 | 3300005518 | Ga0070699_100051065 | Ga0070699_1000510653 | 119 |
| 13 | 3300005440 | Ga0070705_100506344 | Ga0070705_1005063441 | 120 |
| 14 | 3300005467 | Ga0070706_100005960 | Ga0070706_10000596012 | 120 |
| 15 | 3300006358 | Ga0068871_100524317 | Ga0068871_1005243171 | 120 |
| 16 | 3300046533 | Ga0495640_0973082 | Ga0495640_0973082_78_443 | 120 |
| 17 | 3300005440 | Ga0070705_100045622 | Ga0070705_1000456222 | 121 |
| 18 | 3300005546 | Ga0070696_100677561 | Ga0070696_1006775611 | 121 |
| 19 | 3300005549 | Ga0070704_100182498 | Ga0070704_1001824982 | 121 |
| 20 | 3300031456 | Ga0307513_10379700 | Ga0307513_103797002 | 121 |
| 21 | 3300038996 | Ga0242420_019812 | Ga0242420_019812_752_1120 | 121 |
| 22 | 3300005289 | Ga0065704_10320087 | Ga0065704_103200871 | 123 |
| 23 | 3300005293 | Ga0065715_10008821 | Ga0065715_100088214 | 123 |
| 24 | 3300005356 | Ga0070674_100896555 | Ga0070674_1008965551 | 123 |
| 25 | 3300005441 | Ga0070700_100333174 | Ga0070700_1003331741 | 123 |
| 26 | 3300005468 | Ga0070707_101434671 | Ga0070707_1014346711 | 123 |
| 27 | 3300005544 | Ga0070686_100005585 | Ga0070686_1000055856 | 123 |
| 28 | 3300005548 | Ga0070665_102332044 | Ga0070665_1023320441 | 123 |
| 29 | 3300005564 | Ga0070664_100119898 | Ga0070664_1001198981 | 123 |
| 30 | 3300005577 | Ga0068857_100349003 | Ga0068857_1003490033 | 123 |
| 31 | 3300005618 | Ga0068864_100280836 | Ga0068864_1002808362 | 123 |
| 32 | 3300009147 | Ga0114129_10523028 | Ga0114129_105230281 | 123 |
| 33 | 3300009148 | Ga0105243_10089093 | Ga0105243_100890934 | 123 |
| 34 | 3300009174 | Ga0105241_10399327 | Ga0105241_103993273 | 123 |
| 35 | 3300013297 | Ga0157378_11688129 | Ga0157378_116881291 | 123 |
| 36 | 3300014326 | Ga0157380_10000458 | Ga0157380_1000045813 | 123 |
| 37 | 3300025922 | Ga0207646_10589550 | Ga0207646_105895503 | 123 |
| 38 | 3300025936 | Ga0207670_10012111 | Ga0207670_100121115 | 123 |
| 39 | 3300025942 | Ga0207689_10032217 | Ga0207689_100322174 | 123 |
| 40 | 3300025945 | Ga0207679_10465659 | Ga0207679_104656591 | 123 |
| 41 | 3300025960 | Ga0207651_11802035 | Ga0207651_118020351 | 123 |
| 42 | 3300026088 | Ga0207641_11350037 | Ga0207641_113500372 | 123 |
| 43 | 3300026116 | Ga0207674_10554132 | Ga0207674_105541321 | 123 |
| 44 | 3300042126 | Ga0450888_019589 | Ga0450888_019589_442_816 | 123 |
| 45 | 3300046525 | Ga0495663_0000636 | Ga0495663_0000636_3303_3677 | 123 |
| 46 | 3300046539 | Ga0495621_0001370 | Ga0495621_0001370_1563_1937 | 123 |
| 47 | 3300047318 | Ga0495636_0182103 | Ga0495636_0182103_226_600 | 123 |
| 48 | 3300049652 | Ga0501202_127312 | Ga0501202_127312_56_430 | 123 |
| 49 | 3300009553 | Ga0105249_10063590 | Ga0105249_100635904 | 124 |
| 50 | 3300013297 | Ga0157378_12214839 | Ga0157378_122148391 | 124 |
| 51 | 3300013308 | Ga0157375_10139066 | Ga0157375_101390663 | 124 |
| 52 | 3300005545 | Ga0070695_100033440 | Ga0070695_1000334402 | 126 |
| 53 | 3300005330 | Ga0070690_100008709 | Ga0070690_1000087094 | 127 |
| 54 | 3300005338 | Ga0068868_100012352 | Ga0068868_1000123524 | 127 |
| 55 | 3300005343 | Ga0070687_100289367 | Ga0070687_1002893673 | 127 |
| 56 | 3300005444 | Ga0070694_100026410 | Ga0070694_1000264104 | 127 |
| 57 | 3300005459 | Ga0068867_100077179 | Ga0068867_1000771792 | 127 |
| 58 | 3300005536 | Ga0070697_100001249 | Ga0070697_10000124918 | 127 |
| 59 | 3300005564 | Ga0070664_102175883 | Ga0070664_1021758831 | 127 |
| 60 | 3300009092 | Ga0105250_10237989 | Ga0105250_102379892 | 127 |
| 61 | 3300009098 | Ga0105245_10031484 | Ga0105245_100314844 | 127 |
| 62 | 3300009148 | Ga0105243_10137616 | Ga0105243_101376164 | 127 |
| 63 | 3300009176 | Ga0105242_10030053 | Ga0105242_100300532 | 127 |
| 64 | 3300009177 | Ga0105248_10017834 | Ga0105248_100178342 | 127 |
| 65 | 3300009553 | Ga0105249_10180662 | Ga0105249_101806621 | 127 |
| 66 | 3300010375 | Ga0105239_10169708 | Ga0105239_101697082 | 127 |
| 67 | 3300013296 | Ga0157374_10214858 | Ga0157374_102148584 | 127 |
| 68 | 3300013297 | Ga0157378_10015696 | Ga0157378_100156965 | 127 |
| 69 | 3300013306 | Ga0163162_10647944 | Ga0163162_106479442 | 127 |
| 70 | 3300013308 | Ga0157375_10694618 | Ga0157375_106946182 | 127 |
| 71 | 3300014325 | Ga0163163_10115482 | Ga0163163_101154824 | 127 |
| 72 | 3300014326 | Ga0157380_10979145 | Ga0157380_109791452 | 127 |
| 73 | 3300014745 | Ga0157377_10197640 | Ga0157377_101976403 | 127 |
| 74 | 3300014968 | Ga0157379_10433325 | Ga0157379_104333253 | 127 |
| 75 | 3300014969 | Ga0157376_10023487 | Ga0157376_100234875 | 127 |
| 76 | 3300025901 | Ga0207688_10063821 | Ga0207688_100638212 | 127 |
| 77 | 3300025931 | Ga0207644_10559365 | Ga0207644_105593653 | 127 |
| 78 | 3300025934 | Ga0207686_11102442 | Ga0207686_111024422 | 127 |
| 79 | 3300025942 | Ga0207689_10001656 | Ga0207689_1000165622 | 127 |
| 80 | 3300026035 | Ga0207703_10112040 | Ga0207703_101120403 | 127 |
| 81 | 3300026118 | Ga0207675_100002078 | Ga0207675_10000207820 | 127 |
| 82 | 3300013308 | Ga0157375_11374088 | Ga0157375_113740881 | 129 |
| 83 | 3300014325 | Ga0163163_10339077 | Ga0163163_103390772 | 129 |
| 84 | 3300005330 | Ga0070690_100224665 | Ga0070690_1002246652 | 131 |
| 85 | 3300005334 | Ga0068869_100019378 | Ga0068869_1000193784 | 131 |
| 86 | 3300005337 | Ga0070682_100960538 | Ga0070682_1009605381 | 131 |
| 87 | 3300026095 | Ga0207676_10686951 | Ga0207676_106869512 | 131 |
| 88 | 3300006173 | Ga0070716_100795099 | Ga0070716_1007950991 | 132 |
| 89 | 3300025906 | Ga0207699_10644239 | Ga0207699_106442393 | 132 |
| 90 | 3300031911 | Ga0307412_10136563 | Ga0307412_101365632 | 132 |
| 91 | 3300005335 | Ga0070666_10066704 | Ga0070666_100667043 | 133 |
| 92 | 3300005340 | Ga0070689_100000548 | Ga0070689_10000054815 | 133 |
| 93 | 3300005354 | Ga0070675_100058200 | Ga0070675_1000582003 | 133 |
| 94 | 3300005356 | Ga0070674_100431220 | Ga0070674_1004312201 | 133 |
| 95 | 3300005365 | Ga0070688_100924312 | Ga0070688_1009243121 | 133 |
| 96 | 3300005434 | Ga0070709_10226472 | Ga0070709_102264723 | 133 |
| 97 | 3300005438 | Ga0070701_10026534 | Ga0070701_100265344 | 133 |
| 98 | 3300005438 | Ga0070701_10426939 | Ga0070701_104269391 | 133 |
| 99 | 3300005441 | Ga0070700_100725404 | Ga0070700_1007254043 | 133 |
| 100 | 3300005459 | Ga0068867_100146826 | Ga0068867_1001468262 | 133 |
| 101 | 3300005518 | Ga0070699_100246450 | Ga0070699_1002464502 | 133 |
| 102 | 3300005544 | Ga0070686_100015302 | Ga0070686_1000153022 | 133 |
| 103 | 3300005549 | Ga0070704_100459256 | Ga0070704_1004592562 | 133 |
| 104 | 3300005578 | Ga0068854_100164158 | Ga0068854_1001641582 | 133 |
| 105 | 3300005615 | Ga0070702_100033570 | Ga0070702_1000335703 | 133 |
| 106 | 3300005617 | Ga0068859_100303936 | Ga0068859_1003039362 | 133 |
| 107 | 3300005617 | Ga0068859_100766061 | Ga0068859_1007660613 | 133 |
| 108 | 3300005618 | Ga0068864_100061563 | Ga0068864_1000615633 | 133 |
| 109 | 3300005840 | Ga0068870_10020860 | Ga0068870_100208603 | 133 |
| 110 | 3300005841 | Ga0068863_100038388 | Ga0068863_1000383884 | 133 |
| 111 | 3300005841 | Ga0068863_100478103 | Ga0068863_1004781032 | 133 |
| 112 | 3300005842 | Ga0068858_100169903 | Ga0068858_1001699034 | 133 |
| 113 | 3300005843 | Ga0068860_100093365 | Ga0068860_1000933652 | 133 |
| 114 | 3300005843 | Ga0068860_100510401 | Ga0068860_1005104012 | 133 |
| 115 | 3300005844 | Ga0068862_100124211 | Ga0068862_1001242111 | 133 |
| 116 | 3300006914 | Ga0075436_100000008 | Ga0075436_10000000868 | 133 |
| 117 | 3300006931 | Ga0097620_100303954 | Ga0097620_1003039542 | 133 |
| 118 | 3300006931 | Ga0097620_100766002 | Ga0097620_1007660023 | 133 |
| 119 | 3300007076 | Ga0075435_100000657 | Ga0075435_10000065715 | 133 |
| 120 | 3300009177 | Ga0105248_10017565 | Ga0105248_100175654 | 133 |
| 121 | 3300009177 | Ga0105248_10376981 | Ga0105248_103769812 | 133 |
| 122 | 3300009553 | Ga0105249_10441316 | Ga0105249_104413161 | 133 |
| 123 | 3300013297 | Ga0157378_10169726 | Ga0157378_101697263 | 133 |
| 124 | 3300013297 | Ga0157378_10307048 | Ga0157378_103070482 | 133 |
| 125 | 3300013297 | Ga0157378_11043065 | Ga0157378_110430652 | 133 |
| 126 | 3300013297 | Ga0157378_11187219 | Ga0157378_111872192 | 133 |
| 127 | 3300013306 | Ga0163162_10140917 | Ga0163162_101409172 | 133 |
| 128 | 3300014325 | Ga0163163_10106971 | Ga0163163_101069714 | 133 |
| 129 | 3300014325 | Ga0163163_10729900 | Ga0163163_107299003 | 133 |
| 130 | 3300014326 | Ga0157380_10106964 | Ga0157380_101069641 | 133 |
| 131 | 3300014326 | Ga0157380_11082871 | Ga0157380_110828712 | 133 |
| 132 | 3300014326 | Ga0157380_11083649 | Ga0157380_110836492 | 133 |
| 133 | 3300014745 | Ga0157377_11259257 | Ga0157377_112592572 | 133 |
| 134 | 3300025899 | Ga0207642_10052144 | Ga0207642_100521443 | 133 |
| 135 | 3300025908 | Ga0207643_10000647 | Ga0207643_100006472 | 133 |
| 136 | 3300025908 | Ga0207643_10225307 | Ga0207643_102253073 | 133 |
| 137 | 3300025923 | Ga0207681_10066931 | Ga0207681_100669312 | 133 |
| 138 | 3300025925 | Ga0207650_10213375 | Ga0207650_102133752 | 133 |
| 139 | 3300025926 | Ga0207659_10133275 | Ga0207659_101332752 | 133 |
| 140 | 3300025936 | Ga0207670_10000763 | Ga0207670_1000076311 | 133 |
| 141 | 3300025939 | Ga0207665_10305231 | Ga0207665_103052312 | 133 |
| 142 | 3300025941 | Ga0207711_10106759 | Ga0207711_101067593 | 133 |
| 143 | 3300025941 | Ga0207711_10457213 | Ga0207711_104572133 | 133 |
| 144 | 3300025981 | Ga0207640_10628401 | Ga0207640_106284011 | 133 |
| 145 | 3300026035 | Ga0207703_10063880 | Ga0207703_100638804 | 133 |
| 146 | 3300026088 | Ga0207641_10029830 | Ga0207641_100298304 | 133 |
| 147 | 3300026089 | Ga0207648_10100305 | Ga0207648_101003053 | 133 |
| 148 | 3300026095 | Ga0207676_10036154 | Ga0207676_100361544 | 133 |
| 149 | 3300026116 | Ga0207674_11345543 | Ga0207674_113455431 | 133 |
| 150 | 3300028380 | Ga0268265_12482769 | Ga0268265_124827691 | 133 |
| 151 | 3300028381 | Ga0268264_10310489 | Ga0268264_103104893 | 133 |
| 152 | 3300005330 | Ga0070690_100248578 | Ga0070690_1002485782 | 134 |
| 153 | 3300005334 | Ga0068869_100016120 | Ga0068869_1000161202 | 134 |
| 154 | 3300005471 | Ga0070698_100001570 | Ga0070698_1000015707 | 134 |
| 155 | 3300005518 | Ga0070699_100020613 | Ga0070699_1000206135 | 134 |
| 156 | 3300005545 | Ga0070695_100148354 | Ga0070695_1001483542 | 134 |
| 157 | 3300005615 | Ga0070702_100447637 | Ga0070702_1004476371 | 134 |
| 158 | 3300005719 | Ga0068861_100016533 | Ga0068861_1000165334 | 134 |
| 159 | 3300006173 | Ga0070716_100000012 | Ga0070716_10000001213 | 134 |
| 160 | 3300006852 | Ga0075433_10222188 | Ga0075433_102221882 | 134 |
| 161 | 3300006852 | Ga0075433_10555238 | Ga0075433_105552381 | 134 |
| 162 | 3300006871 | Ga0075434_101531921 | Ga0075434_1015319211 | 134 |
| 163 | 3300006881 | Ga0068865_100169397 | Ga0068865_1001693972 | 134 |
| 164 | 3300009101 | Ga0105247_10000022 | Ga0105247_10000022108 | 134 |
| 165 | 3300009147 | Ga0114129_10012953 | Ga0114129_1001295310 | 134 |
| 166 | 3300009148 | Ga0105243_10281928 | Ga0105243_102819283 | 134 |
| 167 | 3300009174 | Ga0105241_10151114 | Ga0105241_101511144 | 134 |
| 168 | 3300009553 | Ga0105249_10003383 | Ga0105249_100033839 | 134 |
| 169 | 3300013297 | Ga0157378_10132132 | Ga0157378_101321322 | 134 |
| 170 | 3300013297 | Ga0157378_10310127 | Ga0157378_103101271 | 134 |
| 171 | 3300025922 | Ga0207646_10117585 | Ga0207646_101175852 | 134 |
| 172 | 3300025935 | Ga0207709_10264476 | Ga0207709_102644763 | 134 |
| 173 | 3300025938 | Ga0207704_10046662 | Ga0207704_100466623 | 134 |
| 174 | 3300025939 | Ga0207665_10000083 | Ga0207665_1000008346 | 134 |
| 175 | 3300025942 | Ga0207689_10033563 | Ga0207689_100335634 | 134 |
| 176 | 3300049655 | Ga0501208_140957 | Ga0501208_140957_23_427 | 134 |
| 177 | 3300050507 | nmdc:mga05p37_15875_c1 | nmdc:mga05p37_15875_c1_4751_5176 | 134 |
| 178 | 3300050513 | nmdc:mga0rr50_1013525_c1 | nmdc:mga0rr50_1013525_c1_81_506 | 134 |
| 179 | 3300050514 | nmdc:mga08x19_582478_c1 | nmdc:mga08x19_582478_c1_308_733 | 134 |
| 180 | 3300050515 | nmdc:mga0a205_550247_c1 | nmdc:mga0a205_550247_c1_150_575 | 134 |
| 181 | 3300050515 | nmdc:mga0a205_9683_c1 | nmdc:mga0a205_9683_c1_7407_7832 | 134 |
| 182 | 3300005347 | Ga0070668_100008962 | Ga0070668_1000089626 | 135 |
| 183 | 3300006852 | Ga0075433_10080606 | Ga0075433_100806064 | 135 |
| 184 | 3300009147 | Ga0114129_10295788 | Ga0114129_102957883 | 135 |
| 185 | 3300013306 | Ga0163162_10000211 | Ga0163162_100002115 | 135 |
| 186 | 3300014326 | Ga0157380_13266517 | Ga0157380_132665171 | 135 |
| 187 | 3300025961 | Ga0207712_10000180 | Ga0207712_100001806 | 135 |
| 188 | 3300025972 | Ga0207668_10005528 | Ga0207668_100055283 | 135 |
| 189 | 3300050507 | nmdc:mga05p37_320707_c1 | nmdc:mga05p37_320707_c1_694_1125 | 135 |
| 190 | 3300005331 | Ga0070670_100000793 | Ga0070670_10000079325 | 136 |
| 191 | 3300005331 | Ga0070670_100548069 | Ga0070670_1005480693 | 136 |
| 192 | 3300005337 | Ga0070682_100000570 | Ga0070682_10000057014 | 136 |
| 193 | 3300005340 | Ga0070689_100169150 | Ga0070689_1001691502 | 136 |
| 194 | 3300005343 | Ga0070687_101018361 | Ga0070687_1010183612 | 136 |
| 195 | 3300005353 | Ga0070669_100063902 | Ga0070669_1000639023 | 136 |
| 196 | 3300005354 | Ga0070675_100189659 | Ga0070675_1001896591 | 136 |
| 197 | 3300005355 | Ga0070671_101740523 | Ga0070671_1017405231 | 136 |
| 198 | 3300005364 | Ga0070673_101427151 | Ga0070673_1014271511 | 136 |
| 199 | 3300005365 | Ga0070688_100300094 | Ga0070688_1003000941 | 136 |
| 200 | 3300005548 | Ga0070665_100237253 | Ga0070665_1002372533 | 136 |
| 201 | 3300005577 | Ga0068857_102321465 | Ga0068857_1023214651 | 136 |
| 202 | 3300009093 | Ga0105240_11672592 | Ga0105240_116725921 | 136 |
| 203 | 3300009147 | Ga0114129_10010729 | Ga0114129_1001072910 | 136 |
| 204 | 3300009147 | Ga0114129_10287436 | Ga0114129_102874362 | 136 |
| 205 | 3300009147 | Ga0114129_10632452 | Ga0114129_106324521 | 136 |
| 206 | 3300009176 | Ga0105242_11175649 | Ga0105242_111756491 | 136 |
| 207 | 3300013306 | Ga0163162_11928368 | Ga0163162_119283682 | 136 |
| 208 | 3300013308 | Ga0157375_10402460 | Ga0157375_104024603 | 136 |
| 209 | 3300025913 | Ga0207695_10497787 | Ga0207695_104977873 | 136 |
| 210 | 3300025923 | Ga0207681_10012688 | Ga0207681_100126881 | 136 |
| 211 | 3300025923 | Ga0207681_10447159 | Ga0207681_104471593 | 136 |
| 212 | 3300025926 | Ga0207659_10180294 | Ga0207659_101802941 | 136 |
| 213 | 3300025934 | Ga0207686_10676344 | Ga0207686_106763441 | 136 |
| 214 | 3300035172 | Ga0373955_0262993 | Ga0373955_0262993_547_957 | 136 |
| 215 | 3300036401 | Ga0373937_0363148 | Ga0373937_0363148_520_930 | 136 |
| 216 | 3300046537 | Ga0495598_0000339 | Ga0495598_0000339_1496_1927 | 136 |
| 217 | 3300050507 | nmdc:mga05p37_45836_c1 | nmdc:mga05p37_45836_c1_3085_3495 | 136 |
| 218 | 3300050507 | nmdc:mga05p37_527028_c1 | nmdc:mga05p37_527028_c1_816_1226 | 136 |
| 219 | 3300000532 | CNAas_1000066 | CNAas_10000667 | 137 |
| 220 | 3300005295 | Ga0065707_10085415 | Ga0065707_100854154 | 137 |
| 221 | 3300005295 | Ga0065707_10416361 | Ga0065707_104163612 | 137 |
| 222 | 3300005334 | Ga0068869_101279315 | Ga0068869_1012793151 | 137 |
| 223 | 3300005336 | Ga0070680_100000578 | Ga0070680_1000005785 | 137 |
| 224 | 3300005340 | Ga0070689_100232297 | Ga0070689_1002322971 | 137 |
| 225 | 3300005340 | Ga0070689_100526376 | Ga0070689_1005263761 | 137 |
| 226 | 3300005353 | Ga0070669_101586992 | Ga0070669_1015869921 | 137 |
| 227 | 3300005356 | Ga0070674_100341855 | Ga0070674_1003418551 | 137 |
| 228 | 3300005367 | Ga0070667_100136627 | Ga0070667_1001366273 | 137 |
| 229 | 3300005440 | Ga0070705_100315713 | Ga0070705_1003157132 | 137 |
| 230 | 3300005440 | Ga0070705_100704986 | Ga0070705_1007049861 | 137 |
| 231 | 3300005441 | Ga0070700_100080890 | Ga0070700_1000808903 | 137 |
| 232 | 3300005444 | Ga0070694_100334412 | Ga0070694_1003344121 | 137 |
| 233 | 3300005456 | Ga0070678_100701219 | Ga0070678_1007012192 | 137 |
| 234 | 3300005458 | Ga0070681_10000041 | Ga0070681_100000414 | 137 |
| 235 | 3300005467 | Ga0070706_100506473 | Ga0070706_1005064731 | 137 |
| 236 | 3300005468 | Ga0070707_100286367 | Ga0070707_1002863671 | 137 |
| 237 | 3300005471 | Ga0070698_100011352 | Ga0070698_10001135210 | 137 |
| 238 | 3300005518 | Ga0070699_100952777 | Ga0070699_1009527772 | 137 |
| 239 | 3300005530 | Ga0070679_100000955 | Ga0070679_10000095512 | 137 |
| 240 | 3300005536 | Ga0070697_100077341 | Ga0070697_1000773414 | 137 |
| 241 | 3300005536 | Ga0070697_100301139 | Ga0070697_1003011393 | 137 |
| 242 | 3300005544 | Ga0070686_100133826 | Ga0070686_1001338263 | 137 |
| 243 | 3300005545 | Ga0070695_100526977 | Ga0070695_1005269771 | 137 |
| 244 | 3300005546 | Ga0070696_100071082 | Ga0070696_1000710823 | 137 |
| 245 | 3300005546 | Ga0070696_100080442 | Ga0070696_1000804422 | 137 |
| 246 | 3300005546 | Ga0070696_100497681 | Ga0070696_1004976812 | 137 |
| 247 | 3300005546 | Ga0070696_100616561 | Ga0070696_1006165612 | 137 |
| 248 | 3300005546 | Ga0070696_101521236 | Ga0070696_1015212361 | 137 |
| 249 | 3300005547 | Ga0070693_100020783 | Ga0070693_1000207832 | 137 |
| 250 | 3300005547 | Ga0070693_100057943 | Ga0070693_1000579432 | 137 |
| 251 | 3300005547 | Ga0070693_100252258 | Ga0070693_1002522581 | 137 |
| 252 | 3300005547 | Ga0070693_100537418 | Ga0070693_1005374181 | 137 |
| 253 | 3300005547 | Ga0070693_101469292 | Ga0070693_1014692921 | 137 |
| 254 | 3300005549 | Ga0070704_100226739 | Ga0070704_1002267393 | 137 |
| 255 | 3300005563 | Ga0068855_100452441 | Ga0068855_1004524411 | 137 |
| 256 | 3300005563 | Ga0068855_100893551 | Ga0068855_1008935511 | 137 |
| 257 | 3300005615 | Ga0070702_100006101 | Ga0070702_1000061013 | 137 |
| 258 | 3300005617 | Ga0068859_100025877 | Ga0068859_1000258773 | 137 |
| 259 | 3300005617 | Ga0068859_100365645 | Ga0068859_1003656452 | 137 |
| 260 | 3300005618 | Ga0068864_100006535 | Ga0068864_1000065352 | 137 |
| 261 | 3300005719 | Ga0068861_100227236 | Ga0068861_1002272363 | 137 |
| 262 | 3300005834 | Ga0068851_10237553 | Ga0068851_102375532 | 137 |
| 263 | 3300005842 | Ga0068858_100135158 | Ga0068858_1001351583 | 137 |
| 264 | 3300005843 | Ga0068860_100044023 | Ga0068860_1000440234 | 137 |
| 265 | 3300006237 | Ga0097621_100122322 | Ga0097621_1001223222 | 137 |
| 266 | 3300006358 | Ga0068871_100004614 | Ga0068871_1000046147 | 137 |
| 267 | 3300006852 | Ga0075433_10380265 | Ga0075433_103802652 | 137 |
| 268 | 3300006852 | Ga0075433_11203234 | Ga0075433_112032342 | 137 |
| 269 | 3300006871 | Ga0075434_100267820 | Ga0075434_1002678202 | 137 |
| 270 | 3300006871 | Ga0075434_100445819 | Ga0075434_1004458191 | 137 |
| 271 | 3300006871 | Ga0075434_100555824 | Ga0075434_1005558242 | 137 |
| 272 | 3300006881 | Ga0068865_100834728 | Ga0068865_1008347281 | 137 |
| 273 | 3300006881 | Ga0068865_101082388 | Ga0068865_1010823881 | 137 |
| 274 | 3300006931 | Ga0097620_100025876 | Ga0097620_1000258763 | 137 |
| 275 | 3300006931 | Ga0097620_100365624 | Ga0097620_1003656242 | 137 |
| 276 | 3300007076 | Ga0075435_100333078 | Ga0075435_1003330782 | 137 |
| 277 | 3300007076 | Ga0075435_100518848 | Ga0075435_1005188482 | 137 |
| 278 | 3300007076 | Ga0075435_100623357 | Ga0075435_1006233572 | 137 |
| 279 | 3300009094 | Ga0111539_10407401 | Ga0111539_104074012 | 137 |
| 280 | 3300009098 | Ga0105245_10243687 | Ga0105245_102436871 | 137 |
| 281 | 3300009147 | Ga0114129_10024247 | Ga0114129_100242471 | 137 |
| 282 | 3300009147 | Ga0114129_10032222 | Ga0114129_100322226 | 137 |
| 283 | 3300009147 | Ga0114129_10071099 | Ga0114129_100710994 | 137 |
| 284 | 3300013100 | Ga0157373_10940040 | Ga0157373_109400402 | 137 |
| 285 | 3300014745 | Ga0157377_11360540 | Ga0157377_113605401 | 137 |
| 286 | 3300017792 | Ga0163161_10184212 | Ga0163161_101842123 | 137 |
| 287 | 3300025321 | Ga0207656_10256353 | Ga0207656_102563533 | 137 |
| 288 | 3300025903 | Ga0207680_10284890 | Ga0207680_102848901 | 137 |
| 289 | 3300025908 | Ga0207643_10410547 | Ga0207643_104105472 | 137 |
| 290 | 3300025911 | Ga0207654_11097219 | Ga0207654_110972192 | 137 |
| 291 | 3300025912 | Ga0207707_10000077 | Ga0207707_1000007712 | 137 |
| 292 | 3300025914 | Ga0207671_10065685 | Ga0207671_100656852 | 137 |
| 293 | 3300025917 | Ga0207660_10003294 | Ga0207660_100032945 | 137 |
| 294 | 3300025920 | Ga0207649_10434713 | Ga0207649_104347133 | 137 |
| 295 | 3300025921 | Ga0207652_10000096 | Ga0207652_1000009610 | 137 |
| 296 | 3300025922 | Ga0207646_10297368 | Ga0207646_102973682 | 137 |
| 297 | 3300025922 | Ga0207646_10515361 | Ga0207646_105153611 | 137 |
| 298 | 3300025923 | Ga0207681_11014575 | Ga0207681_110145752 | 137 |
| 299 | 3300025925 | Ga0207650_10000046 | Ga0207650_1000004627 | 137 |
| 300 | 3300025931 | Ga0207644_10085138 | Ga0207644_100851382 | 137 |
| 301 | 3300025931 | Ga0207644_10350548 | Ga0207644_103505482 | 137 |
| 302 | 3300025937 | Ga0207669_10454225 | Ga0207669_104542252 | 137 |
| 303 | 3300025940 | Ga0207691_11005150 | Ga0207691_110051501 | 137 |
| 304 | 3300025941 | Ga0207711_10011687 | Ga0207711_100116874 | 137 |
| 305 | 3300025942 | Ga0207689_11061889 | Ga0207689_110618891 | 137 |
| 306 | 3300025945 | Ga0207679_10116393 | Ga0207679_101163932 | 137 |
| 307 | 3300025981 | Ga0207640_10190588 | Ga0207640_101905881 | 137 |
| 308 | 3300025986 | Ga0207658_10340553 | Ga0207658_103405531 | 137 |
| 309 | 3300026035 | Ga0207703_10159045 | Ga0207703_101590452 | 137 |
| 310 | 3300026035 | Ga0207703_10275022 | Ga0207703_102750222 | 137 |
| 311 | 3300026075 | Ga0207708_10049837 | Ga0207708_100498373 | 137 |
| 312 | 3300026078 | Ga0207702_11352997 | Ga0207702_113529972 | 137 |
| 313 | 3300026089 | Ga0207648_10194024 | Ga0207648_101940242 | 137 |
| 314 | 3300026089 | Ga0207648_10402158 | Ga0207648_104021581 | 137 |
| 315 | 3300026116 | Ga0207674_10333436 | Ga0207674_103334362 | 137 |
| 316 | 3300026118 | Ga0207675_100890079 | Ga0207675_1008900792 | 137 |
| 317 | 3300026121 | Ga0207683_10816234 | Ga0207683_108162342 | 137 |
| 318 | 3300028379 | Ga0268266_10272964 | Ga0268266_102729643 | 137 |
| 319 | 3300028381 | Ga0268264_10296213 | Ga0268264_102962133 | 137 |
| 320 | 3300028381 | Ga0268264_11250357 | Ga0268264_112503572 | 137 |
| 321 | 3300042012 | Ga0439455_0099901 | Ga0439455_0099901_213_659 | 137 |
| 322 | 3300042439 | Ga0439464_0061793 | Ga0439464_0061793_277_723 | 137 |
| 323 | 3300049686 | Ga0501257_070119 | Ga0501257_070119_175_606 | 137 |
| 324 | 3300049705 | Ga0501225_0014486 | Ga0501225_0014486_1271_1702 | 137 |
| 325 | 3300049763 | Ga0501266_045456 | Ga0501266_045456_217_648 | 137 |
| 326 | 3300050507 | nmdc:mga05p37_131935_c1 | nmdc:mga05p37_131935_c1_1234_1647 | 137 |
| 327 | 3300050507 | nmdc:mga05p37_187251_c1 | nmdc:mga05p37_187251_c1_1855_2289 | 137 |
| 328 | 3300050507 | nmdc:mga05p37_70907_c1 | nmdc:mga05p37_70907_c1_1956_2387 | 137 |
| 329 | 3300050511 | nmdc:mga08y16_323049_c1 | nmdc:mga08y16_323049_c1_908_1339 | 137 |
| 330 | 3300050513 | nmdc:mga0rr50_490209_c1 | nmdc:mga0rr50_490209_c1_277_711 | 137 |
| 331 | 3300050513 | nmdc:mga0rr50_910668_c1 | nmdc:mga0rr50_910668_c1_181_675 | 137 |
| 332 | 3300050515 | nmdc:mga0a205_14052_c1 | nmdc:mga0a205_14052_c1_6015_6446 | 137 |
| 333 | 3300050515 | nmdc:mga0a205_43154_c1 | nmdc:mga0a205_43154_c1_1926_2339 | 137 |
| 334 | 3300050515 | nmdc:mga0a205_582513_c1 | nmdc:mga0a205_582513_c1_439_870 | 137 |
| 335 | 2162886007 | SwRhRL2b_contig_2530518 | SwRhRL2b_0111.00006640 | 138 |
| 336 | 2162886011 | MRS1b_contig_2703841 | MRS1b_0947.00001110 | 138 |
| 337 | 3300003203 | JGI25406J46586_10192407 | JGI25406J46586_101924071 | 138 |
| 338 | 3300003320 | rootH2_10324948 | rootH2_103249483 | 138 |
| 339 | 3300005290 | Ga0065712_10067736 | Ga0065712_1006773653 | 138 |
| 340 | 3300005293 | Ga0065715_10088966 | Ga0065715_1008896610 | 138 |
| 341 | 3300005295 | Ga0065707_10028325 | Ga0065707_100283252 | 138 |
| 342 | 3300005328 | Ga0070676_10081137 | Ga0070676_100811373 | 138 |
| 343 | 3300005330 | Ga0070690_100000641 | Ga0070690_1000006414 | 138 |
| 344 | 3300005331 | Ga0070670_100079128 | Ga0070670_1000791281 | 138 |
| 345 | 3300005331 | Ga0070670_100162578 | Ga0070670_1001625783 | 138 |
| 346 | 3300005334 | Ga0068869_100370603 | Ga0068869_1003706033 | 138 |
| 347 | 3300005334 | Ga0068869_100603803 | Ga0068869_1006038033 | 138 |
| 348 | 3300005334 | Ga0068869_100637793 | Ga0068869_1006377931 | 138 |
| 349 | 3300005336 | Ga0070680_100001718 | Ga0070680_1000017181 | 138 |
| 350 | 3300005336 | Ga0070680_100634463 | Ga0070680_1006344633 | 138 |
| 351 | 3300005336 | Ga0070680_101022813 | Ga0070680_1010228131 | 138 |
| 352 | 3300005337 | Ga0070682_100036312 | Ga0070682_1000363123 | 138 |
| 353 | 3300005339 | Ga0070660_100017641 | Ga0070660_1000176415 | 138 |
| 354 | 3300005340 | Ga0070689_100878207 | Ga0070689_1008782072 | 138 |
| 355 | 3300005343 | Ga0070687_100084542 | Ga0070687_1000845422 | 138 |
| 356 | 3300005344 | Ga0070661_100028303 | Ga0070661_1000283034 | 138 |
| 357 | 3300005353 | Ga0070669_101512706 | Ga0070669_1015127061 | 138 |
| 358 | 3300005364 | Ga0070673_100104662 | Ga0070673_1001046622 | 138 |
| 359 | 3300005366 | Ga0070659_102061226 | Ga0070659_1020612261 | 138 |
| 360 | 3300005406 | Ga0070703_10055771 | Ga0070703_100557713 | 138 |
| 361 | 3300005440 | Ga0070705_100004570 | Ga0070705_1000045705 | 138 |
| 362 | 3300005440 | Ga0070705_100032957 | Ga0070705_1000329573 | 138 |
| 363 | 3300005441 | Ga0070700_100037694 | Ga0070700_1000376942 | 138 |
| 364 | 3300005441 | Ga0070700_100077902 | Ga0070700_1000779022 | 138 |
| 365 | 3300005444 | Ga0070694_100006659 | Ga0070694_1000066592 | 138 |
| 366 | 3300005444 | Ga0070694_100039808 | Ga0070694_1000398083 | 138 |
| 367 | 3300005444 | Ga0070694_100069167 | Ga0070694_1000691672 | 138 |
| 368 | 3300005444 | Ga0070694_100131146 | Ga0070694_1001311462 | 138 |
| 369 | 3300005444 | Ga0070694_100165906 | Ga0070694_1001659062 | 138 |
| 370 | 3300005444 | Ga0070694_100237112 | Ga0070694_1002371121 | 138 |
| 371 | 3300005457 | Ga0070662_100500609 | Ga0070662_1005006091 | 138 |
| 372 | 3300005457 | Ga0070662_100842867 | Ga0070662_1008428672 | 138 |
| 373 | 3300005458 | Ga0070681_10138085 | Ga0070681_101380854 | 138 |
| 374 | 3300005459 | Ga0068867_100449758 | Ga0068867_1004497583 | 138 |
| 375 | 3300005459 | Ga0068867_100993495 | Ga0068867_1009934951 | 138 |
| 376 | 3300005467 | Ga0070706_100018070 | Ga0070706_1000180705 | 138 |
| 377 | 3300005468 | Ga0070707_100008507 | Ga0070707_1000085073 | 138 |
| 378 | 3300005471 | Ga0070698_100018168 | Ga0070698_1000181685 | 138 |
| 379 | 3300005471 | Ga0070698_100075584 | Ga0070698_1000755842 | 138 |
| 380 | 3300005518 | Ga0070699_100000169 | Ga0070699_10000016913 | 138 |
| 381 | 3300005518 | Ga0070699_100000980 | Ga0070699_10000098015 | 138 |
| 382 | 3300005530 | Ga0070679_100613928 | Ga0070679_1006139283 | 138 |
| 383 | 3300005536 | Ga0070697_100015909 | Ga0070697_1000159093 | 138 |
| 384 | 3300005536 | Ga0070697_100051765 | Ga0070697_1000517654 | 138 |
| 385 | 3300005536 | Ga0070697_100290497 | Ga0070697_1002904972 | 138 |
| 386 | 3300005539 | Ga0068853_100023276 | Ga0068853_1000232761 | 138 |
| 387 | 3300005539 | Ga0068853_100237913 | Ga0068853_1002379134 | 138 |
| 388 | 3300005543 | Ga0070672_100078538 | Ga0070672_1000785382 | 138 |
| 389 | 3300005544 | Ga0070686_100001371 | Ga0070686_10000137112 | 138 |
| 390 | 3300005545 | Ga0070695_100033194 | Ga0070695_1000331944 | 138 |
| 391 | 3300005545 | Ga0070695_100207067 | Ga0070695_1002070672 | 138 |
| 392 | 3300005545 | Ga0070695_100312936 | Ga0070695_1003129361 | 138 |
| 393 | 3300005545 | Ga0070695_100522003 | Ga0070695_1005220031 | 138 |
| 394 | 3300005545 | Ga0070695_100680878 | Ga0070695_1006808782 | 138 |
| 395 | 3300005545 | Ga0070695_101168978 | Ga0070695_1011689781 | 138 |
| 396 | 3300005546 | Ga0070696_100556121 | Ga0070696_1005561211 | 138 |
| 397 | 3300005546 | Ga0070696_100742564 | Ga0070696_1007425642 | 138 |
| 398 | 3300005546 | Ga0070696_101362650 | Ga0070696_1013626501 | 138 |
| 399 | 3300005546 | Ga0070696_101744563 | Ga0070696_1017445631 | 138 |
| 400 | 3300005547 | Ga0070693_100027954 | Ga0070693_1000279541 | 138 |
| 401 | 3300005547 | Ga0070693_100044478 | Ga0070693_1000444782 | 138 |
| 402 | 3300005547 | Ga0070693_100104883 | Ga0070693_1001048832 | 138 |
| 403 | 3300005547 | Ga0070693_100845542 | Ga0070693_1008455422 | 138 |
| 404 | 3300005547 | Ga0070693_100882560 | Ga0070693_1008825601 | 138 |
| 405 | 3300005548 | Ga0070665_100331573 | Ga0070665_1003315733 | 138 |
| 406 | 3300005549 | Ga0070704_100102689 | Ga0070704_1001026892 | 138 |
| 407 | 3300005549 | Ga0070704_100280816 | Ga0070704_1002808163 | 138 |
| 408 | 3300005563 | Ga0068855_100528694 | Ga0068855_1005286942 | 138 |
| 409 | 3300005564 | Ga0070664_100000280 | Ga0070664_1000002803 | 138 |
| 410 | 3300005577 | Ga0068857_100212738 | Ga0068857_1002127382 | 138 |
| 411 | 3300005577 | Ga0068857_100653258 | Ga0068857_1006532582 | 138 |
| 412 | 3300005577 | Ga0068857_100760759 | Ga0068857_1007607592 | 138 |
| 413 | 3300005577 | Ga0068857_100836303 | Ga0068857_1008363032 | 138 |
| 414 | 3300005578 | Ga0068854_100032703 | Ga0068854_1000327033 | 138 |
| 415 | 3300005578 | Ga0068854_101715774 | Ga0068854_1017157741 | 138 |
| 416 | 3300005615 | Ga0070702_100101099 | Ga0070702_1001010992 | 138 |
| 417 | 3300005616 | Ga0068852_100701405 | Ga0068852_1007014052 | 138 |
| 418 | 3300005617 | Ga0068859_100029302 | Ga0068859_1000293026 | 138 |
| 419 | 3300005617 | Ga0068859_100070298 | Ga0068859_1000702984 | 138 |
| 420 | 3300005617 | Ga0068859_100133157 | Ga0068859_1001331572 | 138 |
| 421 | 3300005617 | Ga0068859_101277854 | Ga0068859_1012778542 | 138 |
| 422 | 3300005618 | Ga0068864_100008450 | Ga0068864_1000084507 | 138 |
| 423 | 3300005618 | Ga0068864_100084118 | Ga0068864_1000841183 | 138 |
| 424 | 3300005719 | Ga0068861_100014624 | Ga0068861_1000146245 | 138 |
| 425 | 3300005719 | Ga0068861_100381937 | Ga0068861_1003819372 | 138 |
| 426 | 3300005719 | Ga0068861_100418111 | Ga0068861_1004181113 | 138 |
| 427 | 3300005719 | Ga0068861_100908791 | Ga0068861_1009087912 | 138 |
| 428 | 3300005834 | Ga0068851_10001259 | Ga0068851_100012597 | 138 |
| 429 | 3300005840 | Ga0068870_10135920 | Ga0068870_101359202 | 138 |
| 430 | 3300005842 | Ga0068858_100530465 | Ga0068858_1005304652 | 138 |
| 431 | 3300005843 | Ga0068860_100092019 | Ga0068860_1000920192 | 138 |
| 432 | 3300005843 | Ga0068860_101756984 | Ga0068860_1017569841 | 138 |
| 433 | 3300005844 | Ga0068862_100003102 | Ga0068862_1000031024 | 138 |
| 434 | 3300005844 | Ga0068862_100085631 | Ga0068862_1000856311 | 138 |
| 435 | 3300005844 | Ga0068862_100707901 | Ga0068862_1007079013 | 138 |
| 436 | 3300005844 | Ga0068862_101070959 | Ga0068862_1010709591 | 138 |
| 437 | 3300005985 | Ga0081539_10006263 | Ga0081539_100062632 | 138 |
| 438 | 3300006844 | Ga0075428_100198369 | Ga0075428_1001983693 | 138 |
| 439 | 3300006844 | Ga0075428_101920198 | Ga0075428_1019201982 | 138 |
| 440 | 3300006846 | Ga0075430_100210691 | Ga0075430_1002106912 | 138 |
| 441 | 3300006847 | Ga0075431_100259055 | Ga0075431_1002590554 | 138 |
| 442 | 3300006852 | Ga0075433_10311108 | Ga0075433_103111081 | 138 |
| 443 | 3300006852 | Ga0075433_10407300 | Ga0075433_104073002 | 138 |
| 444 | 3300006852 | Ga0075433_10607392 | Ga0075433_106073922 | 138 |
| 445 | 3300006852 | Ga0075433_10639284 | Ga0075433_106392841 | 138 |
| 446 | 3300006852 | Ga0075433_11112375 | Ga0075433_111123752 | 138 |
| 447 | 3300006871 | Ga0075434_100141130 | Ga0075434_1001411303 | 138 |
| 448 | 3300006871 | Ga0075434_100248628 | Ga0075434_1002486283 | 138 |
| 449 | 3300006880 | Ga0075429_101712404 | Ga0075429_1017124041 | 138 |
| 450 | 3300006931 | Ga0097620_100022921 | Ga0097620_1000229213 | 138 |
| 451 | 3300006931 | Ga0097620_100029302 | Ga0097620_1000293026 | 138 |
| 452 | 3300006931 | Ga0097620_100070298 | Ga0097620_1000702984 | 138 |
| 453 | 3300006931 | Ga0097620_100133147 | Ga0097620_1001331472 | 138 |
| 454 | 3300006931 | Ga0097620_101277914 | Ga0097620_1012779142 | 138 |
| 455 | 3300009093 | Ga0105240_10033105 | Ga0105240_100331051 | 138 |
| 456 | 3300009094 | Ga0111539_10066768 | Ga0111539_100667684 | 138 |
| 457 | 3300009094 | Ga0111539_10075347 | Ga0111539_100753474 | 138 |
| 458 | 3300009094 | Ga0111539_10791953 | Ga0111539_107919532 | 138 |
| 459 | 3300009094 | Ga0111539_11332911 | Ga0111539_113329111 | 138 |
| 460 | 3300009094 | Ga0111539_11632552 | Ga0111539_116325523 | 138 |
| 461 | 3300009101 | Ga0105247_10050406 | Ga0105247_100504064 | 138 |
| 462 | 3300009101 | Ga0105247_10050783 | Ga0105247_100507832 | 138 |
| 463 | 3300009147 | Ga0114129_10148006 | Ga0114129_101480061 | 138 |
| 464 | 3300009148 | Ga0105243_10123361 | Ga0105243_101233613 | 138 |
| 465 | 3300009174 | Ga0105241_10035999 | Ga0105241_100359994 | 138 |
| 466 | 3300009174 | Ga0105241_10447469 | Ga0105241_104474692 | 138 |
| 467 | 3300009177 | Ga0105248_10009310 | Ga0105248_100093104 | 138 |
| 468 | 3300009177 | Ga0105248_10014875 | Ga0105248_100148754 | 138 |
| 469 | 3300009177 | Ga0105248_10019260 | Ga0105248_100192606 | 138 |
| 470 | 3300009545 | Ga0105237_10002331 | Ga0105237_1000233125 | 138 |
| 471 | 3300009545 | Ga0105237_10023809 | Ga0105237_100238096 | 138 |
| 472 | 3300009553 | Ga0105249_11240701 | Ga0105249_112407013 | 138 |
| 473 | 3300009553 | Ga0105249_11375886 | Ga0105249_113758861 | 138 |
| 474 | 3300010375 | Ga0105239_10689382 | Ga0105239_106893822 | 138 |
| 475 | 3300010375 | Ga0105239_11038816 | Ga0105239_110388162 | 138 |
| 476 | 3300010375 | Ga0105239_11075455 | Ga0105239_110754552 | 138 |
| 477 | 3300013100 | Ga0157373_10006812 | Ga0157373_100068129 | 138 |
| 478 | 3300013100 | Ga0157373_10074546 | Ga0157373_100745464 | 138 |
| 479 | 3300013296 | Ga0157374_10361457 | Ga0157374_103614572 | 138 |
| 480 | 3300013297 | Ga0157378_10042680 | Ga0157378_100426805 | 138 |
| 481 | 3300013297 | Ga0157378_10083853 | Ga0157378_100838532 | 138 |
| 482 | 3300013306 | Ga0163162_10016961 | Ga0163162_100169616 | 138 |
| 483 | 3300013306 | Ga0163162_10065551 | Ga0163162_100655514 | 138 |
| 484 | 3300013307 | Ga0157372_10106832 | Ga0157372_101068322 | 138 |
| 485 | 3300013307 | Ga0157372_10723993 | Ga0157372_107239933 | 138 |
| 486 | 3300013308 | Ga0157375_10026487 | Ga0157375_100264875 | 138 |
| 487 | 3300013308 | Ga0157375_10194525 | Ga0157375_101945254 | 138 |
| 488 | 3300013308 | Ga0157375_12394264 | Ga0157375_123942642 | 138 |
| 489 | 3300014325 | Ga0163163_10121817 | Ga0163163_101218172 | 138 |
| 490 | 3300014325 | Ga0163163_10131326 | Ga0163163_101313263 | 138 |
| 491 | 3300014325 | Ga0163163_10559558 | Ga0163163_105595582 | 138 |
| 492 | 3300014326 | Ga0157380_10004242 | Ga0157380_1000424211 | 138 |
| 493 | 3300014326 | Ga0157380_10017254 | Ga0157380_100172544 | 138 |
| 494 | 3300014326 | Ga0157380_10450837 | Ga0157380_104508373 | 138 |
| 495 | 3300014745 | Ga0157377_10026346 | Ga0157377_100263462 | 138 |
| 496 | 3300014968 | Ga0157379_10253503 | Ga0157379_102535032 | 138 |
| 497 | 3300014968 | Ga0157379_10560298 | Ga0157379_105602981 | 138 |
| 498 | 3300015262 | Ga0182007_10047454 | Ga0182007_100474541 | 138 |
| 499 | 3300025321 | Ga0207656_10001046 | Ga0207656_100010466 | 138 |
| 500 | 3300025900 | Ga0207710_10085947 | Ga0207710_100859471 | 138 |
| 501 | 3300025904 | Ga0207647_10103692 | Ga0207647_101036924 | 138 |
| 502 | 3300025910 | Ga0207684_10000076 | Ga0207684_1000007621 | 138 |
| 503 | 3300025910 | Ga0207684_10136755 | Ga0207684_101367554 | 138 |
| 504 | 3300025911 | Ga0207654_10248765 | Ga0207654_102487652 | 138 |
| 505 | 3300025911 | Ga0207654_10377527 | Ga0207654_103775272 | 138 |
| 506 | 3300025912 | Ga0207707_10132876 | Ga0207707_101328762 | 138 |
| 507 | 3300025912 | Ga0207707_10783846 | Ga0207707_107838461 | 138 |
| 508 | 3300025912 | Ga0207707_11233302 | Ga0207707_112333021 | 138 |
| 509 | 3300025913 | Ga0207695_10035380 | Ga0207695_100353805 | 138 |
| 510 | 3300025914 | Ga0207671_10013536 | Ga0207671_100135366 | 138 |
| 511 | 3300025917 | Ga0207660_10054506 | Ga0207660_100545063 | 138 |
| 512 | 3300025917 | Ga0207660_11344826 | Ga0207660_113448262 | 138 |
| 513 | 3300025917 | Ga0207660_11622150 | Ga0207660_116221501 | 138 |
| 514 | 3300025921 | Ga0207652_10052088 | Ga0207652_100520884 | 138 |
| 515 | 3300025921 | Ga0207652_11136367 | Ga0207652_111363672 | 138 |
| 516 | 3300025923 | Ga0207681_10823485 | Ga0207681_108234851 | 138 |
| 517 | 3300025925 | Ga0207650_10051485 | Ga0207650_100514852 | 138 |
| 518 | 3300025925 | Ga0207650_10067177 | Ga0207650_100671774 | 138 |
| 519 | 3300025932 | Ga0207690_10273905 | Ga0207690_102739052 | 138 |
| 520 | 3300025933 | Ga0207706_10093709 | Ga0207706_100937092 | 138 |
| 521 | 3300025933 | Ga0207706_10440014 | Ga0207706_104400142 | 138 |
| 522 | 3300025933 | Ga0207706_10769731 | Ga0207706_107697311 | 138 |
| 523 | 3300025933 | Ga0207706_10849966 | Ga0207706_108499662 | 138 |
| 524 | 3300025936 | Ga0207670_10803206 | Ga0207670_108032061 | 138 |
| 525 | 3300025939 | Ga0207665_10740284 | Ga0207665_107402841 | 138 |
| 526 | 3300025941 | Ga0207711_10039251 | Ga0207711_100392514 | 138 |
| 527 | 3300025941 | Ga0207711_10049360 | Ga0207711_100493604 | 138 |
| 528 | 3300025942 | Ga0207689_10214880 | Ga0207689_102148803 | 138 |
| 529 | 3300025942 | Ga0207689_10659302 | Ga0207689_106593021 | 138 |
| 530 | 3300025942 | Ga0207689_10880028 | Ga0207689_108800281 | 138 |
| 531 | 3300025945 | Ga0207679_10092924 | Ga0207679_100929242 | 138 |
| 532 | 3300025945 | Ga0207679_10814893 | Ga0207679_108148931 | 138 |
| 533 | 3300025949 | Ga0207667_10486139 | Ga0207667_104861392 | 138 |
| 534 | 3300025960 | Ga0207651_10135034 | Ga0207651_101350342 | 138 |
| 535 | 3300025961 | Ga0207712_11854099 | Ga0207712_118540992 | 138 |
| 536 | 3300026023 | Ga0207677_10968582 | Ga0207677_109685822 | 138 |
| 537 | 3300026041 | Ga0207639_10226276 | Ga0207639_102262762 | 138 |
| 538 | 3300026075 | Ga0207708_10001596 | Ga0207708_100015962 | 138 |
| 539 | 3300026075 | Ga0207708_10002110 | Ga0207708_100021104 | 138 |
| 540 | 3300026075 | Ga0207708_10287383 | Ga0207708_102873832 | 138 |
| 541 | 3300026095 | Ga0207676_10027189 | Ga0207676_100271892 | 138 |
| 542 | 3300026095 | Ga0207676_10566753 | Ga0207676_105667531 | 138 |
| 543 | 3300026116 | Ga0207674_10000525 | Ga0207674_1000052540 | 138 |
| 544 | 3300026116 | Ga0207674_11388719 | Ga0207674_113887192 | 138 |
| 545 | 3300026116 | Ga0207674_12120573 | Ga0207674_121205731 | 138 |
| 546 | 3300026118 | Ga0207675_100008022 | Ga0207675_10000802211 | 138 |
| 547 | 3300026118 | Ga0207675_100042397 | Ga0207675_1000423974 | 138 |
| 548 | 3300026118 | Ga0207675_100094682 | Ga0207675_1000946823 | 138 |
| 549 | 3300026118 | Ga0207675_100314590 | Ga0207675_1003145902 | 138 |
| 550 | 3300026118 | Ga0207675_101983361 | Ga0207675_1019833611 | 138 |
| 551 | 3300026142 | Ga0207698_10298801 | Ga0207698_102988011 | 138 |
| 552 | 3300027907 | Ga0207428_11008619 | Ga0207428_110086191 | 138 |
| 553 | 3300028380 | Ga0268265_10044278 | Ga0268265_100442783 | 138 |
| 554 | 3300028380 | Ga0268265_10134589 | Ga0268265_101345893 | 138 |
| 555 | 3300028380 | Ga0268265_10312769 | Ga0268265_103127693 | 138 |
| 556 | 3300028381 | Ga0268264_10204624 | Ga0268264_102046242 | 138 |
| 557 | 3300030733 | Ga0314311_1182293 | Ga0314311_11822931 | 138 |
| 558 | 3300030745 | Ga0316182_1226790 | Ga0316182_12267902 | 138 |
| 559 | 3300031548 | Ga0307408_100001826 | Ga0307408_10000182611 | 138 |
| 560 | 3300031731 | Ga0307405_10313060 | Ga0307405_103130602 | 138 |
| 561 | 3300031731 | Ga0307405_10371494 | Ga0307405_103714941 | 138 |
| 562 | 3300031824 | Ga0307413_10132294 | Ga0307413_101322944 | 138 |
| 563 | 3300031824 | Ga0307413_11132243 | Ga0307413_111322431 | 138 |
| 564 | 3300031852 | Ga0307410_10295896 | Ga0307410_102958963 | 138 |
| 565 | 3300031852 | Ga0307410_10934100 | Ga0307410_109341001 | 138 |
| 566 | 3300031901 | Ga0307406_10098592 | Ga0307406_100985922 | 138 |
| 567 | 3300031911 | Ga0307412_10008770 | Ga0307412_100087701 | 138 |
| 568 | 3300031911 | Ga0307412_10061834 | Ga0307412_100618343 | 138 |
| 569 | 3300031911 | Ga0307412_10086405 | Ga0307412_100864053 | 138 |
| 570 | 3300031911 | Ga0307412_10411338 | Ga0307412_104113383 | 138 |
| 571 | 3300031995 | Ga0307409_101193563 | Ga0307409_1011935631 | 138 |
| 572 | 3300032002 | Ga0307416_100096334 | Ga0307416_1000963341 | 138 |
| 573 | 3300032002 | Ga0307416_100214558 | Ga0307416_1002145582 | 138 |
| 574 | 3300032004 | Ga0307414_10061215 | Ga0307414_100612153 | 138 |
| 575 | 3300032004 | Ga0307414_10110428 | Ga0307414_101104284 | 138 |
| 576 | 3300032004 | Ga0307414_10257688 | Ga0307414_102576882 | 138 |
| 577 | 3300032126 | Ga0307415_100014139 | Ga0307415_1000141392 | 138 |
| 578 | 3300032126 | Ga0307415_100064647 | Ga0307415_1000646472 | 138 |
| 579 | 3300032126 | Ga0307415_100262921 | Ga0307415_1002629212 | 138 |
| 580 | 3300034817 | Ga0373948_0084537 | Ga0373948_0084537_43_477 | 138 |
| 581 | 3300035112 | Ga0373932_0120749 | Ga0373932_0120749_19_453 | 138 |
| 582 | 3300035115 | Ga0373941_0127320 | Ga0373941_0127320_177_611 | 138 |
| 583 | 3300037312 | Ga0395899_0593758 | Ga0395899_0593758_148_582 | 138 |
| 584 | 3300037418 | Ga0395900_0715596 | Ga0395900_0715596_156_590 | 138 |
| 585 | 3300037418 | Ga0395900_0794110 | Ga0395900_0794110_159_593 | 138 |
| 586 | 3300037466 | Ga0395898_0094590 | Ga0395898_0094590_437_871 | 138 |
| 587 | 3300038443 | Ga0395901_0270921 | Ga0395901_0270921_943_1377 | 138 |
| 588 | 3300038443 | Ga0395901_0328652 | Ga0395901_0328652_197_631 | 138 |
| 589 | 3300038443 | Ga0395901_0884954 | Ga0395901_0884954_355_789 | 138 |
| 590 | 3300041999 | Ga0439433_0046014 | Ga0439433_0046014_258_692 | 138 |
| 591 | 3300042005 | Ga0439448_0083464 | Ga0439448_0083464_543_959 | 138 |
| 592 | 3300042157 | Ga0439458_0023958 | Ga0439458_0023958_850_1266 | 138 |
| 593 | 3300048907 | Ga0496104_0142126 | Ga0496104_0142126_441_875 | 138 |
| 594 | 3300048910 | Ga0496107_0061191 | Ga0496107_0061191_1333_1749 | 138 |
| 595 | 3300048911 | Ga0496108_0161836 | Ga0496108_0161836_1249_1665 | 138 |
| 596 | 3300048913 | Ga0496110_0593813 | Ga0496110_0593813_498_932 | 138 |
| 597 | 3300048915 | Ga0496112_0236170 | Ga0496112_0236170_473_907 | 138 |
| 598 | 3300049514 | Ga0501291_001731 | Ga0501291_001731_501_935 | 138 |
| 599 | 3300049514 | Ga0501291_034570 | Ga0501291_034570_50_484 | 138 |
| 600 | 3300049521 | Ga0501298_002776 | Ga0501298_002776_728_1162 | 138 |
| 601 | 3300049522 | Ga0501299_019221 | Ga0501299_019221_572_1006 | 138 |
| 602 | 3300049523 | Ga0501300_027137 | Ga0501300_027137_309_743 | 138 |
| 603 | 3300049649 | Ga0501198_004315 | Ga0501198_004315_1294_1728 | 138 |
| 604 | 3300049649 | Ga0501198_084040 | Ga0501198_084040_136_564 | 138 |
| 605 | 3300049650 | Ga0501199_009127 | Ga0501199_009127_275_709 | 138 |
| 606 | 3300049651 | Ga0501201_005143 | Ga0501201_005143_738_1172 | 138 |
| 607 | 3300049652 | Ga0501202_019797 | Ga0501202_019797_538_972 | 138 |
| 608 | 3300049654 | Ga0501207_007766 | Ga0501207_007766_668_1096 | 138 |
| 609 | 3300049659 | Ga0501214_007509 | Ga0501214_007509_527_961 | 138 |
| 610 | 3300049660 | Ga0501216_007629 | Ga0501216_007629_421_855 | 138 |
| 611 | 3300049661 | Ga0501217_023767 | Ga0501217_023767_135_563 | 138 |
| 612 | 3300049663 | Ga0501223_005860 | Ga0501223_005860_854_1288 | 138 |
| 613 | 3300049664 | Ga0501224_010073 | Ga0501224_010073_902_1363 | 138 |
| 614 | 3300049665 | Ga0501227_022977 | Ga0501227_022977_832_1260 | 138 |
| 615 | 3300049665 | Ga0501227_026886 | Ga0501227_026886_13_447 | 138 |
| 616 | 3300049665 | Ga0501227_034899 | Ga0501227_034899_226_660 | 138 |
| 617 | 3300049668 | Ga0501233_007158 | Ga0501233_007158_121_549 | 138 |
| 618 | 3300049668 | Ga0501233_018233 | Ga0501233_018233_921_1382 | 138 |
| 619 | 3300049669 | Ga0501235_029867 | Ga0501235_029867_700_1134 | 138 |
| 620 | 3300049669 | Ga0501235_078570 | Ga0501235_078570_197_631 | 138 |
| 621 | 3300049675 | Ga0501243_004218 | Ga0501243_004218_735_1169 | 138 |
| 622 | 3300049677 | Ga0501247_034983 | Ga0501247_034983_38_466 | 138 |
| 623 | 3300049685 | Ga0501256_012121 | Ga0501256_012121_134_568 | 138 |
| 624 | 3300049689 | Ga0501260_000603 | Ga0501260_000603_762_1190 | 138 |
| 625 | 3300049689 | Ga0501260_005180 | Ga0501260_005180_608_1069 | 138 |
| 626 | 3300049690 | Ga0501261_023683 | Ga0501261_023683_247_675 | 138 |
| 627 | 3300049705 | Ga0501225_0006653 | Ga0501225_0006653_208_642 | 138 |
| 628 | 3300049705 | Ga0501225_0013154 | Ga0501225_0013154_817_1245 | 138 |
| 629 | 3300049706 | Ga0501229_011982 | Ga0501229_011982_152_586 | 138 |
| 630 | 3300049707 | Ga0501234_003604 | Ga0501234_003604_296_724 | 138 |
| 631 | 3300049707 | Ga0501234_048558 | Ga0501234_048558_237_671 | 138 |
| 632 | 3300049708 | Ga0501245_032846 | Ga0501245_032846_85_519 | 138 |
| 633 | 3300049708 | Ga0501245_162982 | Ga0501245_162982_13_441 | 138 |
| 634 | 3300049765 | Ga0501268_008749 | Ga0501268_008749_742_1176 | 138 |
| 635 | 3300049767 | Ga0501270_018536 | Ga0501270_018536_277_705 | 138 |
| 636 | 3300049770 | Ga0501273_003402 | Ga0501273_003402_680_1141 | 138 |
| 637 | 3300049776 | Ga0501280_122909 | Ga0501280_122909_39_467 | 138 |
| 638 | 3300049779 | Ga0501283_001262 | Ga0501283_001262_1011_1445 | 138 |
| 639 | 3300049779 | Ga0501283_004329 | Ga0501283_004329_231_659 | 138 |
| 640 | 3300049851 | Ga0501212_002532 | Ga0501212_002532_203_631 | 138 |
| 641 | 3300049851 | Ga0501212_003304 | Ga0501212_003304_1064_1498 | 138 |
| 642 | 3300049853 | Ga0501226_005410 | Ga0501226_005410_447_875 | 138 |
| 643 | 3300049853 | Ga0501226_006765 | Ga0501226_006765_778_1212 | 138 |
| 644 | 3300050507 | nmdc:mga05p37_219182_c1 | nmdc:mga05p37_219182_c1_1614_2048 | 138 |
| 645 | 3300050507 | nmdc:mga05p37_286014_c1 | nmdc:mga05p37_286014_c1_1395_1829 | 138 |
| 646 | 3300050509 | nmdc:mga0qj67_227233_c1 | nmdc:mga0qj67_227233_c1_1045_1464 | 138 |
| 647 | 3300050510 | nmdc:mga06r32_303513_c1 | nmdc:mga06r32_303513_c1_712_1146 | 138 |
| 648 | 3300050510 | nmdc:mga06r32_321541_c1 | nmdc:mga06r32_321541_c1_656_1075 | 138 |
| 649 | 3300050511 | nmdc:mga08y16_135452_c1 | nmdc:mga08y16_135452_c1_253_669 | 138 |
| 650 | 3300050511 | nmdc:mga08y16_440686_c1 | nmdc:mga08y16_440686_c1_265_699 | 138 |
| 651 | 3300050511 | nmdc:mga08y16_479522_c1 | nmdc:mga08y16_479522_c1_625_1053 | 138 |
| 652 | 3300050512 | nmdc:mga0n895_84297_c1 | nmdc:mga0n895_84297_c1_1867_2283 | 138 |
| 653 | 3300050512 | nmdc:mga0n895_85872_c1 | nmdc:mga0n895_85872_c1_2642_3076 | 138 |
| 654 | 3300050515 | nmdc:mga0a205_13111_c1 | nmdc:mga0a205_13111_c1_246_662 | 138 |
| 655 | 3300050515 | nmdc:mga0a205_70579_c1 | nmdc:mga0a205_70579_c1_2691_3125 | 138 |
| 656 | 3300060353 | Ga0501082_1340016 | Ga0501082_1340016_106_543 | 138 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2a9h-assembly1.cif.gz_C | nmr structural studies of a potassium channel / charybdotoxin complex | 0.4633 | 34 | 138 |
| 2a9h-assembly1.cif.gz_C | nmr structural studies of a potassium channel / charybdotoxin complex | 0.444 | 34 | 138 |
| 2a79-assembly1.cif.gz_B | mammalian shaker kv1.2 potassium channel- beta subunit complex | 0.3786 | 12 | 138 |
| 6wkn-assembly1.cif.gz_A | pl-bound rat trpv2 in nanodiscs | 0.3706 | 9 | 138 |
| 2a79-assembly1.cif.gz_B | mammalian shaker kv1.2 potassium channel- beta subunit complex | 0.3218 | 12 | 138 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2a9hD00 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.4635 | 34 | 138 | 1.10.287.70 |
| 2a9hD00 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.4444 | 34 | 138 | 1.10.287.70 |
| af_A4HRG0_1_184_1.20.1070.10 | Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins | 0.3981 | 12 | 134 | 1.20.1070.10 |
| af_O88758_331_439_1.10.287.70 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.3916 | 16 | 138 | 1.10.287.70 |
| af_O88758_331_439_1.10.287.70 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.387 | 16 | 138 | 1.10.287.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A352F064-F1-model_v4 | DUF6677 domain-containing protein | 0.9471 | 7 | 138 |
GO:0016020
|
| AF-A0A7Y4UIK9-F1-model_v4 | DUF6677 domain-containing protein | 0.9402 | 10 | 138 |
GO:0016020
|
| AF-A0A2W0AZQ2-F1-model_v4 | DUF6677 domain-containing protein | 0.9324 | 13 | 138 |
GO:0016020
|
| AF-A0A6L7U9Z2-F1-model_v4 | deleted | 0.9305 | 7 | 138 |
|
| AF-A0A7V9URH7-F1-model_v4 | DUF6677 domain-containing protein | 0.9299 | 4 | 138 |
GO:0016020
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar