F472957

General Info

Members Datasets Scaffolds Average Seq Length
655 342 646 320

Family's Representative Sequence

Representative Sequence 3300046523|Ga0495644_0019617|Ga0495644_0019617_943_2016
Length 357
Sequence LADKDEGCFDRRRKSMTAFKAGGRVRTSSREELRMPTLHGTLLKAAGLLLALTTAVAAQDYPNKPVRLIIPFPPGGSNDVVGRLIATHLSERLGKQVVVDNRGAGAGGVVGSEVAANAPRDGYTLLIISLAHAVNPWLYKLPYDPIKSFTPVAILASGPNVLVVNPDLPVHSVKDLLAAAKEKPGQLQYASAGIGSFQHLGGELFKLTAGVNLLHVPFKGGGPAMIDVIGGHTKVMFSSLVQTTPHIRSGKLRALGTGGLTRNPVLPDVPAIAEAGVPGYEAVNWWGVVAPAGTPAAIVEKLHKEITAVQESDEVKKHFASEGAQVVQMSSAEFAVFIEKEMNKWERVVKEGGIKAE

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
60 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
64 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
65 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
66 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
69 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
70 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
71 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
82 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
102 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
103 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
104 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
152 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
155 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
156 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
157 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
158 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
159 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
160 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
161 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
162 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
163 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
164 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
165 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
166 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
167 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
168 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
169 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
170 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
171 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
172 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
173 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
174 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
175 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
176 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
177 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
178 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
179 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
180 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
181 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
182 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
183 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
184 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
185 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
186 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
187 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
188 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
189 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
190 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
191 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
192 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
193 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
194 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
195 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
196 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
197 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
198 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
199 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
200 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
201 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
202 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
203 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
204 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
205 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
206 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
207 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
208 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
209 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
210 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
211 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
212 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
213 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
214 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
215 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
216 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
217 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
218 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
219 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
220 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
221 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
222 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
223 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
224 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
225 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
226 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
227 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
228 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
229 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
230 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
231 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
232 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
233 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
234 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
235 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
236 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
237 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
238 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
239 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
240 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
241 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
242 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
243 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
244 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
245 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
246 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
247 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
248 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
249 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
250 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
251 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
252 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
253 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
254 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
255 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
256 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
257 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
258 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
259 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
260 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
261 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
262 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
263 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
264 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
265 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
266 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
267 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
268 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
269 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
270 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
271 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
272 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
273 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
274 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
275 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
276 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
277 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
278 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
279 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
280 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
281 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
282 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
285 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
287 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
290 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
297 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
298 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
299 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
300 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
301 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
302 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
303 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
304 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
305 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
306 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
307 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
308 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
309 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
310 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
311 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
312 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
313 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
314 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
315 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
316 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
317 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
318 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
319 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
320 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
321 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
322 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
323 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
324 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
325 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
326 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
327 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
328 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
329 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
330 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
331 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
332 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
333 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
334 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
335 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
336 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
337 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
338 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
339 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
340 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
341 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
342 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.5
Nodule 0
Rhizoplane 8.85
Rhizosphere 84.73
Stem 0
Stem Tuber 0
Unclassified 0.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_619028 2162886007 Bacteria 1978
2 JGI24737J22298_10035475 3300001990 Bacteria 1543
3 JGI24744J21845_10010458 3300002077 Bacteria 1901
4 JGI24742J22300_10002855 3300002244 Bacteria 2791
5 Ga0065707_10127840 3300005295 Bacteria 1976
6 Ga0070658_10017811 3300005327 Bacteria 5681
7 Ga0070676_10031436 3300005328 Bacteria 3033
8 Ga0070683_100160876 3300005329 Bacteria 2130
9 Ga0070683_100310475 3300005329 Bacteria 1501
10 Ga0070690_100023376 3300005330 Bacteria 3791
11 Ga0068869_100200157 3300005334 Bacteria 1574
12 Ga0070680_100052166 3300005336 Bacteria 3339
13 Ga0068868_100050930 3300005338 Bacteria 3254
14 Ga0068868_100278749 3300005338 Bacteria 1414
15 Ga0070689_100030900 3300005340 Bacteria 4067
16 Ga0070689_100052061 3300005340 Bacteria 3166
17 Ga0070689_100057601 3300005340 Bacteria 3016
18 Ga0070689_100071554 3300005340 Bacteria 2709
19 Ga0070687_100018341 3300005343 Bacteria 3235
20 Ga0070661_100227023 3300005344 Bacteria 1434
21 Ga0070692_10132326 3300005345 Bacteria 1403
22 Ga0070668_100031290 3300005347 Bacteria 4048
23 Ga0070668_100235344 3300005347 Bacteria 1516
24 Ga0070669_100088741 3300005353 Bacteria 2315
25 Ga0070669_100145768 3300005353 Bacteria 1829
26 Ga0070669_100185492 3300005353 Bacteria 1630
27 Ga0070675_100023649 3300005354 Bacteria 4915
28 Ga0070671_100014076 3300005355 Bacteria 6458
29 Ga0070671_100069285 3300005355 Bacteria 2942
30 Ga0070671_100075882 3300005355 Bacteria 2808
31 Ga0070671_100111507 3300005355 Bacteria 2298
32 Ga0070674_100007137 3300005356 Bacteria 6571
33 Ga0070673_100044391 3300005364 Bacteria 3441
34 Ga0070673_100091157 3300005364 Bacteria 2491
35 Ga0070673_100502695 3300005364 Bacteria 1097
36 Ga0070659_100280320 3300005366 Bacteria 1386
37 Ga0070667_100024257 3300005367 Bacteria 5037
38 Ga0070714_100069870 3300005435 Bacteria 3034
39 Ga0070714_100223682 3300005435 Bacteria 1731
40 Ga0070713_100158006 3300005436 Bacteria 2022
41 Ga0070710_10079388 3300005437 Bacteria 1912
42 Ga0070701_10014707 3300005438 Bacteria 3593
43 Ga0070711_100048441 3300005439 Bacteria 2906
44 Ga0070711_100188084 3300005439 Bacteria 1585
45 Ga0070705_100080566 3300005440 Bacteria 1998
46 Ga0070694_100002295 3300005444 Bacteria 11315
47 Ga0070694_100009395 3300005444 Bacteria 6003
48 Ga0070663_100229800 3300005455 Bacteria 1460
49 Ga0070678_100170885 3300005456 Bacteria 1770
50 Ga0070662_100100583 3300005457 Bacteria 2187
51 Ga0070662_100155736 3300005457 Bacteria 1783
52 Ga0070681_10043120 3300005458 Bacteria 4520
53 Ga0070681_10367590 3300005458 Bacteria 1349
54 Ga0068867_100082922 3300005459 Bacteria 2420
55 Ga0068867_100185278 3300005459 Bacteria 1657
56 Ga0070685_10034266 3300005466 Bacteria 2859
57 Ga0070707_100565696 3300005468 Bacteria 1099
58 Ga0070698_100121843 3300005471 Bacteria 2567
59 Ga0070698_100138733 3300005471 Bacteria 2384
60 Ga0070679_100017610 3300005530 Bacteria 6916
61 Ga0070679_100087553 3300005530 Bacteria 3102
62 Ga0070679_100264309 3300005530 Bacteria 1676
63 Ga0070684_100086057 3300005535 Bacteria 2789
64 Ga0068853_100096262 3300005539 Bacteria 2611
65 Ga0070672_100062522 3300005543 Bacteria 2938
66 Ga0070686_100015684 3300005544 Bacteria 4395
67 Ga0070686_100102156 3300005544 Bacteria 1939
68 Ga0070695_100003529 3300005545 Bacteria 9131
69 Ga0070696_100058527 3300005546 Bacteria 2691
70 Ga0070693_100188318 3300005547 Bacteria 1333
71 Ga0070665_100132337 3300005548 Bacteria 2496
72 Ga0070704_100022251 3300005549 Bacteria 4122
73 Ga0070704_100072294 3300005549 Bacteria 2508
74 Ga0068854_100026877 3300005578 Bacteria 3959
75 Ga0068854_100289669 3300005578 Bacteria 1321
76 Ga0070702_100120695 3300005615 Bacteria 1640
77 Ga0070702_100190426 3300005615 Bacteria 1349
78 Ga0068852_100106108 3300005616 Bacteria 2546
79 Ga0068859_100054576 3300005617 Bacteria 4019
80 Ga0068859_100102424 3300005617 Bacteria 2921
81 Ga0068864_100018958 3300005618 Bacteria 5752
82 Ga0068864_100036891 3300005618 Bacteria 4168
83 Ga0068870_10250354 3300005840 Bacteria 1098
84 Ga0068863_100107054 3300005841 Bacteria 2660
85 Ga0068858_100025413 3300005842 Bacteria 5511
86 Ga0081455_10000669 3300005937 Bacteria 44336
87 Ga0081455_10010322 3300005937 Bacteria 9494
88 Ga0081455_10026170 3300005937 Bacteria 5374
89 Ga0081538_10001564 3300005981 Bacteria 23475
90 Ga0081538_10037286 3300005981 Bacteria 3157
91 Ga0081538_10058508 3300005981 Bacteria 2235
92 Ga0081540_1001200 3300005983 Bacteria 22696
93 Ga0081540_1037669 3300005983 Bacteria 2559
94 Ga0081539_10001356 3300005985 Bacteria 42605
95 Ga0070717_10145746 3300006028 Bacteria 2045
96 Ga0075365_10075461 3300006038 Bacteria 2275
97 Ga0075365_10223467 3300006038 Bacteria 1321
98 Ga0075368_10007461 3300006042 Bacteria 3858
99 Ga0075363_100004161 3300006048 Bacteria 6283
100 Ga0075364_10011898 3300006051 Bacteria 5301
101 Ga0070712_100002654 3300006175 Bacteria 11037
102 Ga0070712_100056890 3300006175 Bacteria 2745
103 Ga0075362_10001383 3300006177 Bacteria 7699
104 Ga0075362_10038928 3300006177 Bacteria 2089
105 Ga0075362_10055847 3300006177 Bacteria 1776
106 Ga0075362_10082246 3300006177 Bacteria 1485
107 Ga0075367_10091905 3300006178 Bacteria 1847
108 Ga0075369_10058854 3300006186 Bacteria 1673
109 Ga0075366_10097792 3300006195 Bacteria 1760
110 Ga0068871_100013831 3300006358 Bacteria 5999
111 Ga0068871_100100950 3300006358 Bacteria 2417
112 Ga0075428_100002569 3300006844 Bacteria 19722
113 Ga0075428_100011624 3300006844 Bacteria 9796
114 Ga0075428_100057483 3300006844 Bacteria 4258
115 Ga0075428_100075150 3300006844 Bacteria 3690
116 Ga0075428_100143852 3300006844 Bacteria 2592
117 Ga0075428_100358587 3300006844 Bacteria 1564
118 Ga0075428_100401542 3300006844 Bacteria 1469
119 Ga0075430_100000063 3300006846 Bacteria 57435
120 Ga0075430_100007026 3300006846 Bacteria 9490
121 Ga0075430_100046155 3300006846 Bacteria 3680
122 Ga0075430_100067686 3300006846 Bacteria 2997
123 Ga0075431_100001682 3300006847 Bacteria 20734
124 Ga0075431_100012395 3300006847 Bacteria 8604
125 Ga0075431_100031216 3300006847 Bacteria 5487
126 Ga0075431_100160476 3300006847 Bacteria 2312
127 Ga0075434_100027816 3300006871 Bacteria 5551
128 Ga0075434_100046120 3300006871 Bacteria 4325
129 Ga0075434_100321966 3300006871 Bacteria 1567
130 Ga0075429_100005500 3300006880 Bacteria 10908
131 Ga0075429_100007197 3300006880 Bacteria 9654
132 Ga0075429_100021973 3300006880 Bacteria 5532
133 Ga0075429_100023196 3300006880 Bacteria 5382
134 Ga0075429_100036588 3300006880 Bacteria 4270
135 Ga0075429_100165815 3300006880 Bacteria 1935
136 Ga0075429_100198236 3300006880 Bacteria 1759
137 Ga0075429_100364929 3300006880 Bacteria 1264
138 Ga0068865_100081952 3300006881 Bacteria 2318
139 Ga0068865_100095941 3300006881 Bacteria 2161
140 Ga0097620_100054576 3300006931 Bacteria 4019
141 Ga0097620_100102422 3300006931 Bacteria 2921
142 Ga0075435_100029006 3300007076 Bacteria 4342
143 Ga0075435_100222802 3300007076 Bacteria 1602
144 Ga0099794_10059093 3300007265 Bacteria 1859
145 Ga0105244_10045377 3300009036 Bacteria 2261
146 Ga0111539_10000584 3300009094 Bacteria 47005
147 Ga0111539_10002420 3300009094 Bacteria 24821
148 Ga0111539_10004295 3300009094 Bacteria 18636
149 Ga0111539_10038151 3300009094 Bacteria 5796
150 Ga0111539_10097638 3300009094 Bacteria 3451
151 Ga0111539_10192490 3300009094 Bacteria 2379
152 Ga0105247_10013222 3300009101 Bacteria 4951
153 Ga0105247_10114666 3300009101 Bacteria 1738
154 Ga0114129_10000199 3300009147 Bacteria 66704
155 Ga0114129_10005299 3300009147 Bacteria 18196
156 Ga0114129_10025557 3300009147 Bacteria 8366
157 Ga0114129_10087647 3300009147 Bacteria 4316
158 Ga0114129_10100816 3300009147 Bacteria 3995
159 Ga0114129_10189803 3300009147 Bacteria 2791
160 Ga0114129_10381487 3300009147 Bacteria 1861
161 Ga0114129_10836592 3300009147 Bacteria 1171
162 Ga0105243_10032485 3300009148 Bacteria 4034
163 Ga0105243_10076587 3300009148 Bacteria 2719
164 Ga0105243_10108404 3300009148 Bacteria 2318
165 Ga0105241_10163927 3300009174 Bacteria 1830
166 Ga0105242_10049576 3300009176 Bacteria 3417
167 Ga0105242_10386853 3300009176 Bacteria 1302
168 Ga0105248_10030282 3300009177 Bacteria 6043
169 Ga0105238_10267876 3300009551 Bacteria 1688
170 Ga0105238_10372598 3300009551 Bacteria 1418
171 Ga0105238_10421118 3300009551 Bacteria 1330
172 Ga0105249_10006518 3300009553 Bacteria 10155
173 Ga0105249_10244064 3300009553 Bacteria 1777
174 Ga0105249_10661184 3300009553 Bacteria 1103
175 Ga0099796_10001693 3300010159 Bacteria 4569
176 Ga0099796_10079742 3300010159 Bacteria 1198
177 Ga0105239_10049040 3300010375 Bacteria 4630
178 Ga0105239_10204024 3300010375 Bacteria 2215
179 Ga0105246_10053542 3300011119 Bacteria 2777
180 Ga0105246_10178276 3300011119 Bacteria 1634
181 Ga0157378_10232713 3300013297 Bacteria 1757
182 Ga0163162_10055029 3300013306 Bacteria 4004
183 Ga0163162_10306838 3300013306 Bacteria 1719
184 Ga0157375_10001521 3300013308 Bacteria 19961
185 Ga0157375_10882193 3300013308 Bacteria 1039
186 Ga0163163_10004477 3300014325 Bacteria 11918
187 Ga0163163_10168951 3300014325 Bacteria 2233
188 Ga0163163_10246646 3300014325 Bacteria 1836
189 Ga0157380_10071822 3300014326 Bacteria 2801
190 Ga0157380_10223784 3300014326 Bacteria 1685
191 Ga0157380_10392092 3300014326 Bacteria 1314
192 Ga0157376_10066864 3300014969 Bacteria 3039
193 Ga0157376_10081402 3300014969 Bacteria 2780
194 Ga0213876_10104694 3300021384 Bacteria 1501
195 Ga0209758_1002417 3300025297 Bacteria 19125
196 Ga0207426_1025911 3300025302 Bacteria 1970
197 Ga0207697_10007537 3300025315 Bacteria 4845
198 Ga0207697_10078734 3300025315 Bacteria 1387
199 Ga0207682_10014593 3300025893 Bacteria 3062
200 Ga0207688_10001481 3300025901 Bacteria 12308
201 Ga0207688_10007736 3300025901 Bacteria 5855
202 Ga0207680_10035408 3300025903 Bacteria 2866
203 Ga0207647_10052730 3300025904 Bacteria 2509
204 Ga0207645_10022680 3300025907 Bacteria 4081
205 Ga0207645_10025867 3300025907 Bacteria 3796
206 Ga0207643_10002578 3300025908 Bacteria 9815
207 Ga0207707_10303982 3300025912 Bacteria 1379
208 Ga0207693_10033141 3300025915 Bacteria 4077
209 Ga0207693_10037884 3300025915 Bacteria 3800
210 Ga0207660_10094826 3300025917 Bacteria 2219
211 Ga0207662_10021624 3300025918 Bacteria 3681
212 Ga0207662_10098580 3300025918 Bacteria 1808
213 Ga0207657_10033671 3300025919 Bacteria 4615
214 Ga0207649_10101541 3300025920 Bacteria 1905
215 Ga0207652_10004363 3300025921 Bacteria 11526
216 Ga0207652_10170343 3300025921 Bacteria 1954
217 Ga0207652_10229354 3300025921 Bacteria 1673
218 Ga0207681_10045506 3300025923 Bacteria 2947
219 Ga0207681_10126196 3300025923 Bacteria 1885
220 Ga0207694_10181188 3300025924 Bacteria 1708
221 Ga0207650_10068470 3300025925 Bacteria 2665
222 Ga0207650_10106387 3300025925 Bacteria 2167
223 Ga0207687_10041231 3300025927 Bacteria 3168
224 Ga0207700_10370219 3300025928 Bacteria 1251
225 Ga0207644_10096541 3300025931 Bacteria 2212
226 Ga0207690_10071916 3300025932 Bacteria 2387
227 Ga0207706_10074680 3300025933 Bacteria 2981
228 Ga0207706_10255904 3300025933 Bacteria 1529
229 Ga0207686_10083504 3300025934 Bacteria 2091
230 Ga0207686_10124359 3300025934 Bacteria 1760
231 Ga0207670_10085017 3300025936 Bacteria 2222
232 Ga0207670_10099004 3300025936 Bacteria 2079
233 Ga0207669_10009105 3300025937 Bacteria 4709
234 Ga0207691_10077916 3300025940 Bacteria 2984
235 Ga0207711_10057574 3300025941 Bacteria 3341
236 Ga0207711_10159172 3300025941 Bacteria 2042
237 Ga0207689_10052814 3300025942 Bacteria 3348
238 Ga0207689_10054189 3300025942 Bacteria 3304
239 Ga0207640_10018223 3300025981 Bacteria 4122
240 Ga0207658_10091749 3300025986 Bacteria 2358
241 Ga0207703_10063299 3300026035 Bacteria 3032
242 Ga0207703_10357318 3300026035 Bacteria 1346
243 Ga0207639_10022893 3300026041 Bacteria 4506
244 Ga0207678_10017701 3300026067 Bacteria 6257
245 Ga0207678_10399546 3300026067 Bacteria 1190
246 Ga0207708_10011303 3300026075 Bacteria 6646
247 Ga0207708_10025614 3300026075 Bacteria 4464
248 Ga0207648_10006412 3300026089 Bacteria 11694
249 Ga0207648_10124461 3300026089 Bacteria 2268
250 Ga0207676_10122216 3300026095 Bacteria 2198
251 Ga0207676_10215743 3300026095 Bacteria 1705
252 Ga0207674_10127787 3300026116 Bacteria 2506
253 Ga0207675_100033231 3300026118 Bacteria 4807
254 Ga0207683_10047318 3300026121 Bacteria 3767
255 Ga0207683_10069648 3300026121 Bacteria 3107
256 Ga0207683_10167096 3300026121 Bacteria 1991
257 Ga0209967_1006036 3300027364 Bacteria 1635
258 Ga0209981_1000108 3300027378 Bacteria 9363
259 Ga0209981_1009684 3300027378 Bacteria 1320
260 Ga0210000_1001906 3300027462 Bacteria 2949
261 Ga0209968_1002752 3300027526 Bacteria 2639
262 Ga0209999_1001768 3300027543 Bacteria 3748
263 Ga0209999_1005358 3300027543 Bacteria 2309
264 Ga0209970_1016912 3300027614 Bacteria 1219
265 Ga0209971_1001897 3300027682 Bacteria 5117
266 Ga0209966_1003426 3300027695 Bacteria 2669
267 Ga0207428_10026893 3300027907 Bacteria 4793
268 Ga0268266_10073587 3300028379 Bacteria 2965
269 Ga0268265_10060002 3300028380 Bacteria 2913
270 Ga0265337_1000071 3300028556 Bacteria 47429
271 Ga0265318_10006909 3300028577 Bacteria 5175
272 Ga0265318_10041305 3300028577 Bacteria 1754
273 Ga0265338_10256976 3300028800 Bacteria 1286
274 Ga0265330_10020279 3300031235 Bacteria 3037
275 Ga0265332_10004771 3300031238 Bacteria 6316
276 Ga0265328_10017370 3300031239 Bacteria 2786
277 Ga0265325_10001522 3300031241 Bacteria 16252
278 Ga0265325_10006017 3300031241 Bacteria 7420
279 Ga0265325_10008016 3300031241 Bacteria 6266
280 Ga0265325_10030664 3300031241 Bacteria 2882
281 Ga0265325_10047880 3300031241 Bacteria 2212
282 Ga0265329_10032809 3300031242 Bacteria 1681
283 Ga0265340_10009642 3300031247 Bacteria 5175
284 Ga0265340_10020870 3300031247 Bacteria 3362
285 Ga0265339_10001047 3300031249 Bacteria 21072
286 Ga0265339_10071657 3300031249 Bacteria 1845
287 Ga0265331_10000872 3300031250 Bacteria 24581
288 Ga0265316_10042203 3300031344 Bacteria 3647
289 Ga0265313_10000977 3300031595 Bacteria 28255
290 Ga0265314_10002632 3300031711 Bacteria 18095
291 Ga0265342_10055983 3300031712 Bacteria 2339
292 Ga0307411_10236922 3300032005 Bacteria 1426
293 Ga0307415_100261794 3300032126 Bacteria 1412
294 Ga0373948_0001038 3300034817 Bacteria 3738
295 Ga0373958_0000067 3300034819 Bacteria 10448
296 Ga0373959_0000605 3300034820 Bacteria 6302
297 Ga0373926_0038725 3300035083 Bacteria 1699
298 Ga0373928_0001080 3300035084 Bacteria 5386
299 Ga0373928_0022443 3300035084 Bacteria 1339
300 Ga0373929_0000479 3300035085 Bacteria 7659
301 Ga0373940_0000423 3300035088 Bacteria 6449
302 Ga0373949_0000398 3300035090 Bacteria 15159
303 Ga0373951_0000207 3300035091 Bacteria 21222
304 Ga0373952_0000046 3300035092 Bacteria 14781
305 Ga0373932_0000529 3300035112 Bacteria 11735
306 Ga0373936_0014420 3300035113 Bacteria 3021
307 Ga0373936_0023790 3300035113 Bacteria 2389
308 Ga0373939_0000159 3300035114 Bacteria 18873
309 Ga0373939_0014094 3300035114 Bacteria 2069
310 Ga0373941_0000017 3300035115 Bacteria 30339
311 Ga0373945_0013465 3300035116 Bacteria 2730
312 Ga0373953_0031612 3300035117 Bacteria 2060
313 Ga0373953_0072067 3300035117 Bacteria 1426
314 Ga0373954_0019942 3300035118 Bacteria 3027
315 Ga0373954_0057652 3300035118 Bacteria 1829
316 Ga0373957_0004052 3300035120 Bacteria 4415
317 Ga0373960_0000896 3300035121 Bacteria 6327
318 Ga0373943_0004464 3300035170 Bacteria 6333
319 Ga0373955_0000530 3300035172 Bacteria 16128
320 Ga0373955_0003218 3300035172 Bacteria 7154
321 Ga0373942_0000086 3300035207 Bacteria 19988
322 Ga0373961_0002182 3300035241 Bacteria 5193
323 Ga0373962_0012862 3300035242 Bacteria 2113
324 Ga0373962_0017725 3300035242 Bacteria 1848
325 Ga0373924_0021780 3300035410 Bacteria 2501
326 Ga0373931_0008078 3300035691 Bacteria 4980
327 Ga0373931_0069082 3300035691 Bacteria 1924
328 Ga0373931_0122941 3300035691 Bacteria 1485
329 Ga0373935_0000108 3300035692 Bacteria 37623
330 Ga0373935_0072350 3300035692 Bacteria 2226
331 Ga0373935_0097026 3300035692 Bacteria 1938
332 Ga0373927_0004068 3300035695 Bacteria 10319
333 Ga0373927_0051665 3300035695 Bacteria 2658
334 Ga0373933_0000591 3300035724 Bacteria 22690
335 Ga0373933_0003638 3300035724 Bacteria 8542
336 Ga0373947_0004424 3300035725 Bacteria 8242
337 Ga0373947_0031657 3300035725 Bacteria 3114
338 Ga0373947_0057763 3300035725 Bacteria 2349
339 Ga0373937_0000007 3300036401 Bacteria 183537
340 Ga0373937_0006142 3300036401 Bacteria 10342
341 Ga0373925_0000011 3300037068 Bacteria 209840
342 Ga0395900_0001925 3300037418 Bacteria 23563
343 Ga0395900_0029817 3300037418 Bacteria 5600
344 Ga0436364_1380890 3300037853 Bacteria 2469
345 Ga0395901_0041809 3300038443 Bacteria 4751
346 Ga0436365_1075974 3300039437 Bacteria 3375
347 Ga0436363_0211948 3300039450 Bacteria 1585
348 Ga0436363_1183097 3300039450 Bacteria 997
349 Ga0451853_0997442 3300041512 Bacteria 1244
350 Ga0439441_002576 3300042001 Bacteria 2573
351 Ga0439443_004187 3300042003 Bacteria 1863
352 Ga0439446_0031443 3300042156 Unclassified 1536
353 Ga0439460_0000174 3300042461 Bacteria 12145
354 Ga0450893_0010550 3300042532 Bacteria 1520
355 Ga0453684_0040067 3300044712 Bacteria 6370
356 Ga0495592_0000390 3300046454 Bacteria 34192
357 Ga0495590_0093166 3300046457 Bacteria 1067
358 Ga0495629_0022960 3300046459 Bacteria 4446
359 Ga0495638_0192640 3300046460 Bacteria 1156
360 Ga0495651_0009066 3300046462 Bacteria 7636
361 Ga0495651_0028258 3300046462 Bacteria 4372
362 Ga0495651_0136692 3300046462 Bacteria 1782
363 Ga0495653_0000249 3300046463 Bacteria 43160
364 Ga0495653_0041065 3300046463 Bacteria 3613
365 Ga0495580_0032962 3300046472 Bacteria 3733
366 Ga0495582_0082076 3300046473 Bacteria 1791
367 Ga0495582_0090937 3300046473 Bacteria 1702
368 Ga0495605_0075576 3300046474 Bacteria 1584
369 Ga0495662_0134123 3300046476 Bacteria 1218
370 Ga0495664_0000024 3300046477 Bacteria 126593
371 Ga0495584_0037506 3300046491 Unclassified 2450
372 Ga0495584_0144758 3300046491 Bacteria 1207
373 Ga0495584_0146791 3300046491 Bacteria 1198
374 Ga0495594_0011329 3300046499 Bacteria 4632
375 Ga0495608_0000004 3300046511 Bacteria 355027
376 Ga0495608_0125356 3300046511 Bacteria 1645
377 Ga0495608_0178717 3300046511 Bacteria 1343
378 Ga0495618_0000855 3300046514 Bacteria 21101
379 Ga0495618_0048645 3300046514 Bacteria 2677
380 Ga0495628_0000006 3300046516 Bacteria 306606
381 Ga0495628_0269556 3300046516 Bacteria 1267
382 Ga0495630_0000601 3300046517 Bacteria 26137
383 Ga0495630_0134886 3300046517 Bacteria 1876
384 Ga0495644_0019617 3300046523 Bacteria 2582
385 Ga0495652_0000038 3300046529 Bacteria 129311
386 Ga0495652_0124440 3300046529 Bacteria 2051
387 Ga0495665_0048609 3300046531 Bacteria 2249
388 Ga0495665_0181628 3300046531 Bacteria 1093
389 Ga0495640_0000013 3300046533 Bacteria 172438
390 Ga0495640_0056898 3300046533 Bacteria 2670
391 Ga0495586_0077474 3300046535 Bacteria 1823
392 Ga0495587_0000004 3300046536 Bacteria 358433
393 Ga0495587_0011398 3300046536 Bacteria 5636
394 Ga0495645_0000001 3300046543 Bacteria 657910
395 Ga0495633_0039898 3300046558 Bacteria 2239
396 Ga0495667_0000084 3300046559 Bacteria 67342
397 Ga0495667_0202172 3300046559 Bacteria 1271
398 Ga0495656_0019425 3300046615 Plasmid 2623
399 Ga0495656_0059217 3300046615 Bacteria 1665
400 Ga0495634_0000164 3300046642 Bacteria 60673
401 Ga0495634_0025446 3300046642 Bacteria 4140
402 Ga0495635_0000003 3300046663 Bacteria 390055
403 Ga0495635_0220189 3300046663 Bacteria 1284
404 Ga0495659_0046589 3300046664 Bacteria 1566
405 Ga0495661_0105762 3300046665 Bacteria 1576
406 Ga0495657_0000248 3300046675 Bacteria 49080
407 Ga0495657_0058759 3300046675 Bacteria 2552
408 Ga0495599_0000014 3300046678 Bacteria 177414
409 Ga0495623_0000015 3300046679 Bacteria 117329
410 Ga0495646_0000005 3300046680 Bacteria 266899
411 Ga0495613_0011799 3300046689 Bacteria 6490
412 Ga0495624_0113521 3300046690 Bacteria 1665
413 Ga0495589_0140084 3300046794 Bacteria 1159
414 Ga0495600_0000005 3300046809 Bacteria 171675
415 Ga0495600_0026577 3300046809 Bacteria 3736
416 Ga0495660_0145101 3300046810 Bacteria 1177
417 Ga0495581_0035116 3300047315 Bacteria 2901
418 Ga0495581_0101323 3300047315 Bacteria 1673
419 Ga0495604_0000002 3300047317 Bacteria 530904
420 Ga0495604_0050251 3300047317 Bacteria 3238
421 Ga0495674_0000004 3300047319 Bacteria 531855
422 Ga0495674_0167199 3300047319 Bacteria 1837
423 Ga0495672_0154403 3300047320 Bacteria 1187
424 Ga0495676_0086728 3300047321 Bacteria 2354
425 Ga0495680_0000142 3300047322 Bacteria 72324
426 Ga0495680_0006220 3300047322 Bacteria 11128
427 Ga0495675_0000053 3300047444 Bacteria 78760
428 Ga0495685_082661 3300047447 Bacteria 1069
429 Ga0495684_0000004 3300047471 Bacteria 307093
430 Ga0495593_0001399 3300047673 Bacteria 14116
431 Ga0495602_0000001 3300048088 Bacteria 510904
432 Ga0495602_0039913 3300048088 Bacteria 4315
433 Ga0495602_0130553 3300048088 Bacteria 2005
434 Ga0496100_0068911 3300048903 Bacteria 2354
435 Ga0496100_0089764 3300048903 Bacteria 2094
436 Ga0496100_0096916 3300048903 Bacteria 2024
437 Ga0496100_0159034 3300048903 Bacteria 1618
438 Ga0496101_0074509 3300048904 Bacteria 2496
439 Ga0496101_0076402 3300048904 Bacteria 2467
440 Ga0496101_0095218 3300048904 Bacteria 2221
441 Ga0496102_0030973 3300048905 Bacteria 4792
442 Ga0496102_0102351 3300048905 Bacteria 2662
443 Ga0496103_0021838 3300048906 Bacteria 3852
444 Ga0496103_0022327 3300048906 Bacteria 3810
445 Ga0496103_0115703 3300048906 Bacteria 1706
446 Ga0496104_0000778 3300048907 Bacteria 27299
447 Ga0496104_0004804 3300048907 Bacteria 11771
448 Ga0496104_0020957 3300048907 Bacteria 5996
449 Ga0496104_0175869 3300048907 Bacteria 2051
450 Ga0496104_0187123 3300048907 Bacteria 1981
451 Ga0496104_0202937 3300048907 Bacteria 1894
452 Ga0496105_0016531 3300048908 Bacteria 5892
453 Ga0496105_0051610 3300048908 Bacteria 3397
454 Ga0496105_0071122 3300048908 Bacteria 2876
455 Ga0496105_0089361 3300048908 Bacteria 2545
456 Ga0496105_0177211 3300048908 Bacteria 1746
457 Ga0496106_0009665 3300048909 Bacteria 7123
458 Ga0496106_0022495 3300048909 Bacteria 4684
459 Ga0496106_0041752 3300048909 Bacteria 3438
460 Ga0496106_0140498 3300048909 Bacteria 1899
461 Ga0496107_0010821 3300048910 Bacteria 6348
462 Ga0496107_0152874 3300048910 Bacteria 1708
463 Ga0496108_0003559 3300048911 Bacteria 12495
464 Ga0496108_0181836 3300048911 Bacteria 1821
465 Ga0496109_0001664 3300048912 Bacteria 18514
466 Ga0496109_0025511 3300048912 Bacteria 5267
467 Ga0496109_0052080 3300048912 Bacteria 3730
468 Ga0496109_0192627 3300048912 Bacteria 1916
469 Ga0496109_0302713 3300048912 Bacteria 1508
470 Ga0496110_0008663 3300048913 Bacteria 8191
471 Ga0496110_0055123 3300048913 Bacteria 3497
472 Ga0496110_0259462 3300048913 Bacteria 1582
473 Ga0496110_0265606 3300048913 Bacteria 1562
474 Ga0496111_0038752 3300048914 Bacteria 3415
475 Ga0496111_0056561 3300048914 Bacteria 2838
476 Ga0496111_0063984 3300048914 Bacteria 2668
477 Ga0496111_0099479 3300048914 Bacteria 2136
478 Ga0496112_0123197 3300048915 Bacteria 2563
479 Ga0496112_0124243 3300048915 Bacteria 2551
480 Ga0496112_0172695 3300048915 Bacteria 2127
481 Ga0496113_0001475 3300048916 Bacteria 13126
482 Ga0496113_0204792 3300048916 Bacteria 1569
483 Ga0496114_0007227 3300048917 Bacteria 8771
484 Ga0496114_0007386 3300048917 Bacteria 8684
485 Ga0496114_0134337 3300048917 Bacteria 2138
486 Ga0496115_0015056 3300048918 Bacteria 5862
487 Ga0496115_0126846 3300048918 Bacteria 2102
488 Ga0496115_0178949 3300048918 Bacteria 1753
489 Ga0496115_0235489 3300048918 Bacteria 1509
490 Ga0501031_0032599 3300049568 Bacteria 3397
491 Ga0501031_0239871 3300049568 Bacteria 1179
492 Ga0501032_0017659 3300049569 Bacteria 5007
493 Ga0501033_0043257 3300049570 Bacteria 3355
494 Ga0501034_0258739 3300049571 Bacteria 1684
495 Ga0501036_0003271 3300049572 Bacteria 12923
496 Ga0501036_0004299 3300049572 Bacteria 11505
497 Ga0501036_0134215 3300049572 Bacteria 2089
498 Ga0501037_0026706 3300049573 Bacteria 4266
499 Ga0501038_0001109 3300049574 Bacteria 24402
500 Ga0501038_0038044 3300049574 Bacteria 4214
501 Ga0501038_0065552 3300049574 Bacteria 3094
502 Ga0501039_0015991 3300049575 Bacteria 5745
503 Ga0501039_0092803 3300049575 Bacteria 2353
504 Ga0501040_0001909 3300049576 Bacteria 13402
505 Ga0501040_0026531 3300049576 Bacteria 3897
506 Ga0501041_0003730 3300049577 Bacteria 8760
507 Ga0501041_0137314 3300049577 Bacteria 1524
508 Ga0501041_0173652 3300049577 Unclassified 1349
509 Ga0501042_0000383 3300049578 Bacteria 22452
510 Ga0501043_0039655 3300049579 Bacteria 3701
511 Ga0501046_0001197 3300049580 Bacteria 25219
512 Ga0501046_0005257 3300049580 Bacteria 11575
513 Ga0501047_0131279 3300049581 Bacteria 2385
514 Ga0501047_0136435 3300049581 Bacteria 2334
515 Ga0501047_0192866 3300049581 Bacteria 1900
516 Ga0501048_0030146 3300049582 Bacteria 3927
517 Ga0501067_0047518 3300049583 Bacteria 2380
518 Ga0501068_0009855 3300049584 Bacteria 5352
519 Ga0501069_0001350 3300049585 Bacteria 12034
520 Ga0501070_0015678 3300049586 Bacteria 6370
521 Ga0501071_0011854 3300049587 Bacteria 5886
522 Ga0501071_0020152 3300049587 Bacteria 4633
523 Ga0501071_0030315 3300049587 Bacteria 3825
524 Ga0501071_0044594 3300049587 Bacteria 3181
525 Ga0501071_0184277 3300049587 Bacteria 1565
526 Ga0501072_0001948 3300049588 Bacteria 15375
527 Ga0501072_0002470 3300049588 Bacteria 13847
528 Ga0501072_0022536 3300049588 Bacteria 4884
529 Ga0501072_0102115 3300049588 Bacteria 2279
530 Ga0501072_0359785 3300049588 Bacteria 1155
531 Ga0501073_0064750 3300049589 Bacteria 2549
532 Ga0501073_0098535 3300049589 Bacteria 2030
533 Ga0501074_0014399 3300049590 Bacteria 5757
534 Ga0501075_0000525 3300049591 Bacteria 23161
535 Ga0501075_0004827 3300049591 Bacteria 9175
536 Ga0501075_0007402 3300049591 Bacteria 7617
537 Ga0501075_0263951 3300049591 Bacteria 1312
538 Ga0501076_0001958 3300049592 Bacteria 14062
539 Ga0501076_0013583 3300049592 Bacteria 6108
540 Ga0501076_0095303 3300049592 Bacteria 2397
541 Ga0501076_0257007 3300049592 Bacteria 1430
542 Ga0501077_0031416 3300049593 Bacteria 3378
543 Ga0501079_0000625 3300049741 Bacteria 23469
544 Ga0501079_0015914 3300049741 Bacteria 5748
545 Ga0501079_0018731 3300049741 Bacteria 5289
546 Ga0501079_0145992 3300049741 Bacteria 1843
547 Ga0501080_0054849 3300049742 Bacteria 3711
548 Ga0501080_0110457 3300049742 Bacteria 2548
549 Ga0501081_0000055 3300049743 Bacteria 43227
550 Ga0501081_0061523 3300049743 Bacteria 2603
551 Ga0501081_0322119 3300049743 Bacteria 1136
552 Ga0501083_0006890 3300049744 Bacteria 8069
553 Ga0501044_0000351 3300049823 Bacteria 57748
554 Ga0501044_0005311 3300049823 Bacteria 14327
555 Ga0501044_0049886 3300049823 Bacteria 4321
556 Ga0501044_0155218 3300049823 Bacteria 2269
557 Ga0501045_0000901 3300049824 Bacteria 19335
558 Ga0501045_0006242 3300049824 Bacteria 8246
559 Ga0501045_0015157 3300049824 Bacteria 5472
560 nmdc:mga03683_151558_c1 3300050489 Bacteria 1046
561 nmdc:mga03683_24348_c1 3300050489 Bacteria 2368
562 nmdc:mga03n38_26262_c1 3300050490 Bacteria 2403
563 nmdc:mga03n38_45095_c1 3300050490 Bacteria 1940
564 nmdc:mga03n38_59542_c1 3300050490 Bacteria 1734
565 nmdc:mga00v17_45378_c1 3300050491 Bacteria 2655
566 nmdc:mga00v17_7422_c1 3300050491 Bacteria 5850
567 nmdc:mga0yw44_100884_c1 3300050492 Bacteria 1839
568 nmdc:mga0yw44_78772_c1 3300050492 Bacteria 2061
569 nmdc:mga0k408_143465_c1 3300050493 Bacteria 1421
570 nmdc:mga0k408_153514_c1 3300050493 Bacteria 1371
571 nmdc:mga0k408_194752_c1 3300050493 Bacteria 1210
572 nmdc:mga06z11_272209_c1 3300050494 Bacteria 1001
573 nmdc:mga06z11_42366_c1 3300050494 Bacteria 2283
574 nmdc:mga05p37_223_c1 3300050507 Bacteria 57418
575 nmdc:mga05p37_325786_c1 3300050507 Bacteria 1817
576 nmdc:mga05p37_46700_c1 3300050507 Bacteria 5324
577 nmdc:mga05p37_540137_c1 3300050507 Bacteria 1329
578 nmdc:mga05p37_56359_c1 3300050507 Bacteria 4838
579 nmdc:mga05p37_589816_c1 3300050507 Bacteria 1257
580 nmdc:mga09592_135171_c1 3300050508 Bacteria 2123
581 nmdc:mga09592_14238_c1 3300050508 Bacteria 6493
582 nmdc:mga09592_152742_c1 3300050508 Bacteria 1992
583 nmdc:mga09592_17457_c1 3300050508 Bacteria 5880
584 nmdc:mga09592_27300_c1 3300050508 Bacteria 4737
585 nmdc:mga09592_7453_c1 3300050508 Bacteria 8891
586 nmdc:mga09592_8032_c1 3300050508 Bacteria 8581
587 nmdc:mga09592_83861_c1 3300050508 Bacteria 2717
588 nmdc:mga09592_84627_c1 3300050508 Bacteria 2704
589 nmdc:mga09592_9213_c1 3300050508 Bacteria 8030
590 nmdc:mga0qj67_11276_c1 3300050509 Bacteria 6694
591 nmdc:mga0qj67_1416_c1 3300050509 Bacteria 16782
592 nmdc:mga0qj67_14241_c1 3300050509 Bacteria 6011
593 nmdc:mga0qj67_16218_c1 3300050509 Bacteria 5646
594 nmdc:mga0qj67_3966_c1 3300050509 Bacteria 10709
595 nmdc:mga06r32_1449_c1 3300050510 Bacteria 21429
596 nmdc:mga06r32_17056_c1 3300050510 Bacteria 6627
597 nmdc:mga06r32_210759_c1 3300050510 Bacteria 1931
598 nmdc:mga06r32_39246_c1 3300050510 Bacteria 4492
599 nmdc:mga08y16_118764_c1 3300050511 Bacteria 2752
600 nmdc:mga08y16_5989_c1 3300050511 Bacteria 12747
601 nmdc:mga08y16_813_c1 3300050511 Bacteria 29890
602 nmdc:mga0n895_63420_c1 3300050512 Bacteria 3654
603 nmdc:mga0n895_73026_c1 3300050512 Bacteria 3405
604 nmdc:mga0rr50_134532_c1 3300050513 Bacteria 1983
605 nmdc:mga0rr50_244815_c1 3300050513 Bacteria 1487
606 nmdc:mga0a205_12766_c1 3300050515 Bacteria 7789
607 nmdc:mga0a205_62538_c1 3300050515 Bacteria 3596
608 nmdc:mga0sz30_28053_c1 3300050516 Bacteria 2315
609 Ga0495601_0000026 3300053077 Bacteria 126257
610 Ga0495601_0002532 3300053077 Bacteria 10391
611 Ga0495601_0284322 3300053077 Bacteria 1078
612 Ga0495612_0000005 3300053078 Bacteria 286943
613 Ga0495655_0074377 3300053083 Bacteria 957
614 Ga0495595_0000065 3300053084 Bacteria 52635
615 Ga0495595_0054768 3300053084 Bacteria 1855
616 Ga0495619_0000003 3300053085 Bacteria 515784
617 Ga0495619_0006125 3300053085 Bacteria 7619
618 Ga0495619_0042256 3300053085 Bacteria 2984
619 Ga0495619_0047217 3300053085 Bacteria 2835
620 Ga0495619_0050494 3300053085 Bacteria 2746
621 Ga0495619_0078690 3300053085 Bacteria 2217
622 Ga0500643_000795 3300053087 Bacteria 20468
623 Ga0500562_025786 3300053108 Bacteria 1540
624 Ga0500595_000001 3300053119 Bacteria 1088438
625 Ga0500595_042929 3300053119 Bacteria 1443
626 Ga0500642_0055327 3300053130 Bacteria 1765
627 Ga0500658_0059366 3300053134 Bacteria 1587
628 Ga0500616_0111110 3300053153 Bacteria 1323
629 Ga0501084_0002498 3300054114 Bacteria 14797
630 Ga0501084_0029050 3300054114 Bacteria 4624
631 Ga0501084_0033744 3300054114 Bacteria 4281
632 Ga0501084_0073459 3300054114 Bacteria 2864
633 Ga0501084_0106624 3300054114 Bacteria 2354
634 Ga0501084_0110965 3300054114 Bacteria 2305
635 Ga0501084_0187481 3300054114 Bacteria 1745
636 Ga0501082_0000013 3300060353 Bacteria 119623
637 Ga0501082_0008950 3300060353 Bacteria 8640
638 Ga0501082_0029062 3300060353 Bacteria 4762
639 Ga0501082_0046577 3300060353 Bacteria 3737
640 Ga0501082_0086514 3300060353 Bacteria 2704
641 Ga0501082_0147560 3300060353 Bacteria 2042
642 Ga0501082_0173806 3300060353 Bacteria 1873
643 Ga0530510_0001004 3300061734 Bacteria 18744
644 Ga0530510_0028198 3300061734 Bacteria 4026
645 Ga0530510_0055810 3300061734 Bacteria 2853
646 Ga0530510_0094400 3300061734 Bacteria 2185

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005455 Ga0070663_100229800 Ga0070663_1002298002 286
2 3300035692 Ga0373935_0072350 Ga0373935_0072350_21_893 289
3 3300049590 Ga0501074_0014399 Ga0501074_0014399_4852_5733 289
4 3300049743 Ga0501081_0061523 Ga0501081_0061523_24_899 290
5 3300053083 Ga0495655_0074377 Ga0495655_0074377_71_946 291
6 3300005340 Ga0070689_100030900 Ga0070689_1000309004 293
7 3300005355 Ga0070671_100111507 Ga0070671_1001115071 293
8 3300006177 Ga0075362_10055847 Ga0075362_100558472 293
9 3300009148 Ga0105243_10108404 Ga0105243_101084042 293
10 3300009176 Ga0105242_10049576 Ga0105242_100495763 293
11 3300009177 Ga0105248_10030282 Ga0105248_100302825 293
12 3300013306 Ga0163162_10306838 Ga0163162_103068382 293
13 3300013308 Ga0157375_10882193 Ga0157375_108821931 293
14 3300014326 Ga0157380_10223784 Ga0157380_102237842 293
15 3300014326 Ga0157380_10392092 Ga0157380_103920921 293
16 3300025901 Ga0207688_10001481 Ga0207688_100014812 293
17 3300025907 Ga0207645_10022680 Ga0207645_100226804 293
18 3300025923 Ga0207681_10126196 Ga0207681_101261962 293
19 3300026095 Ga0207676_10122216 Ga0207676_101222162 293
20 3300035242 Ga0373962_0012862 Ga0373962_0012862_751_1725 293
21 3300035691 Ga0373931_0069082 Ga0373931_0069082_119_1093 293
22 3300048903 Ga0496100_0089764 Ga0496100_0089764_626_1600 293
23 3300048908 Ga0496105_0177211 Ga0496105_0177211_104_1078 293
24 3300048910 Ga0496107_0152874 Ga0496107_0152874_611_1585 293
25 3300048914 Ga0496111_0099479 Ga0496111_0099479_48_1022 293
26 3300048915 Ga0496112_0123197 Ga0496112_0123197_735_1709 293
27 3300048917 Ga0496114_0007386 Ga0496114_0007386_3894_4868 293
28 3300048918 Ga0496115_0178949 Ga0496115_0178949_230_1204 293
29 3300050489 nmdc:mga03683_151558_c1 nmdc:mga03683_151558_c1_31_1014 293
30 3300005338 Ga0068868_100278749 Ga0068868_1002787492 296
31 3300005353 Ga0070669_100145768 Ga0070669_1001457682 296
32 3300005355 Ga0070671_100075882 Ga0070671_1000758822 296
33 3300005367 Ga0070667_100024257 Ga0070667_1000242573 296
34 3300005456 Ga0070678_100170885 Ga0070678_1001708851 296
35 3300005543 Ga0070672_100062522 Ga0070672_1000625223 296
36 3300005618 Ga0068864_100018958 Ga0068864_1000189583 296
37 3300006358 Ga0068871_100013831 Ga0068871_1000138314 296
38 3300009147 Ga0114129_10836592 Ga0114129_108365921 296
39 3300014969 Ga0157376_10066864 Ga0157376_100668643 296
40 3300025923 Ga0207681_10045506 Ga0207681_100455062 296
41 3300005295 Ga0065707_10127840 Ga0065707_101278402 297
42 3300005364 Ga0070673_100091157 Ga0070673_1000911572 297
43 3300006038 Ga0075365_10223467 Ga0075365_102234672 297
44 3300006042 Ga0075368_10007461 Ga0075368_100074612 297
45 3300006177 Ga0075362_10038928 Ga0075362_100389282 297
46 3300006186 Ga0075369_10058854 Ga0075369_100588542 297
47 3300009553 Ga0105249_10661184 Ga0105249_106611842 297
48 3300025315 Ga0207697_10078734 Ga0207697_100787342 297
49 3300049592 Ga0501076_0257007 Ga0501076_0257007_94_1047 297
50 3300050490 nmdc:mga03n38_45095_c1 nmdc:mga03n38_45095_c1_178_1155 297
51 3300050490 nmdc:mga03n38_59542_c1 nmdc:mga03n38_59542_c1_374_1351 297
52 3300050491 nmdc:mga00v17_7422_c1 nmdc:mga00v17_7422_c1_4776_5753 297
53 3300050493 nmdc:mga0k408_194752_c1 nmdc:mga0k408_194752_c1_65_1054 297
54 3300050516 nmdc:mga0sz30_28053_c1 nmdc:mga0sz30_28053_c1_695_1672 297
55 3300053108 Ga0500562_025786 Ga0500562_025786_149_1141 297
56 3300054114 Ga0501084_0110965 Ga0501084_0110965_949_1920 297
57 3300005547 Ga0070693_100188318 Ga0070693_1001883181 298
58 3300005981 Ga0081538_10037286 Ga0081538_100372862 298
59 3300006844 Ga0075428_100143852 Ga0075428_1001438521 298
60 3300009147 Ga0114129_10025557 Ga0114129_100255576 298
61 3300009174 Ga0105241_10163927 Ga0105241_101639272 298
62 3300049577 Ga0501041_0173652 Ga0501041_0173652_379_1332 298
63 3300050507 nmdc:mga05p37_46700_c1 nmdc:mga05p37_46700_c1_1073_2083 298
64 3300053119 Ga0500595_042929 Ga0500595_042929_343_1320 298
65 3300005983 Ga0081540_1001200 Ga0081540_10012006 299
66 3300006844 Ga0075428_100401542 Ga0075428_1004015421 299
67 3300009147 Ga0114129_10087647 Ga0114129_100876472 299
68 3300009147 Ga0114129_10100816 Ga0114129_101008163 299
69 3300027682 Ga0209971_1001897 Ga0209971_10018972 299
70 3300027695 Ga0209966_1003426 Ga0209966_10034264 299
71 3300042001 Ga0439441_002576 Ga0439441_002576_991_1968 299
72 3300042003 Ga0439443_004187 Ga0439443_004187_378_1355 299
73 3300046473 Ga0495582_0082076 Ga0495582_0082076_118_1062 299
74 3300046491 Ga0495584_0146791 Ga0495584_0146791_161_1063 299
75 3300046664 Ga0495659_0046589 Ga0495659_0046589_30_932 299
76 3300049592 Ga0501076_0001958 Ga0501076_0001958_2385_3356 299
77 3300049741 Ga0501079_0145992 Ga0501079_0145992_719_1690 299
78 3300050508 nmdc:mga09592_7453_c1 nmdc:mga09592_7453_c1_5218_6120 299
79 3300054114 Ga0501084_0187481 Ga0501084_0187481_130_1101 299
80 3300028577 Ga0265318_10041305 Ga0265318_100413053 300
81 3300031235 Ga0265330_10020279 Ga0265330_100202792 300
82 3300031241 Ga0265325_10008016 Ga0265325_100080166 300
83 3300031247 Ga0265340_10020870 Ga0265340_100208703 300
84 3300031249 Ga0265339_10071657 Ga0265339_100716572 300
85 3300006880 Ga0075429_100165815 Ga0075429_1001658152 301
86 3300009147 Ga0114129_10381487 Ga0114129_103814872 301
87 3300050508 nmdc:mga09592_17457_c1 nmdc:mga09592_17457_c1_3317_4291 301
88 3300005530 Ga0070679_100264309 Ga0070679_1002643091 302
89 3300025921 Ga0207652_10170343 Ga0207652_101703432 302
90 3300046491 Ga0495584_0144758 Ga0495584_0144758_57_1001 302
91 3300049570 Ga0501033_0043257 Ga0501033_0043257_177_1148 302
92 3300049576 Ga0501040_0026531 Ga0501040_0026531_1104_2075 302
93 3300049591 Ga0501075_0007402 Ga0501075_0007402_6419_7390 302
94 3300049823 Ga0501044_0155218 Ga0501044_0155218_12_980 302
95 3300060353 Ga0501082_0029062 Ga0501082_0029062_116_1087 302
96 3300061734 Ga0530510_0055810 Ga0530510_0055810_1548_2519 302
97 3300005329 Ga0070683_100310475 Ga0070683_1003104752 303
98 3300005328 Ga0070676_10031436 Ga0070676_100314362 304
99 3300005330 Ga0070690_100023376 Ga0070690_1000233763 304
100 3300005340 Ga0070689_100071554 Ga0070689_1000715542 304
101 3300005347 Ga0070668_100235344 Ga0070668_1002353442 304
102 3300005355 Ga0070671_100069285 Ga0070671_1000692851 304
103 3300005457 Ga0070662_100100583 Ga0070662_1001005832 304
104 3300005459 Ga0068867_100185278 Ga0068867_1001852782 304
105 3300005578 Ga0068854_100289669 Ga0068854_1002896691 304
106 3300005615 Ga0070702_100120695 Ga0070702_1001206952 304
107 3300005841 Ga0068863_100107054 Ga0068863_1001070542 304
108 3300006028 Ga0070717_10145746 Ga0070717_101457461 304
109 3300006881 Ga0068865_100081952 Ga0068865_1000819522 304
110 3300009094 Ga0111539_10097638 Ga0111539_100976382 304
111 3300009148 Ga0105243_10076587 Ga0105243_100765872 304
112 3300009176 Ga0105242_10386853 Ga0105242_103868531 304
113 3300009553 Ga0105249_10244064 Ga0105249_102440641 304
114 3300011119 Ga0105246_10178276 Ga0105246_101782762 304
115 3300014325 Ga0163163_10168951 Ga0163163_101689511 304
116 3300014969 Ga0157376_10081402 Ga0157376_100814022 304
117 3300025315 Ga0207697_10007537 Ga0207697_100075374 304
118 3300025893 Ga0207682_10014593 Ga0207682_100145932 304
119 3300025903 Ga0207680_10035408 Ga0207680_100354082 304
120 3300025933 Ga0207706_10074680 Ga0207706_100746802 304
121 3300025934 Ga0207686_10124359 Ga0207686_101243592 304
122 3300025942 Ga0207689_10054189 Ga0207689_100541893 304
123 3300026075 Ga0207708_10025614 Ga0207708_100256143 304
124 3300026089 Ga0207648_10124461 Ga0207648_101244611 304
125 3300026121 Ga0207683_10167096 Ga0207683_101670961 304
126 3300028577 Ga0265318_10006909 Ga0265318_100069092 304
127 3300031238 Ga0265332_10004771 Ga0265332_100047713 304
128 3300031239 Ga0265328_10017370 Ga0265328_100173702 304
129 3300031242 Ga0265329_10032809 Ga0265329_100328092 304
130 3300031250 Ga0265331_10000872 Ga0265331_100008722 304
131 3300031711 Ga0265314_10002632 Ga0265314_1000263217 304
132 3300031712 Ga0265342_10055983 Ga0265342_100559831 304
133 3300042156 Ga0439446_0031443 Ga0439446_0031443_221_1165 304
134 3300046511 Ga0495608_0125356 Ga0495608_0125356_326_1291 304
135 3300046516 Ga0495628_0269556 Ga0495628_0269556_23_1003 304
136 3300048088 Ga0495602_0130553 Ga0495602_0130553_853_1833 304
137 3300005439 Ga0070711_100188084 Ga0070711_1001880842 305
138 3300006844 Ga0075428_100002569 Ga0075428_1000025697 305
139 3300006880 Ga0075429_100007197 Ga0075429_10000719712 305
140 3300007076 Ga0075435_100222802 Ga0075435_1002228022 305
141 3300009094 Ga0111539_10000584 Ga0111539_1000058419 305
142 3300009147 Ga0114129_10189803 Ga0114129_101898033 305
143 3300010159 Ga0099796_10001693 Ga0099796_100016933 305
144 3300027378 Ga0209981_1000108 Ga0209981_10001089 305
145 3300027462 Ga0210000_1001906 Ga0210000_10019062 305
146 3300027526 Ga0209968_1002752 Ga0209968_10027522 305
147 3300027543 Ga0209999_1001768 Ga0209999_10017682 305
148 3300027614 Ga0209970_1016912 Ga0209970_10169121 305
149 3300037418 Ga0395900_0001925 Ga0395900_0001925_12697_13668 305
150 3300047673 Ga0495593_0001399 Ga0495593_0001399_336_1298 305
151 3300050508 nmdc:mga09592_27300_c1 nmdc:mga09592_27300_c1_2910_3893 305
152 3300050511 nmdc:mga08y16_813_c1 nmdc:mga08y16_813_c1_9790_10773 305
153 3300050513 nmdc:mga0rr50_244815_c1 nmdc:mga0rr50_244815_c1_373_1356 305
154 3300060353 Ga0501082_0000013 Ga0501082_0000013_38772_39731 305
155 3300005340 Ga0070689_100052061 Ga0070689_1000520612 306
156 3300005458 Ga0070681_10367590 Ga0070681_103675901 306
157 3300005468 Ga0070707_100565696 Ga0070707_1005656961 306
158 3300005471 Ga0070698_100121843 Ga0070698_1001218433 306
159 3300005937 Ga0081455_10026170 Ga0081455_100261705 306
160 3300005981 Ga0081538_10001564 Ga0081538_1000156419 306
161 3300005981 Ga0081538_10058508 Ga0081538_100585083 306
162 3300005983 Ga0081540_1037669 Ga0081540_10376693 306
163 3300006048 Ga0075363_100004161 Ga0075363_1000041613 306
164 3300006051 Ga0075364_10011898 Ga0075364_100118985 306
165 3300006177 Ga0075362_10001383 Ga0075362_100013837 306
166 3300006846 Ga0075430_100007026 Ga0075430_1000070266 306
167 3300006846 Ga0075430_100067686 Ga0075430_1000676862 306
168 3300006847 Ga0075431_100031216 Ga0075431_1000312164 306
169 3300006880 Ga0075429_100021973 Ga0075429_1000219735 306
170 3300006880 Ga0075429_100036588 Ga0075429_1000365884 306
171 3300009551 Ga0105238_10372598 Ga0105238_103725982 306
172 3300021384 Ga0213876_10104694 Ga0213876_101046942 306
173 3300025912 Ga0207707_10303982 Ga0207707_103039821 306
174 3300025917 Ga0207660_10094826 Ga0207660_100948262 306
175 3300025936 Ga0207670_10099004 Ga0207670_100990042 306
176 3300028800 Ga0265338_10256976 Ga0265338_102569762 306
177 3300031241 Ga0265325_10001522 Ga0265325_1000152214 306
178 3300031241 Ga0265325_10047880 Ga0265325_100478803 306
179 3300031247 Ga0265340_10009642 Ga0265340_100096422 306
180 3300035117 Ga0373953_0031612 Ga0373953_0031612_33_998 306
181 3300035118 Ga0373954_0057652 Ga0373954_0057652_150_1115 306
182 3300035120 Ga0373957_0004052 Ga0373957_0004052_2516_3481 306
183 3300035172 Ga0373955_0003218 Ga0373955_0003218_5981_6946 306
184 3300035724 Ga0373933_0000591 Ga0373933_0000591_3799_4764 306
185 3300036401 Ga0373937_0006142 Ga0373937_0006142_2959_3924 306
186 3300037418 Ga0395900_0029817 Ga0395900_0029817_1621_2571 306
187 3300037853 Ga0436364_1380890 Ga0436364_1380890_1001_1960 306
188 3300038443 Ga0395901_0041809 Ga0395901_0041809_396_1346 306
189 3300039437 Ga0436365_1075974 Ga0436365_1075974_1491_2450 306
190 3300046462 Ga0495651_0028258 Ga0495651_0028258_1556_2521 306
191 3300046463 Ga0495653_0041065 Ga0495653_0041065_2265_3335 306
192 3300046511 Ga0495608_0178717 Ga0495608_0178717_61_1026 306
193 3300046529 Ga0495652_0124440 Ga0495652_0124440_96_1061 306
194 3300046536 Ga0495587_0011398 Ga0495587_0011398_1891_2856 306
195 3300046559 Ga0495667_0202172 Ga0495667_0202172_278_1243 306
196 3300046615 Ga0495656_0059217 Ga0495656_0059217_399_1376 306
197 3300046675 Ga0495657_0058759 Ga0495657_0058759_1251_2216 306
198 3300046809 Ga0495600_0026577 Ga0495600_0026577_424_1389 306
199 3300047317 Ga0495604_0050251 Ga0495604_0050251_917_1987 306
200 3300047322 Ga0495680_0006220 Ga0495680_0006220_6443_7408 306
201 3300048088 Ga0495602_0039913 Ga0495602_0039913_1878_2843 306
202 3300048907 Ga0496104_0175869 Ga0496104_0175869_149_1108 306
203 3300049571 Ga0501034_0258739 Ga0501034_0258739_624_1595 306
204 3300049574 Ga0501038_0065552 Ga0501038_0065552_67_1017 306
205 3300049577 Ga0501041_0137314 Ga0501041_0137314_66_1031 306
206 3300049581 Ga0501047_0192866 Ga0501047_0192866_40_990 306
207 3300049587 Ga0501071_0184277 Ga0501071_0184277_421_1389 306
208 3300049588 Ga0501072_0001948 Ga0501072_0001948_6105_7091 306
209 3300049588 Ga0501072_0022536 Ga0501072_0022536_401_1366 306
210 3300049588 Ga0501072_0102115 Ga0501072_0102115_517_1488 306
211 3300049591 Ga0501075_0263951 Ga0501075_0263951_66_1031 306
212 3300049741 Ga0501079_0018731 Ga0501079_0018731_2253_3218 306
213 3300049823 Ga0501044_0005311 Ga0501044_0005311_4276_5226 306
214 3300050489 nmdc:mga03683_24348_c1 nmdc:mga03683_24348_c1_203_1153 306
215 3300050490 nmdc:mga03n38_26262_c1 nmdc:mga03n38_26262_c1_20_970 306
216 3300050491 nmdc:mga00v17_45378_c1 nmdc:mga00v17_45378_c1_1615_2565 306
217 3300050494 nmdc:mga06z11_42366_c1 nmdc:mga06z11_42366_c1_419_1369 306
218 3300050507 nmdc:mga05p37_589816_c1 nmdc:mga05p37_589816_c1_200_1177 306
219 3300050508 nmdc:mga09592_14238_c1 nmdc:mga09592_14238_c1_402_1370 306
220 3300050509 nmdc:mga0qj67_11276_c1 nmdc:mga0qj67_11276_c1_3785_4753 306
221 3300050509 nmdc:mga0qj67_14241_c1 nmdc:mga0qj67_14241_c1_229_1206 306
222 3300050509 nmdc:mga0qj67_3966_c1 nmdc:mga0qj67_3966_c1_3547_4509 306
223 3300050510 nmdc:mga06r32_210759_c1 nmdc:mga06r32_210759_c1_31_999 306
224 3300050510 nmdc:mga06r32_39246_c1 nmdc:mga06r32_39246_c1_3290_4267 306
225 3300050511 nmdc:mga08y16_118764_c1 nmdc:mga08y16_118764_c1_330_1286 306
226 3300053077 Ga0495601_0002532 Ga0495601_0002532_5422_6387 306
227 3300053085 Ga0495619_0006125 Ga0495619_0006125_364_1329 306
228 3300054114 Ga0501084_0029050 Ga0501084_0029050_3028_3993 306
229 3300054114 Ga0501084_0106624 Ga0501084_0106624_372_1340 306
230 3300060353 Ga0501082_0086514 Ga0501082_0086514_562_1533 306
231 3300060353 Ga0501082_0147560 Ga0501082_0147560_917_1888 306
232 3300060353 Ga0501082_0173806 Ga0501082_0173806_421_1386 306
233 3300061734 Ga0530510_0094400 Ga0530510_0094400_978_1949 306
234 2162886007 SwRhRL2b_contig_619028 SwRhRL2b_0043.00003980 307
235 3300001990 JGI24737J22298_10035475 JGI24737J22298_100354751 307
236 3300002077 JGI24744J21845_10010458 JGI24744J21845_100104582 307
237 3300002244 JGI24742J22300_10002855 JGI24742J22300_100028552 307
238 3300005327 Ga0070658_10017811 Ga0070658_100178112 307
239 3300005329 Ga0070683_100160876 Ga0070683_1001608762 307
240 3300005334 Ga0068869_100200157 Ga0068869_1002001572 307
241 3300005336 Ga0070680_100052166 Ga0070680_1000521663 307
242 3300005338 Ga0068868_100050930 Ga0068868_1000509303 307
243 3300005340 Ga0070689_100030900 Ga0070689_1000309003 307
244 3300005340 Ga0070689_100057601 Ga0070689_1000576011 307
245 3300005343 Ga0070687_100018341 Ga0070687_1000183413 307
246 3300005344 Ga0070661_100227023 Ga0070661_1002270231 307
247 3300005345 Ga0070692_10132326 Ga0070692_101323262 307
248 3300005347 Ga0070668_100031290 Ga0070668_1000312902 307
249 3300005353 Ga0070669_100088741 Ga0070669_1000887412 307
250 3300005353 Ga0070669_100185492 Ga0070669_1001854922 307
251 3300005354 Ga0070675_100023649 Ga0070675_1000236492 307
252 3300005355 Ga0070671_100014076 Ga0070671_1000140763 307
253 3300005355 Ga0070671_100111507 Ga0070671_1001115072 307
254 3300005356 Ga0070674_100007137 Ga0070674_1000071373 307
255 3300005364 Ga0070673_100044391 Ga0070673_1000443911 307
256 3300005364 Ga0070673_100502695 Ga0070673_1005026951 307
257 3300005366 Ga0070659_100280320 Ga0070659_1002803202 307
258 3300005435 Ga0070714_100069870 Ga0070714_1000698702 307
259 3300005435 Ga0070714_100223682 Ga0070714_1002236822 307
260 3300005436 Ga0070713_100158006 Ga0070713_1001580062 307
261 3300005437 Ga0070710_10079388 Ga0070710_100793882 307
262 3300005438 Ga0070701_10014707 Ga0070701_100147072 307
263 3300005439 Ga0070711_100048441 Ga0070711_1000484414 307
264 3300005440 Ga0070705_100080566 Ga0070705_1000805662 307
265 3300005444 Ga0070694_100002295 Ga0070694_10000229511 307
266 3300005444 Ga0070694_100009395 Ga0070694_1000093953 307
267 3300005457 Ga0070662_100155736 Ga0070662_1001557362 307
268 3300005458 Ga0070681_10043120 Ga0070681_100431202 307
269 3300005459 Ga0068867_100082922 Ga0068867_1000829223 307
270 3300005466 Ga0070685_10034266 Ga0070685_100342661 307
271 3300005471 Ga0070698_100121843 Ga0070698_1001218432 307
272 3300005471 Ga0070698_100138733 Ga0070698_1001387332 307
273 3300005530 Ga0070679_100017610 Ga0070679_1000176104 307
274 3300005530 Ga0070679_100087553 Ga0070679_1000875533 307
275 3300005535 Ga0070684_100086057 Ga0070684_1000860571 307
276 3300005539 Ga0068853_100096262 Ga0068853_1000962622 307
277 3300005544 Ga0070686_100015684 Ga0070686_1000156844 307
278 3300005544 Ga0070686_100102156 Ga0070686_1001021562 307
279 3300005545 Ga0070695_100003529 Ga0070695_1000035293 307
280 3300005546 Ga0070696_100058527 Ga0070696_1000585272 307
281 3300005548 Ga0070665_100132337 Ga0070665_1001323373 307
282 3300005549 Ga0070704_100022251 Ga0070704_1000222513 307
283 3300005549 Ga0070704_100072294 Ga0070704_1000722942 307
284 3300005578 Ga0068854_100026877 Ga0068854_1000268774 307
285 3300005615 Ga0070702_100190426 Ga0070702_1001904261 307
286 3300005616 Ga0068852_100106108 Ga0068852_1001061082 307
287 3300005617 Ga0068859_100054576 Ga0068859_1000545763 307
288 3300005617 Ga0068859_100102424 Ga0068859_1001024242 307
289 3300005618 Ga0068864_100036891 Ga0068864_1000368911 307
290 3300005840 Ga0068870_10250354 Ga0068870_102503541 307
291 3300005842 Ga0068858_100025413 Ga0068858_1000254133 307
292 3300005937 Ga0081455_10000669 Ga0081455_100006693 307
293 3300005937 Ga0081455_10010322 Ga0081455_100103227 307
294 3300005937 Ga0081455_10026170 Ga0081455_100261704 307
295 3300005985 Ga0081539_10001356 Ga0081539_1000135626 307
296 3300006038 Ga0075365_10075461 Ga0075365_100754613 307
297 3300006175 Ga0070712_100002654 Ga0070712_1000026549 307
298 3300006175 Ga0070712_100056890 Ga0070712_1000568902 307
299 3300006177 Ga0075362_10082246 Ga0075362_100822461 307
300 3300006178 Ga0075367_10091905 Ga0075367_100919052 307
301 3300006195 Ga0075366_10097792 Ga0075366_100977922 307
302 3300006358 Ga0068871_100100950 Ga0068871_1001009502 307
303 3300006844 Ga0075428_100011624 Ga0075428_1000116245 307
304 3300006844 Ga0075428_100057483 Ga0075428_1000574833 307
305 3300006844 Ga0075428_100075150 Ga0075428_1000751503 307
306 3300006844 Ga0075428_100358587 Ga0075428_1003585872 307
307 3300006846 Ga0075430_100000063 Ga0075430_10000006352 307
308 3300006846 Ga0075430_100046155 Ga0075430_1000461553 307
309 3300006847 Ga0075431_100001682 Ga0075431_10000168211 307
310 3300006847 Ga0075431_100012395 Ga0075431_1000123956 307
311 3300006847 Ga0075431_100160476 Ga0075431_1001604763 307
312 3300006871 Ga0075434_100027816 Ga0075434_1000278164 307
313 3300006871 Ga0075434_100046120 Ga0075434_1000461203 307
314 3300006871 Ga0075434_100321966 Ga0075434_1003219662 307
315 3300006880 Ga0075429_100005500 Ga0075429_1000055005 307
316 3300006880 Ga0075429_100023196 Ga0075429_1000231966 307
317 3300006880 Ga0075429_100198236 Ga0075429_1001982362 307
318 3300006880 Ga0075429_100364929 Ga0075429_1003649292 307
319 3300006881 Ga0068865_100095941 Ga0068865_1000959412 307
320 3300006931 Ga0097620_100054576 Ga0097620_1000545763 307
321 3300006931 Ga0097620_100102422 Ga0097620_1001024223 307
322 3300007076 Ga0075435_100029006 Ga0075435_1000290063 307
323 3300007265 Ga0099794_10059093 Ga0099794_100590932 307
324 3300009036 Ga0105244_10045377 Ga0105244_100453773 307
325 3300009094 Ga0111539_10002420 Ga0111539_1000242017 307
326 3300009094 Ga0111539_10004295 Ga0111539_1000429510 307
327 3300009094 Ga0111539_10038151 Ga0111539_100381512 307
328 3300009094 Ga0111539_10192490 Ga0111539_101924902 307
329 3300009101 Ga0105247_10013222 Ga0105247_100132223 307
330 3300009101 Ga0105247_10114666 Ga0105247_101146663 307
331 3300009147 Ga0114129_10000199 Ga0114129_1000019967 307
332 3300009147 Ga0114129_10005299 Ga0114129_100052996 307
333 3300009148 Ga0105243_10032485 Ga0105243_100324853 307
334 3300009148 Ga0105243_10108404 Ga0105243_101084041 307
335 3300009177 Ga0105248_10030282 Ga0105248_100302826 307
336 3300009551 Ga0105238_10267876 Ga0105238_102678763 307
337 3300009551 Ga0105238_10421118 Ga0105238_104211181 307
338 3300009553 Ga0105249_10006518 Ga0105249_100065183 307
339 3300010159 Ga0099796_10079742 Ga0099796_100797421 307
340 3300010375 Ga0105239_10049040 Ga0105239_100490402 307
341 3300010375 Ga0105239_10204024 Ga0105239_102040243 307
342 3300011119 Ga0105246_10053542 Ga0105246_100535422 307
343 3300013297 Ga0157378_10232713 Ga0157378_102327132 307
344 3300013306 Ga0163162_10055029 Ga0163162_100550292 307
345 3300013308 Ga0157375_10001521 Ga0157375_1000152117 307
346 3300014325 Ga0163163_10004477 Ga0163163_100044777 307
347 3300014325 Ga0163163_10246646 Ga0163163_102466461 307
348 3300014326 Ga0157380_10071822 Ga0157380_100718222 307
349 3300025297 Ga0209758_1002417 Ga0209758_100241716 307
350 3300025302 Ga0207426_1025911 Ga0207426_10259112 307
351 3300025901 Ga0207688_10007736 Ga0207688_100077365 307
352 3300025904 Ga0207647_10052730 Ga0207647_100527302 307
353 3300025907 Ga0207645_10022680 Ga0207645_100226803 307
354 3300025907 Ga0207645_10025867 Ga0207645_100258672 307
355 3300025908 Ga0207643_10002578 Ga0207643_100025788 307
356 3300025915 Ga0207693_10033141 Ga0207693_100331416 307
357 3300025915 Ga0207693_10037884 Ga0207693_100378841 307
358 3300025918 Ga0207662_10021624 Ga0207662_100216243 307
359 3300025918 Ga0207662_10098580 Ga0207662_100985801 307
360 3300025919 Ga0207657_10033671 Ga0207657_100336712 307
361 3300025920 Ga0207649_10101541 Ga0207649_101015412 307
362 3300025921 Ga0207652_10004363 Ga0207652_1000436310 307
363 3300025921 Ga0207652_10229354 Ga0207652_102293542 307
364 3300025924 Ga0207694_10181188 Ga0207694_101811882 307
365 3300025925 Ga0207650_10068470 Ga0207650_100684703 307
366 3300025925 Ga0207650_10106387 Ga0207650_101063872 307
367 3300025927 Ga0207687_10041231 Ga0207687_100412312 307
368 3300025928 Ga0207700_10370219 Ga0207700_103702191 307
369 3300025931 Ga0207644_10096541 Ga0207644_100965412 307
370 3300025932 Ga0207690_10071916 Ga0207690_100719162 307
371 3300025933 Ga0207706_10255904 Ga0207706_102559042 307
372 3300025934 Ga0207686_10083504 Ga0207686_100835042 307
373 3300025936 Ga0207670_10085017 Ga0207670_100850173 307
374 3300025937 Ga0207669_10009105 Ga0207669_100091055 307
375 3300025940 Ga0207691_10077916 Ga0207691_100779162 307
376 3300025941 Ga0207711_10057574 Ga0207711_100575742 307
377 3300025941 Ga0207711_10159172 Ga0207711_101591722 307
378 3300025942 Ga0207689_10052814 Ga0207689_100528141 307
379 3300025981 Ga0207640_10018223 Ga0207640_100182233 307
380 3300025986 Ga0207658_10091749 Ga0207658_100917492 307
381 3300026035 Ga0207703_10063299 Ga0207703_100632991 307
382 3300026035 Ga0207703_10357318 Ga0207703_103573181 307
383 3300026041 Ga0207639_10022893 Ga0207639_100228932 307
384 3300026067 Ga0207678_10017701 Ga0207678_100177015 307
385 3300026067 Ga0207678_10399546 Ga0207678_103995461 307
386 3300026075 Ga0207708_10011303 Ga0207708_100113035 307
387 3300026089 Ga0207648_10006412 Ga0207648_100064122 307
388 3300026095 Ga0207676_10215743 Ga0207676_102157432 307
389 3300026116 Ga0207674_10127787 Ga0207674_101277871 307
390 3300026118 Ga0207675_100033231 Ga0207675_1000332314 307
391 3300026121 Ga0207683_10047318 Ga0207683_100473182 307
392 3300026121 Ga0207683_10069648 Ga0207683_100696483 307
393 3300027364 Ga0209967_1006036 Ga0209967_10060362 307
394 3300027378 Ga0209981_1009684 Ga0209981_10096842 307
395 3300027543 Ga0209999_1005358 Ga0209999_10053583 307
396 3300027907 Ga0207428_10026893 Ga0207428_100268935 307
397 3300028379 Ga0268266_10073587 Ga0268266_100735873 307
398 3300028380 Ga0268265_10060002 Ga0268265_100600021 307
399 3300028556 Ga0265337_1000071 Ga0265337_100007147 307
400 3300031241 Ga0265325_10006017 Ga0265325_100060178 307
401 3300031241 Ga0265325_10030664 Ga0265325_100306642 307
402 3300031249 Ga0265339_10001047 Ga0265339_100010472 307
403 3300031344 Ga0265316_10042203 Ga0265316_100422032 307
404 3300031595 Ga0265313_10000977 Ga0265313_1000097724 307
405 3300032005 Ga0307411_10236922 Ga0307411_102369222 307
406 3300032126 Ga0307415_100261794 Ga0307415_1002617942 307
407 3300034817 Ga0373948_0001038 Ga0373948_0001038_1273_2196 307
408 3300034819 Ga0373958_0000067 Ga0373958_0000067_1301_2224 307
409 3300034820 Ga0373959_0000605 Ga0373959_0000605_2763_3686 307
410 3300035083 Ga0373926_0038725 Ga0373926_0038725_343_1314 307
411 3300035084 Ga0373928_0001080 Ga0373928_0001080_1416_2339 307
412 3300035084 Ga0373928_0022443 Ga0373928_0022443_103_1071 307
413 3300035085 Ga0373929_0000479 Ga0373929_0000479_5703_6626 307
414 3300035088 Ga0373940_0000423 Ga0373940_0000423_2232_3155 307
415 3300035090 Ga0373949_0000398 Ga0373949_0000398_30_953 307
416 3300035091 Ga0373951_0000207 Ga0373951_0000207_1391_2314 307
417 3300035092 Ga0373952_0000046 Ga0373952_0000046_10251_11174 307
418 3300035112 Ga0373932_0000529 Ga0373932_0000529_9976_10899 307
419 3300035113 Ga0373936_0014420 Ga0373936_0014420_1125_2093 307
420 3300035113 Ga0373936_0023790 Ga0373936_0023790_503_1471 307
421 3300035114 Ga0373939_0000159 Ga0373939_0000159_7835_8758 307
422 3300035114 Ga0373939_0014094 Ga0373939_0014094_660_1628 307
423 3300035115 Ga0373941_0000017 Ga0373941_0000017_25776_26699 307
424 3300035116 Ga0373945_0013465 Ga0373945_0013465_806_1777 307
425 3300035117 Ga0373953_0072067 Ga0373953_0072067_255_1223 307
426 3300035118 Ga0373954_0019942 Ga0373954_0019942_1047_2015 307
427 3300035121 Ga0373960_0000896 Ga0373960_0000896_2990_3913 307
428 3300035170 Ga0373943_0004464 Ga0373943_0004464_2537_3505 307
429 3300035172 Ga0373955_0000530 Ga0373955_0000530_5362_6330 307
430 3300035207 Ga0373942_0000086 Ga0373942_0000086_2337_3260 307
431 3300035241 Ga0373961_0002182 Ga0373961_0002182_1456_2379 307
432 3300035242 Ga0373962_0017725 Ga0373962_0017725_447_1418 307
433 3300035410 Ga0373924_0021780 Ga0373924_0021780_243_1211 307
434 3300035691 Ga0373931_0008078 Ga0373931_0008078_1262_2185 307
435 3300035691 Ga0373931_0122941 Ga0373931_0122941_20_988 307
436 3300035692 Ga0373935_0000108 Ga0373935_0000108_23734_24702 307
437 3300035692 Ga0373935_0097026 Ga0373935_0097026_52_1017 307
438 3300035695 Ga0373927_0004068 Ga0373927_0004068_5458_6426 307
439 3300035695 Ga0373927_0051665 Ga0373927_0051665_1083_2057 307
440 3300035724 Ga0373933_0003638 Ga0373933_0003638_2786_3754 307
441 3300035725 Ga0373947_0004424 Ga0373947_0004424_6429_7397 307
442 3300035725 Ga0373947_0031657 Ga0373947_0031657_954_1925 307
443 3300035725 Ga0373947_0057763 Ga0373947_0057763_285_1250 307
444 3300036401 Ga0373937_0000007 Ga0373937_0000007_18713_19681 307
445 3300037068 Ga0373925_0000011 Ga0373925_0000011_9964_10932 307
446 3300039450 Ga0436363_0211948 Ga0436363_0211948_532_1515 307
447 3300039450 Ga0436363_1183097 Ga0436363_1183097_16_966 307
448 3300041512 Ga0451853_0997442 Ga0451853_0997442_217_1188 307
449 3300042461 Ga0439460_0000174 Ga0439460_0000174_10712_11740 307
450 3300042532 Ga0450893_0010550 Ga0450893_0010550_255_1298 307
451 3300044712 Ga0453684_0040067 Ga0453684_0040067_1289_2212 307
452 3300046454 Ga0495592_0000390 Ga0495592_0000390_22702_23670 307
453 3300046457 Ga0495590_0093166 Ga0495590_0093166_52_1026 307
454 3300046459 Ga0495629_0022960 Ga0495629_0022960_2616_3584 307
455 3300046460 Ga0495638_0192640 Ga0495638_0192640_30_1031 307
456 3300046462 Ga0495651_0009066 Ga0495651_0009066_2882_3850 307
457 3300046462 Ga0495651_0136692 Ga0495651_0136692_811_1740 307
458 3300046463 Ga0495653_0000249 Ga0495653_0000249_25174_26142 307
459 3300046472 Ga0495580_0032962 Ga0495580_0032962_1299_2270 307
460 3300046473 Ga0495582_0090937 Ga0495582_0090937_167_1138 307
461 3300046474 Ga0495605_0075576 Ga0495605_0075576_45_1016 307
462 3300046476 Ga0495662_0134123 Ga0495662_0134123_193_1158 307
463 3300046477 Ga0495664_0000024 Ga0495664_0000024_98984_99952 307
464 3300046491 Ga0495584_0037506 Ga0495584_0037506_473_1450 307
465 3300046499 Ga0495594_0011329 Ga0495594_0011329_1239_2210 307
466 3300046511 Ga0495608_0000004 Ga0495608_0000004_43074_44042 307
467 3300046514 Ga0495618_0000855 Ga0495618_0000855_15008_15976 307
468 3300046514 Ga0495618_0048645 Ga0495618_0048645_1310_2281 307
469 3300046516 Ga0495628_0000006 Ga0495628_0000006_106691_107659 307
470 3300046517 Ga0495630_0000601 Ga0495630_0000601_16981_17949 307
471 3300046517 Ga0495630_0134886 Ga0495630_0134886_636_1607 307
472 3300046523 Ga0495644_0019617 Ga0495644_0019617_943_2016 307
473 3300046529 Ga0495652_0000038 Ga0495652_0000038_101702_102670 307
474 3300046531 Ga0495665_0048609 Ga0495665_0048609_587_1555 307
475 3300046531 Ga0495665_0181628 Ga0495665_0181628_55_1020 307
476 3300046533 Ga0495640_0000013 Ga0495640_0000013_7538_8506 307
477 3300046533 Ga0495640_0056898 Ga0495640_0056898_1176_2141 307
478 3300046535 Ga0495586_0077474 Ga0495586_0077474_693_1661 307
479 3300046536 Ga0495587_0000004 Ga0495587_0000004_46539_47507 307
480 3300046543 Ga0495645_0000001 Ga0495645_0000001_311074_312042 307
481 3300046558 Ga0495633_0039898 Ga0495633_0039898_1138_2109 307
482 3300046559 Ga0495667_0000084 Ga0495667_0000084_27736_28704 307
483 3300046615 Ga0495656_0019425 Ga0495656_0019425_561_1538 307
484 3300046642 Ga0495634_0000164 Ga0495634_0000164_5178_6146 307
485 3300046642 Ga0495634_0025446 Ga0495634_0025446_922_1887 307
486 3300046663 Ga0495635_0000003 Ga0495635_0000003_310705_311673 307
487 3300046663 Ga0495635_0220189 Ga0495635_0220189_10_981 307
488 3300046665 Ga0495661_0105762 Ga0495661_0105762_241_1218 307
489 3300046675 Ga0495657_0000248 Ga0495657_0000248_38563_39531 307
490 3300046678 Ga0495599_0000014 Ga0495599_0000014_163976_164944 307
491 3300046679 Ga0495623_0000015 Ga0495623_0000015_23616_24584 307
492 3300046680 Ga0495646_0000005 Ga0495646_0000005_223245_224213 307
493 3300046689 Ga0495613_0011799 Ga0495613_0011799_3516_4484 307
494 3300046690 Ga0495624_0113521 Ga0495624_0113521_14_985 307
495 3300046794 Ga0495589_0140084 Ga0495589_0140084_131_1102 307
496 3300046809 Ga0495600_0000005 Ga0495600_0000005_6703_7671 307
497 3300046810 Ga0495660_0145101 Ga0495660_0145101_81_1052 307
498 3300047315 Ga0495581_0035116 Ga0495581_0035116_1243_2211 307
499 3300047315 Ga0495581_0101323 Ga0495581_0101323_479_1450 307
500 3300047317 Ga0495604_0000002 Ga0495604_0000002_218976_219944 307
501 3300047319 Ga0495674_0000004 Ga0495674_0000004_218525_219493 307
502 3300047319 Ga0495674_0167199 Ga0495674_0167199_807_1772 307
503 3300047320 Ga0495672_0154403 Ga0495672_0154403_136_1107 307
504 3300047321 Ga0495676_0086728 Ga0495676_0086728_1113_2084 307
505 3300047322 Ga0495680_0000142 Ga0495680_0000142_6976_7944 307
506 3300047444 Ga0495675_0000053 Ga0495675_0000053_39137_40105 307
507 3300047447 Ga0495685_082661 Ga0495685_082661_80_1051 307
508 3300047471 Ga0495684_0000004 Ga0495684_0000004_199401_200369 307
509 3300048088 Ga0495602_0000001 Ga0495602_0000001_310747_311715 307
510 3300048903 Ga0496100_0068911 Ga0496100_0068911_987_1958 307
511 3300048903 Ga0496100_0096916 Ga0496100_0096916_22_993 307
512 3300048903 Ga0496100_0159034 Ga0496100_0159034_322_1275 307
513 3300048904 Ga0496101_0074509 Ga0496101_0074509_494_1465 307
514 3300048904 Ga0496101_0076402 Ga0496101_0076402_751_1713 307
515 3300048904 Ga0496101_0095218 Ga0496101_0095218_1041_1964 307
516 3300048905 Ga0496102_0030973 Ga0496102_0030973_2493_3416 307
517 3300048905 Ga0496102_0102351 Ga0496102_0102351_448_1419 307
518 3300048906 Ga0496103_0021838 Ga0496103_0021838_2561_3532 307
519 3300048906 Ga0496103_0022327 Ga0496103_0022327_2519_3490 307
520 3300048906 Ga0496103_0115703 Ga0496103_0115703_645_1613 307
521 3300048907 Ga0496104_0000778 Ga0496104_0000778_5160_6155 307
522 3300048907 Ga0496104_0004804 Ga0496104_0004804_1156_2151 307
523 3300048907 Ga0496104_0004804 Ga0496104_0004804_46_1023 307
524 3300048907 Ga0496104_0020957 Ga0496104_0020957_2435_3406 307
525 3300048907 Ga0496104_0187123 Ga0496104_0187123_212_1180 307
526 3300048907 Ga0496104_0202937 Ga0496104_0202937_448_1419 307
527 3300048908 Ga0496105_0016531 Ga0496105_0016531_3300_4295 307
528 3300048908 Ga0496105_0051610 Ga0496105_0051610_976_1947 307
529 3300048908 Ga0496105_0071122 Ga0496105_0071122_140_1135 307
530 3300048908 Ga0496105_0089361 Ga0496105_0089361_25_978 307
531 3300048909 Ga0496106_0009665 Ga0496106_0009665_4820_5791 307
532 3300048909 Ga0496106_0022495 Ga0496106_0022495_2695_3666 307
533 3300048909 Ga0496106_0041752 Ga0496106_0041752_447_1370 307
534 3300048909 Ga0496106_0140498 Ga0496106_0140498_811_1788 307
535 3300048910 Ga0496107_0010821 Ga0496107_0010821_4911_5834 307
536 3300048911 Ga0496108_0003559 Ga0496108_0003559_2662_3633 307
537 3300048911 Ga0496108_0181836 Ga0496108_0181836_103_1098 307
538 3300048912 Ga0496109_0001664 Ga0496109_0001664_10533_11504 307
539 3300048912 Ga0496109_0025511 Ga0496109_0025511_3061_4032 307
540 3300048912 Ga0496109_0052080 Ga0496109_0052080_26_949 307
541 3300048912 Ga0496109_0192627 Ga0496109_0192627_706_1668 307
542 3300048912 Ga0496109_0302713 Ga0496109_0302713_461_1456 307
543 3300048913 Ga0496110_0008663 Ga0496110_0008663_1964_2935 307
544 3300048913 Ga0496110_0055123 Ga0496110_0055123_576_1547 307
545 3300048913 Ga0496110_0259462 Ga0496110_0259462_315_1295 307
546 3300048913 Ga0496110_0265606 Ga0496110_0265606_31_1002 307
547 3300048914 Ga0496111_0038752 Ga0496111_0038752_2276_3247 307
548 3300048914 Ga0496111_0056561 Ga0496111_0056561_461_1384 307
549 3300048914 Ga0496111_0063984 Ga0496111_0063984_210_1190 307
550 3300048915 Ga0496112_0124243 Ga0496112_0124243_132_1103 307
551 3300048915 Ga0496112_0172695 Ga0496112_0172695_52_1119 307
552 3300048916 Ga0496113_0001475 Ga0496113_0001475_1623_2594 307
553 3300048916 Ga0496113_0204792 Ga0496113_0204792_420_1397 307
554 3300048917 Ga0496114_0007227 Ga0496114_0007227_47_1018 307
555 3300048917 Ga0496114_0007386 Ga0496114_0007386_4914_5876 307
556 3300048917 Ga0496114_0134337 Ga0496114_0134337_210_1181 307
557 3300048918 Ga0496115_0015056 Ga0496115_0015056_1772_2767 307
558 3300048918 Ga0496115_0126846 Ga0496115_0126846_810_1772 307
559 3300048918 Ga0496115_0235489 Ga0496115_0235489_213_1190 307
560 3300049568 Ga0501031_0032599 Ga0501031_0032599_1687_2661 307
561 3300049568 Ga0501031_0239871 Ga0501031_0239871_19_990 307
562 3300049569 Ga0501032_0017659 Ga0501032_0017659_2241_3221 307
563 3300049572 Ga0501036_0003271 Ga0501036_0003271_10842_11816 307
564 3300049572 Ga0501036_0004299 Ga0501036_0004299_3125_4105 307
565 3300049572 Ga0501036_0134215 Ga0501036_0134215_668_1654 307
566 3300049573 Ga0501037_0026706 Ga0501037_0026706_1670_2650 307
567 3300049574 Ga0501038_0001109 Ga0501038_0001109_11602_12576 307
568 3300049574 Ga0501038_0038044 Ga0501038_0038044_1490_2470 307
569 3300049575 Ga0501039_0015991 Ga0501039_0015991_4096_5070 307
570 3300049575 Ga0501039_0092803 Ga0501039_0092803_11_1036 307
571 3300049576 Ga0501040_0001909 Ga0501040_0001909_5112_6086 307
572 3300049577 Ga0501041_0003730 Ga0501041_0003730_4966_5940 307
573 3300049578 Ga0501042_0000383 Ga0501042_0000383_11800_12774 307
574 3300049579 Ga0501043_0039655 Ga0501043_0039655_1105_2085 307
575 3300049580 Ga0501046_0001197 Ga0501046_0001197_12160_13134 307
576 3300049580 Ga0501046_0005257 Ga0501046_0005257_2687_3667 307
577 3300049581 Ga0501047_0131279 Ga0501047_0131279_21_971 307
578 3300049581 Ga0501047_0136435 Ga0501047_0136435_713_1687 307
579 3300049582 Ga0501048_0030146 Ga0501048_0030146_48_1028 307
580 3300049583 Ga0501067_0047518 Ga0501067_0047518_459_1439 307
581 3300049584 Ga0501068_0009855 Ga0501068_0009855_1680_2660 307
582 3300049585 Ga0501069_0001350 Ga0501069_0001350_1060_2040 307
583 3300049586 Ga0501070_0015678 Ga0501070_0015678_5160_6140 307
584 3300049587 Ga0501071_0011854 Ga0501071_0011854_263_1237 307
585 3300049587 Ga0501071_0020152 Ga0501071_0020152_46_1020 307
586 3300049587 Ga0501071_0030315 Ga0501071_0030315_2798_3784 307
587 3300049587 Ga0501071_0044594 Ga0501071_0044594_1431_2411 307
588 3300049588 Ga0501072_0002470 Ga0501072_0002470_5196_6170 307
589 3300049588 Ga0501072_0359785 Ga0501072_0359785_114_1094 307
590 3300049589 Ga0501073_0064750 Ga0501073_0064750_522_1502 307
591 3300049589 Ga0501073_0098535 Ga0501073_0098535_469_1449 307
592 3300049591 Ga0501075_0000525 Ga0501075_0000525_11917_12891 307
593 3300049591 Ga0501075_0004827 Ga0501075_0004827_5677_6663 307
594 3300049592 Ga0501076_0013583 Ga0501076_0013583_4433_5407 307
595 3300049592 Ga0501076_0095303 Ga0501076_0095303_1149_2123 307
596 3300049593 Ga0501077_0031416 Ga0501077_0031416_2120_3094 307
597 3300049741 Ga0501079_0000625 Ga0501079_0000625_11574_12548 307
598 3300049741 Ga0501079_0015914 Ga0501079_0015914_3144_4130 307
599 3300049742 Ga0501080_0054849 Ga0501080_0054849_2539_3519 307
600 3300049742 Ga0501080_0110457 Ga0501080_0110457_1474_2448 307
601 3300049743 Ga0501081_0000055 Ga0501081_0000055_5124_6098 307
602 3300049743 Ga0501081_0322119 Ga0501081_0322119_57_1007 307
603 3300049744 Ga0501083_0006890 Ga0501083_0006890_2021_3001 307
604 3300049823 Ga0501044_0000351 Ga0501044_0000351_10467_11447 307
605 3300049823 Ga0501044_0049886 Ga0501044_0049886_1977_2951 307
606 3300049824 Ga0501045_0000901 Ga0501045_0000901_7900_8874 307
607 3300049824 Ga0501045_0006242 Ga0501045_0006242_5933_6919 307
608 3300049824 Ga0501045_0015157 Ga0501045_0015157_4384_5364 307
609 3300050492 nmdc:mga0yw44_100884_c1 nmdc:mga0yw44_100884_c1_21_992 307
610 3300050492 nmdc:mga0yw44_78772_c1 nmdc:mga0yw44_78772_c1_611_1582 307
611 3300050493 nmdc:mga0k408_143465_c1 nmdc:mga0k408_143465_c1_441_1370 307
612 3300050493 nmdc:mga0k408_153514_c1 nmdc:mga0k408_153514_c1_343_1314 307
613 3300050494 nmdc:mga06z11_272209_c1 nmdc:mga06z11_272209_c1_17_967 307
614 3300050507 nmdc:mga05p37_223_c1 nmdc:mga05p37_223_c1_44028_44987 307
615 3300050507 nmdc:mga05p37_325786_c1 nmdc:mga05p37_325786_c1_604_1629 307
616 3300050507 nmdc:mga05p37_540137_c1 nmdc:mga05p37_540137_c1_277_1248 307
617 3300050507 nmdc:mga05p37_56359_c1 nmdc:mga05p37_56359_c1_1935_2906 307
618 3300050508 nmdc:mga09592_135171_c1 nmdc:mga09592_135171_c1_346_1320 307
619 3300050508 nmdc:mga09592_152742_c1 nmdc:mga09592_152742_c1_622_1545 307
620 3300050508 nmdc:mga09592_8032_c1 nmdc:mga09592_8032_c1_2775_3734 307
621 3300050508 nmdc:mga09592_83861_c1 nmdc:mga09592_83861_c1_1516_2490 307
622 3300050508 nmdc:mga09592_84627_c1 nmdc:mga09592_84627_c1_547_1518 307
623 3300050508 nmdc:mga09592_9213_c1 nmdc:mga09592_9213_c1_2107_3132 307
624 3300050509 nmdc:mga0qj67_1416_c1 nmdc:mga0qj67_1416_c1_10881_11855 307
625 3300050509 nmdc:mga0qj67_16218_c1 nmdc:mga0qj67_16218_c1_4278_5219 307
626 3300050510 nmdc:mga06r32_1449_c1 nmdc:mga06r32_1449_c1_9728_10687 307
627 3300050510 nmdc:mga06r32_17056_c1 nmdc:mga06r32_17056_c1_576_1601 307
628 3300050511 nmdc:mga08y16_5989_c1 nmdc:mga08y16_5989_c1_3551_4510 307
629 3300050512 nmdc:mga0n895_63420_c1 nmdc:mga0n895_63420_c1_1452_2438 307
630 3300050512 nmdc:mga0n895_73026_c1 nmdc:mga0n895_73026_c1_417_1376 307
631 3300050513 nmdc:mga0rr50_134532_c1 nmdc:mga0rr50_134532_c1_152_1126 307
632 3300050515 nmdc:mga0a205_12766_c1 nmdc:mga0a205_12766_c1_6428_7414 307
633 3300050515 nmdc:mga0a205_62538_c1 nmdc:mga0a205_62538_c1_2213_3187 307
634 3300053077 Ga0495601_0000026 Ga0495601_0000026_98776_99744 307
635 3300053077 Ga0495601_0284322 Ga0495601_0284322_31_1002 307
636 3300053078 Ga0495612_0000005 Ga0495612_0000005_87028_87996 307
637 3300053084 Ga0495595_0000065 Ga0495595_0000065_38648_39616 307
638 3300053084 Ga0495595_0054768 Ga0495595_0054768_68_1036 307
639 3300053085 Ga0495619_0000003 Ga0495619_0000003_315869_316837 307
640 3300053085 Ga0495619_0042256 Ga0495619_0042256_562_1533 307
641 3300053085 Ga0495619_0047217 Ga0495619_0047217_1042_2010 307
642 3300053085 Ga0495619_0050494 Ga0495619_0050494_925_1896 307
643 3300053085 Ga0495619_0078690 Ga0495619_0078690_844_1791 307
644 3300053087 Ga0500643_000795 Ga0500643_000795_16554_17525 307
645 3300053119 Ga0500595_000001 Ga0500595_000001_318616_319587 307
646 3300053130 Ga0500642_0055327 Ga0500642_0055327_822_1754 307
647 3300053134 Ga0500658_0059366 Ga0500658_0059366_513_1484 307
648 3300053153 Ga0500616_0111110 Ga0500616_0111110_255_1229 307
649 3300054114 Ga0501084_0002498 Ga0501084_0002498_2507_3481 307
650 3300054114 Ga0501084_0033744 Ga0501084_0033744_107_1087 307
651 3300054114 Ga0501084_0073459 Ga0501084_0073459_1265_2251 307
652 3300060353 Ga0501082_0008950 Ga0501082_0008950_3196_4170 307
653 3300060353 Ga0501082_0046577 Ga0501082_0046577_2715_3695 307
654 3300061734 Ga0530510_0001004 Ga0530510_0001004_12660_13634 307
655 3300061734 Ga0530510_0028198 Ga0530510_0028198_977_1981 307

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03401

TctC

Tripartite tricarboxylate transporter family receptor

81

354

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dvz-assembly1.cif.gz_A structure of a periplasmic transporter 0.9668 12 307
5oku-assembly1.cif.gz_A r. palustris rpa4515 with adipate 0.9646 11 305
2f5x-assembly3.cif.gz_C structure of periplasmic binding protein bugd 0.9611 12 305
8hkb-assembly1.cif.gz_A tpa bound-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis mutant k184d 0.9602 15 305
2dvz-assembly1.cif.gz_A structure of a periplasmic transporter 0.9512 12 307
ID Description Score Start End Superfamily
4x9tA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.953 109 224 3.40.190.10
2qpqC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9468 109 231 3.40.190.10
6hkeC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9442 109 231 3.40.190.10
2dvzA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.9339 12 305 3.40.190.150
2qpqC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9322 109 231 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A1F4CWQ1-F1-model_v4 LacI family transcriptional regulator 0.979 12 307
AF-A0A1G6LKF5-F1-model_v4 Tripartite-type tricarboxylate transporter, receptor component TctC 0.9775 11 307
AF-A0A1B2QZA4-F1-model_v4 ABC transporter substrate-binding protein 0.9749 10 307
AF-A0A1J5PQ67-F1-model_v4 Tripartite tricarboxylate transporter family receptor 0.9744 49 300
AF-A0A5C8CF86-F1-model_v4 deleted 0.9742 23 305

Feature Viewer

pLDDT pTM Quality
93.52 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map