F472957
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 655 | 342 | 646 | 320 |
Family's Representative Sequence
| Representative Sequence | 3300046523|Ga0495644_0019617|Ga0495644_0019617_943_2016 |
| Length | 357 |
| Sequence | LADKDEGCFDRRRKSMTAFKAGGRVRTSSREELRMPTLHGTLLKAAGLLLALTTAVAAQDYPNKPVRLIIPFPPGGSNDVVGRLIATHLSERLGKQVVVDNRGAGAGGVVGSEVAANAPRDGYTLLIISLAHAVNPWLYKLPYDPIKSFTPVAILASGPNVLVVNPDLPVHSVKDLLAAAKEKPGQLQYASAGIGSFQHLGGELFKLTAGVNLLHVPFKGGGPAMIDVIGGHTKVMFSSLVQTTPHIRSGKLRALGTGGLTRNPVLPDVPAIAEAGVPGYEAVNWWGVVAPAGTPAAIVEKLHKEITAVQESDEVKKHFASEGAQVVQMSSAEFAVFIEKEMNKWERVVKEGGIKAE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 3 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 4 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 5 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 37 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 43 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 51 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 53 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 54 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 55 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 56 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 57 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 58 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 59 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 60 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 61 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 62 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 64 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 65 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 66 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 67 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 69 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 70 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 71 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 72 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 73 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 74 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 75 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 76 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 77 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 78 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 79 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 81 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 82 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 93 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 102 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 152 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 155 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 156 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 157 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 158 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 159 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 160 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 161 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 162 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 163 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 164 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 165 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 166 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 167 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 168 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 169 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 170 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 171 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 172 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 173 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 174 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 175 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 176 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 177 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 178 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 179 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 180 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 181 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 182 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 183 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 184 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 185 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 186 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 187 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 188 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 189 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 190 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 191 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 192 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 193 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 194 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 195 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 196 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 197 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 198 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 199 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 200 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 201 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 202 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 203 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 204 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 205 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 206 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 207 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 208 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 209 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 210 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 211 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 212 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 213 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 214 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 215 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 267 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 268 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 269 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 270 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 271 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 272 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 273 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 274 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 275 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 276 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 277 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 278 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 279 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 280 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 281 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 282 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 315 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 316 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 317 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 318 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 319 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 320 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 324 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 325 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 329 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 335 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 336 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 337 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 338 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 339 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 340 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.5 |
| Nodule | 0 |
| Rhizoplane | 8.85 |
| Rhizosphere | 84.73 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.92 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_619028 | 2162886007 | Bacteria | 1978 |
| 2 | JGI24737J22298_10035475 | 3300001990 | Bacteria | 1543 |
| 3 | JGI24744J21845_10010458 | 3300002077 | Bacteria | 1901 |
| 4 | JGI24742J22300_10002855 | 3300002244 | Bacteria | 2791 |
| 5 | Ga0065707_10127840 | 3300005295 | Bacteria | 1976 |
| 6 | Ga0070658_10017811 | 3300005327 | Bacteria | 5681 |
| 7 | Ga0070676_10031436 | 3300005328 | Bacteria | 3033 |
| 8 | Ga0070683_100160876 | 3300005329 | Bacteria | 2130 |
| 9 | Ga0070683_100310475 | 3300005329 | Bacteria | 1501 |
| 10 | Ga0070690_100023376 | 3300005330 | Bacteria | 3791 |
| 11 | Ga0068869_100200157 | 3300005334 | Bacteria | 1574 |
| 12 | Ga0070680_100052166 | 3300005336 | Bacteria | 3339 |
| 13 | Ga0068868_100050930 | 3300005338 | Bacteria | 3254 |
| 14 | Ga0068868_100278749 | 3300005338 | Bacteria | 1414 |
| 15 | Ga0070689_100030900 | 3300005340 | Bacteria | 4067 |
| 16 | Ga0070689_100052061 | 3300005340 | Bacteria | 3166 |
| 17 | Ga0070689_100057601 | 3300005340 | Bacteria | 3016 |
| 18 | Ga0070689_100071554 | 3300005340 | Bacteria | 2709 |
| 19 | Ga0070687_100018341 | 3300005343 | Bacteria | 3235 |
| 20 | Ga0070661_100227023 | 3300005344 | Bacteria | 1434 |
| 21 | Ga0070692_10132326 | 3300005345 | Bacteria | 1403 |
| 22 | Ga0070668_100031290 | 3300005347 | Bacteria | 4048 |
| 23 | Ga0070668_100235344 | 3300005347 | Bacteria | 1516 |
| 24 | Ga0070669_100088741 | 3300005353 | Bacteria | 2315 |
| 25 | Ga0070669_100145768 | 3300005353 | Bacteria | 1829 |
| 26 | Ga0070669_100185492 | 3300005353 | Bacteria | 1630 |
| 27 | Ga0070675_100023649 | 3300005354 | Bacteria | 4915 |
| 28 | Ga0070671_100014076 | 3300005355 | Bacteria | 6458 |
| 29 | Ga0070671_100069285 | 3300005355 | Bacteria | 2942 |
| 30 | Ga0070671_100075882 | 3300005355 | Bacteria | 2808 |
| 31 | Ga0070671_100111507 | 3300005355 | Bacteria | 2298 |
| 32 | Ga0070674_100007137 | 3300005356 | Bacteria | 6571 |
| 33 | Ga0070673_100044391 | 3300005364 | Bacteria | 3441 |
| 34 | Ga0070673_100091157 | 3300005364 | Bacteria | 2491 |
| 35 | Ga0070673_100502695 | 3300005364 | Bacteria | 1097 |
| 36 | Ga0070659_100280320 | 3300005366 | Bacteria | 1386 |
| 37 | Ga0070667_100024257 | 3300005367 | Bacteria | 5037 |
| 38 | Ga0070714_100069870 | 3300005435 | Bacteria | 3034 |
| 39 | Ga0070714_100223682 | 3300005435 | Bacteria | 1731 |
| 40 | Ga0070713_100158006 | 3300005436 | Bacteria | 2022 |
| 41 | Ga0070710_10079388 | 3300005437 | Bacteria | 1912 |
| 42 | Ga0070701_10014707 | 3300005438 | Bacteria | 3593 |
| 43 | Ga0070711_100048441 | 3300005439 | Bacteria | 2906 |
| 44 | Ga0070711_100188084 | 3300005439 | Bacteria | 1585 |
| 45 | Ga0070705_100080566 | 3300005440 | Bacteria | 1998 |
| 46 | Ga0070694_100002295 | 3300005444 | Bacteria | 11315 |
| 47 | Ga0070694_100009395 | 3300005444 | Bacteria | 6003 |
| 48 | Ga0070663_100229800 | 3300005455 | Bacteria | 1460 |
| 49 | Ga0070678_100170885 | 3300005456 | Bacteria | 1770 |
| 50 | Ga0070662_100100583 | 3300005457 | Bacteria | 2187 |
| 51 | Ga0070662_100155736 | 3300005457 | Bacteria | 1783 |
| 52 | Ga0070681_10043120 | 3300005458 | Bacteria | 4520 |
| 53 | Ga0070681_10367590 | 3300005458 | Bacteria | 1349 |
| 54 | Ga0068867_100082922 | 3300005459 | Bacteria | 2420 |
| 55 | Ga0068867_100185278 | 3300005459 | Bacteria | 1657 |
| 56 | Ga0070685_10034266 | 3300005466 | Bacteria | 2859 |
| 57 | Ga0070707_100565696 | 3300005468 | Bacteria | 1099 |
| 58 | Ga0070698_100121843 | 3300005471 | Bacteria | 2567 |
| 59 | Ga0070698_100138733 | 3300005471 | Bacteria | 2384 |
| 60 | Ga0070679_100017610 | 3300005530 | Bacteria | 6916 |
| 61 | Ga0070679_100087553 | 3300005530 | Bacteria | 3102 |
| 62 | Ga0070679_100264309 | 3300005530 | Bacteria | 1676 |
| 63 | Ga0070684_100086057 | 3300005535 | Bacteria | 2789 |
| 64 | Ga0068853_100096262 | 3300005539 | Bacteria | 2611 |
| 65 | Ga0070672_100062522 | 3300005543 | Bacteria | 2938 |
| 66 | Ga0070686_100015684 | 3300005544 | Bacteria | 4395 |
| 67 | Ga0070686_100102156 | 3300005544 | Bacteria | 1939 |
| 68 | Ga0070695_100003529 | 3300005545 | Bacteria | 9131 |
| 69 | Ga0070696_100058527 | 3300005546 | Bacteria | 2691 |
| 70 | Ga0070693_100188318 | 3300005547 | Bacteria | 1333 |
| 71 | Ga0070665_100132337 | 3300005548 | Bacteria | 2496 |
| 72 | Ga0070704_100022251 | 3300005549 | Bacteria | 4122 |
| 73 | Ga0070704_100072294 | 3300005549 | Bacteria | 2508 |
| 74 | Ga0068854_100026877 | 3300005578 | Bacteria | 3959 |
| 75 | Ga0068854_100289669 | 3300005578 | Bacteria | 1321 |
| 76 | Ga0070702_100120695 | 3300005615 | Bacteria | 1640 |
| 77 | Ga0070702_100190426 | 3300005615 | Bacteria | 1349 |
| 78 | Ga0068852_100106108 | 3300005616 | Bacteria | 2546 |
| 79 | Ga0068859_100054576 | 3300005617 | Bacteria | 4019 |
| 80 | Ga0068859_100102424 | 3300005617 | Bacteria | 2921 |
| 81 | Ga0068864_100018958 | 3300005618 | Bacteria | 5752 |
| 82 | Ga0068864_100036891 | 3300005618 | Bacteria | 4168 |
| 83 | Ga0068870_10250354 | 3300005840 | Bacteria | 1098 |
| 84 | Ga0068863_100107054 | 3300005841 | Bacteria | 2660 |
| 85 | Ga0068858_100025413 | 3300005842 | Bacteria | 5511 |
| 86 | Ga0081455_10000669 | 3300005937 | Bacteria | 44336 |
| 87 | Ga0081455_10010322 | 3300005937 | Bacteria | 9494 |
| 88 | Ga0081455_10026170 | 3300005937 | Bacteria | 5374 |
| 89 | Ga0081538_10001564 | 3300005981 | Bacteria | 23475 |
| 90 | Ga0081538_10037286 | 3300005981 | Bacteria | 3157 |
| 91 | Ga0081538_10058508 | 3300005981 | Bacteria | 2235 |
| 92 | Ga0081540_1001200 | 3300005983 | Bacteria | 22696 |
| 93 | Ga0081540_1037669 | 3300005983 | Bacteria | 2559 |
| 94 | Ga0081539_10001356 | 3300005985 | Bacteria | 42605 |
| 95 | Ga0070717_10145746 | 3300006028 | Bacteria | 2045 |
| 96 | Ga0075365_10075461 | 3300006038 | Bacteria | 2275 |
| 97 | Ga0075365_10223467 | 3300006038 | Bacteria | 1321 |
| 98 | Ga0075368_10007461 | 3300006042 | Bacteria | 3858 |
| 99 | Ga0075363_100004161 | 3300006048 | Bacteria | 6283 |
| 100 | Ga0075364_10011898 | 3300006051 | Bacteria | 5301 |
| 101 | Ga0070712_100002654 | 3300006175 | Bacteria | 11037 |
| 102 | Ga0070712_100056890 | 3300006175 | Bacteria | 2745 |
| 103 | Ga0075362_10001383 | 3300006177 | Bacteria | 7699 |
| 104 | Ga0075362_10038928 | 3300006177 | Bacteria | 2089 |
| 105 | Ga0075362_10055847 | 3300006177 | Bacteria | 1776 |
| 106 | Ga0075362_10082246 | 3300006177 | Bacteria | 1485 |
| 107 | Ga0075367_10091905 | 3300006178 | Bacteria | 1847 |
| 108 | Ga0075369_10058854 | 3300006186 | Bacteria | 1673 |
| 109 | Ga0075366_10097792 | 3300006195 | Bacteria | 1760 |
| 110 | Ga0068871_100013831 | 3300006358 | Bacteria | 5999 |
| 111 | Ga0068871_100100950 | 3300006358 | Bacteria | 2417 |
| 112 | Ga0075428_100002569 | 3300006844 | Bacteria | 19722 |
| 113 | Ga0075428_100011624 | 3300006844 | Bacteria | 9796 |
| 114 | Ga0075428_100057483 | 3300006844 | Bacteria | 4258 |
| 115 | Ga0075428_100075150 | 3300006844 | Bacteria | 3690 |
| 116 | Ga0075428_100143852 | 3300006844 | Bacteria | 2592 |
| 117 | Ga0075428_100358587 | 3300006844 | Bacteria | 1564 |
| 118 | Ga0075428_100401542 | 3300006844 | Bacteria | 1469 |
| 119 | Ga0075430_100000063 | 3300006846 | Bacteria | 57435 |
| 120 | Ga0075430_100007026 | 3300006846 | Bacteria | 9490 |
| 121 | Ga0075430_100046155 | 3300006846 | Bacteria | 3680 |
| 122 | Ga0075430_100067686 | 3300006846 | Bacteria | 2997 |
| 123 | Ga0075431_100001682 | 3300006847 | Bacteria | 20734 |
| 124 | Ga0075431_100012395 | 3300006847 | Bacteria | 8604 |
| 125 | Ga0075431_100031216 | 3300006847 | Bacteria | 5487 |
| 126 | Ga0075431_100160476 | 3300006847 | Bacteria | 2312 |
| 127 | Ga0075434_100027816 | 3300006871 | Bacteria | 5551 |
| 128 | Ga0075434_100046120 | 3300006871 | Bacteria | 4325 |
| 129 | Ga0075434_100321966 | 3300006871 | Bacteria | 1567 |
| 130 | Ga0075429_100005500 | 3300006880 | Bacteria | 10908 |
| 131 | Ga0075429_100007197 | 3300006880 | Bacteria | 9654 |
| 132 | Ga0075429_100021973 | 3300006880 | Bacteria | 5532 |
| 133 | Ga0075429_100023196 | 3300006880 | Bacteria | 5382 |
| 134 | Ga0075429_100036588 | 3300006880 | Bacteria | 4270 |
| 135 | Ga0075429_100165815 | 3300006880 | Bacteria | 1935 |
| 136 | Ga0075429_100198236 | 3300006880 | Bacteria | 1759 |
| 137 | Ga0075429_100364929 | 3300006880 | Bacteria | 1264 |
| 138 | Ga0068865_100081952 | 3300006881 | Bacteria | 2318 |
| 139 | Ga0068865_100095941 | 3300006881 | Bacteria | 2161 |
| 140 | Ga0097620_100054576 | 3300006931 | Bacteria | 4019 |
| 141 | Ga0097620_100102422 | 3300006931 | Bacteria | 2921 |
| 142 | Ga0075435_100029006 | 3300007076 | Bacteria | 4342 |
| 143 | Ga0075435_100222802 | 3300007076 | Bacteria | 1602 |
| 144 | Ga0099794_10059093 | 3300007265 | Bacteria | 1859 |
| 145 | Ga0105244_10045377 | 3300009036 | Bacteria | 2261 |
| 146 | Ga0111539_10000584 | 3300009094 | Bacteria | 47005 |
| 147 | Ga0111539_10002420 | 3300009094 | Bacteria | 24821 |
| 148 | Ga0111539_10004295 | 3300009094 | Bacteria | 18636 |
| 149 | Ga0111539_10038151 | 3300009094 | Bacteria | 5796 |
| 150 | Ga0111539_10097638 | 3300009094 | Bacteria | 3451 |
| 151 | Ga0111539_10192490 | 3300009094 | Bacteria | 2379 |
| 152 | Ga0105247_10013222 | 3300009101 | Bacteria | 4951 |
| 153 | Ga0105247_10114666 | 3300009101 | Bacteria | 1738 |
| 154 | Ga0114129_10000199 | 3300009147 | Bacteria | 66704 |
| 155 | Ga0114129_10005299 | 3300009147 | Bacteria | 18196 |
| 156 | Ga0114129_10025557 | 3300009147 | Bacteria | 8366 |
| 157 | Ga0114129_10087647 | 3300009147 | Bacteria | 4316 |
| 158 | Ga0114129_10100816 | 3300009147 | Bacteria | 3995 |
| 159 | Ga0114129_10189803 | 3300009147 | Bacteria | 2791 |
| 160 | Ga0114129_10381487 | 3300009147 | Bacteria | 1861 |
| 161 | Ga0114129_10836592 | 3300009147 | Bacteria | 1171 |
| 162 | Ga0105243_10032485 | 3300009148 | Bacteria | 4034 |
| 163 | Ga0105243_10076587 | 3300009148 | Bacteria | 2719 |
| 164 | Ga0105243_10108404 | 3300009148 | Bacteria | 2318 |
| 165 | Ga0105241_10163927 | 3300009174 | Bacteria | 1830 |
| 166 | Ga0105242_10049576 | 3300009176 | Bacteria | 3417 |
| 167 | Ga0105242_10386853 | 3300009176 | Bacteria | 1302 |
| 168 | Ga0105248_10030282 | 3300009177 | Bacteria | 6043 |
| 169 | Ga0105238_10267876 | 3300009551 | Bacteria | 1688 |
| 170 | Ga0105238_10372598 | 3300009551 | Bacteria | 1418 |
| 171 | Ga0105238_10421118 | 3300009551 | Bacteria | 1330 |
| 172 | Ga0105249_10006518 | 3300009553 | Bacteria | 10155 |
| 173 | Ga0105249_10244064 | 3300009553 | Bacteria | 1777 |
| 174 | Ga0105249_10661184 | 3300009553 | Bacteria | 1103 |
| 175 | Ga0099796_10001693 | 3300010159 | Bacteria | 4569 |
| 176 | Ga0099796_10079742 | 3300010159 | Bacteria | 1198 |
| 177 | Ga0105239_10049040 | 3300010375 | Bacteria | 4630 |
| 178 | Ga0105239_10204024 | 3300010375 | Bacteria | 2215 |
| 179 | Ga0105246_10053542 | 3300011119 | Bacteria | 2777 |
| 180 | Ga0105246_10178276 | 3300011119 | Bacteria | 1634 |
| 181 | Ga0157378_10232713 | 3300013297 | Bacteria | 1757 |
| 182 | Ga0163162_10055029 | 3300013306 | Bacteria | 4004 |
| 183 | Ga0163162_10306838 | 3300013306 | Bacteria | 1719 |
| 184 | Ga0157375_10001521 | 3300013308 | Bacteria | 19961 |
| 185 | Ga0157375_10882193 | 3300013308 | Bacteria | 1039 |
| 186 | Ga0163163_10004477 | 3300014325 | Bacteria | 11918 |
| 187 | Ga0163163_10168951 | 3300014325 | Bacteria | 2233 |
| 188 | Ga0163163_10246646 | 3300014325 | Bacteria | 1836 |
| 189 | Ga0157380_10071822 | 3300014326 | Bacteria | 2801 |
| 190 | Ga0157380_10223784 | 3300014326 | Bacteria | 1685 |
| 191 | Ga0157380_10392092 | 3300014326 | Bacteria | 1314 |
| 192 | Ga0157376_10066864 | 3300014969 | Bacteria | 3039 |
| 193 | Ga0157376_10081402 | 3300014969 | Bacteria | 2780 |
| 194 | Ga0213876_10104694 | 3300021384 | Bacteria | 1501 |
| 195 | Ga0209758_1002417 | 3300025297 | Bacteria | 19125 |
| 196 | Ga0207426_1025911 | 3300025302 | Bacteria | 1970 |
| 197 | Ga0207697_10007537 | 3300025315 | Bacteria | 4845 |
| 198 | Ga0207697_10078734 | 3300025315 | Bacteria | 1387 |
| 199 | Ga0207682_10014593 | 3300025893 | Bacteria | 3062 |
| 200 | Ga0207688_10001481 | 3300025901 | Bacteria | 12308 |
| 201 | Ga0207688_10007736 | 3300025901 | Bacteria | 5855 |
| 202 | Ga0207680_10035408 | 3300025903 | Bacteria | 2866 |
| 203 | Ga0207647_10052730 | 3300025904 | Bacteria | 2509 |
| 204 | Ga0207645_10022680 | 3300025907 | Bacteria | 4081 |
| 205 | Ga0207645_10025867 | 3300025907 | Bacteria | 3796 |
| 206 | Ga0207643_10002578 | 3300025908 | Bacteria | 9815 |
| 207 | Ga0207707_10303982 | 3300025912 | Bacteria | 1379 |
| 208 | Ga0207693_10033141 | 3300025915 | Bacteria | 4077 |
| 209 | Ga0207693_10037884 | 3300025915 | Bacteria | 3800 |
| 210 | Ga0207660_10094826 | 3300025917 | Bacteria | 2219 |
| 211 | Ga0207662_10021624 | 3300025918 | Bacteria | 3681 |
| 212 | Ga0207662_10098580 | 3300025918 | Bacteria | 1808 |
| 213 | Ga0207657_10033671 | 3300025919 | Bacteria | 4615 |
| 214 | Ga0207649_10101541 | 3300025920 | Bacteria | 1905 |
| 215 | Ga0207652_10004363 | 3300025921 | Bacteria | 11526 |
| 216 | Ga0207652_10170343 | 3300025921 | Bacteria | 1954 |
| 217 | Ga0207652_10229354 | 3300025921 | Bacteria | 1673 |
| 218 | Ga0207681_10045506 | 3300025923 | Bacteria | 2947 |
| 219 | Ga0207681_10126196 | 3300025923 | Bacteria | 1885 |
| 220 | Ga0207694_10181188 | 3300025924 | Bacteria | 1708 |
| 221 | Ga0207650_10068470 | 3300025925 | Bacteria | 2665 |
| 222 | Ga0207650_10106387 | 3300025925 | Bacteria | 2167 |
| 223 | Ga0207687_10041231 | 3300025927 | Bacteria | 3168 |
| 224 | Ga0207700_10370219 | 3300025928 | Bacteria | 1251 |
| 225 | Ga0207644_10096541 | 3300025931 | Bacteria | 2212 |
| 226 | Ga0207690_10071916 | 3300025932 | Bacteria | 2387 |
| 227 | Ga0207706_10074680 | 3300025933 | Bacteria | 2981 |
| 228 | Ga0207706_10255904 | 3300025933 | Bacteria | 1529 |
| 229 | Ga0207686_10083504 | 3300025934 | Bacteria | 2091 |
| 230 | Ga0207686_10124359 | 3300025934 | Bacteria | 1760 |
| 231 | Ga0207670_10085017 | 3300025936 | Bacteria | 2222 |
| 232 | Ga0207670_10099004 | 3300025936 | Bacteria | 2079 |
| 233 | Ga0207669_10009105 | 3300025937 | Bacteria | 4709 |
| 234 | Ga0207691_10077916 | 3300025940 | Bacteria | 2984 |
| 235 | Ga0207711_10057574 | 3300025941 | Bacteria | 3341 |
| 236 | Ga0207711_10159172 | 3300025941 | Bacteria | 2042 |
| 237 | Ga0207689_10052814 | 3300025942 | Bacteria | 3348 |
| 238 | Ga0207689_10054189 | 3300025942 | Bacteria | 3304 |
| 239 | Ga0207640_10018223 | 3300025981 | Bacteria | 4122 |
| 240 | Ga0207658_10091749 | 3300025986 | Bacteria | 2358 |
| 241 | Ga0207703_10063299 | 3300026035 | Bacteria | 3032 |
| 242 | Ga0207703_10357318 | 3300026035 | Bacteria | 1346 |
| 243 | Ga0207639_10022893 | 3300026041 | Bacteria | 4506 |
| 244 | Ga0207678_10017701 | 3300026067 | Bacteria | 6257 |
| 245 | Ga0207678_10399546 | 3300026067 | Bacteria | 1190 |
| 246 | Ga0207708_10011303 | 3300026075 | Bacteria | 6646 |
| 247 | Ga0207708_10025614 | 3300026075 | Bacteria | 4464 |
| 248 | Ga0207648_10006412 | 3300026089 | Bacteria | 11694 |
| 249 | Ga0207648_10124461 | 3300026089 | Bacteria | 2268 |
| 250 | Ga0207676_10122216 | 3300026095 | Bacteria | 2198 |
| 251 | Ga0207676_10215743 | 3300026095 | Bacteria | 1705 |
| 252 | Ga0207674_10127787 | 3300026116 | Bacteria | 2506 |
| 253 | Ga0207675_100033231 | 3300026118 | Bacteria | 4807 |
| 254 | Ga0207683_10047318 | 3300026121 | Bacteria | 3767 |
| 255 | Ga0207683_10069648 | 3300026121 | Bacteria | 3107 |
| 256 | Ga0207683_10167096 | 3300026121 | Bacteria | 1991 |
| 257 | Ga0209967_1006036 | 3300027364 | Bacteria | 1635 |
| 258 | Ga0209981_1000108 | 3300027378 | Bacteria | 9363 |
| 259 | Ga0209981_1009684 | 3300027378 | Bacteria | 1320 |
| 260 | Ga0210000_1001906 | 3300027462 | Bacteria | 2949 |
| 261 | Ga0209968_1002752 | 3300027526 | Bacteria | 2639 |
| 262 | Ga0209999_1001768 | 3300027543 | Bacteria | 3748 |
| 263 | Ga0209999_1005358 | 3300027543 | Bacteria | 2309 |
| 264 | Ga0209970_1016912 | 3300027614 | Bacteria | 1219 |
| 265 | Ga0209971_1001897 | 3300027682 | Bacteria | 5117 |
| 266 | Ga0209966_1003426 | 3300027695 | Bacteria | 2669 |
| 267 | Ga0207428_10026893 | 3300027907 | Bacteria | 4793 |
| 268 | Ga0268266_10073587 | 3300028379 | Bacteria | 2965 |
| 269 | Ga0268265_10060002 | 3300028380 | Bacteria | 2913 |
| 270 | Ga0265337_1000071 | 3300028556 | Bacteria | 47429 |
| 271 | Ga0265318_10006909 | 3300028577 | Bacteria | 5175 |
| 272 | Ga0265318_10041305 | 3300028577 | Bacteria | 1754 |
| 273 | Ga0265338_10256976 | 3300028800 | Bacteria | 1286 |
| 274 | Ga0265330_10020279 | 3300031235 | Bacteria | 3037 |
| 275 | Ga0265332_10004771 | 3300031238 | Bacteria | 6316 |
| 276 | Ga0265328_10017370 | 3300031239 | Bacteria | 2786 |
| 277 | Ga0265325_10001522 | 3300031241 | Bacteria | 16252 |
| 278 | Ga0265325_10006017 | 3300031241 | Bacteria | 7420 |
| 279 | Ga0265325_10008016 | 3300031241 | Bacteria | 6266 |
| 280 | Ga0265325_10030664 | 3300031241 | Bacteria | 2882 |
| 281 | Ga0265325_10047880 | 3300031241 | Bacteria | 2212 |
| 282 | Ga0265329_10032809 | 3300031242 | Bacteria | 1681 |
| 283 | Ga0265340_10009642 | 3300031247 | Bacteria | 5175 |
| 284 | Ga0265340_10020870 | 3300031247 | Bacteria | 3362 |
| 285 | Ga0265339_10001047 | 3300031249 | Bacteria | 21072 |
| 286 | Ga0265339_10071657 | 3300031249 | Bacteria | 1845 |
| 287 | Ga0265331_10000872 | 3300031250 | Bacteria | 24581 |
| 288 | Ga0265316_10042203 | 3300031344 | Bacteria | 3647 |
| 289 | Ga0265313_10000977 | 3300031595 | Bacteria | 28255 |
| 290 | Ga0265314_10002632 | 3300031711 | Bacteria | 18095 |
| 291 | Ga0265342_10055983 | 3300031712 | Bacteria | 2339 |
| 292 | Ga0307411_10236922 | 3300032005 | Bacteria | 1426 |
| 293 | Ga0307415_100261794 | 3300032126 | Bacteria | 1412 |
| 294 | Ga0373948_0001038 | 3300034817 | Bacteria | 3738 |
| 295 | Ga0373958_0000067 | 3300034819 | Bacteria | 10448 |
| 296 | Ga0373959_0000605 | 3300034820 | Bacteria | 6302 |
| 297 | Ga0373926_0038725 | 3300035083 | Bacteria | 1699 |
| 298 | Ga0373928_0001080 | 3300035084 | Bacteria | 5386 |
| 299 | Ga0373928_0022443 | 3300035084 | Bacteria | 1339 |
| 300 | Ga0373929_0000479 | 3300035085 | Bacteria | 7659 |
| 301 | Ga0373940_0000423 | 3300035088 | Bacteria | 6449 |
| 302 | Ga0373949_0000398 | 3300035090 | Bacteria | 15159 |
| 303 | Ga0373951_0000207 | 3300035091 | Bacteria | 21222 |
| 304 | Ga0373952_0000046 | 3300035092 | Bacteria | 14781 |
| 305 | Ga0373932_0000529 | 3300035112 | Bacteria | 11735 |
| 306 | Ga0373936_0014420 | 3300035113 | Bacteria | 3021 |
| 307 | Ga0373936_0023790 | 3300035113 | Bacteria | 2389 |
| 308 | Ga0373939_0000159 | 3300035114 | Bacteria | 18873 |
| 309 | Ga0373939_0014094 | 3300035114 | Bacteria | 2069 |
| 310 | Ga0373941_0000017 | 3300035115 | Bacteria | 30339 |
| 311 | Ga0373945_0013465 | 3300035116 | Bacteria | 2730 |
| 312 | Ga0373953_0031612 | 3300035117 | Bacteria | 2060 |
| 313 | Ga0373953_0072067 | 3300035117 | Bacteria | 1426 |
| 314 | Ga0373954_0019942 | 3300035118 | Bacteria | 3027 |
| 315 | Ga0373954_0057652 | 3300035118 | Bacteria | 1829 |
| 316 | Ga0373957_0004052 | 3300035120 | Bacteria | 4415 |
| 317 | Ga0373960_0000896 | 3300035121 | Bacteria | 6327 |
| 318 | Ga0373943_0004464 | 3300035170 | Bacteria | 6333 |
| 319 | Ga0373955_0000530 | 3300035172 | Bacteria | 16128 |
| 320 | Ga0373955_0003218 | 3300035172 | Bacteria | 7154 |
| 321 | Ga0373942_0000086 | 3300035207 | Bacteria | 19988 |
| 322 | Ga0373961_0002182 | 3300035241 | Bacteria | 5193 |
| 323 | Ga0373962_0012862 | 3300035242 | Bacteria | 2113 |
| 324 | Ga0373962_0017725 | 3300035242 | Bacteria | 1848 |
| 325 | Ga0373924_0021780 | 3300035410 | Bacteria | 2501 |
| 326 | Ga0373931_0008078 | 3300035691 | Bacteria | 4980 |
| 327 | Ga0373931_0069082 | 3300035691 | Bacteria | 1924 |
| 328 | Ga0373931_0122941 | 3300035691 | Bacteria | 1485 |
| 329 | Ga0373935_0000108 | 3300035692 | Bacteria | 37623 |
| 330 | Ga0373935_0072350 | 3300035692 | Bacteria | 2226 |
| 331 | Ga0373935_0097026 | 3300035692 | Bacteria | 1938 |
| 332 | Ga0373927_0004068 | 3300035695 | Bacteria | 10319 |
| 333 | Ga0373927_0051665 | 3300035695 | Bacteria | 2658 |
| 334 | Ga0373933_0000591 | 3300035724 | Bacteria | 22690 |
| 335 | Ga0373933_0003638 | 3300035724 | Bacteria | 8542 |
| 336 | Ga0373947_0004424 | 3300035725 | Bacteria | 8242 |
| 337 | Ga0373947_0031657 | 3300035725 | Bacteria | 3114 |
| 338 | Ga0373947_0057763 | 3300035725 | Bacteria | 2349 |
| 339 | Ga0373937_0000007 | 3300036401 | Bacteria | 183537 |
| 340 | Ga0373937_0006142 | 3300036401 | Bacteria | 10342 |
| 341 | Ga0373925_0000011 | 3300037068 | Bacteria | 209840 |
| 342 | Ga0395900_0001925 | 3300037418 | Bacteria | 23563 |
| 343 | Ga0395900_0029817 | 3300037418 | Bacteria | 5600 |
| 344 | Ga0436364_1380890 | 3300037853 | Bacteria | 2469 |
| 345 | Ga0395901_0041809 | 3300038443 | Bacteria | 4751 |
| 346 | Ga0436365_1075974 | 3300039437 | Bacteria | 3375 |
| 347 | Ga0436363_0211948 | 3300039450 | Bacteria | 1585 |
| 348 | Ga0436363_1183097 | 3300039450 | Bacteria | 997 |
| 349 | Ga0451853_0997442 | 3300041512 | Bacteria | 1244 |
| 350 | Ga0439441_002576 | 3300042001 | Bacteria | 2573 |
| 351 | Ga0439443_004187 | 3300042003 | Bacteria | 1863 |
| 352 | Ga0439446_0031443 | 3300042156 | Unclassified | 1536 |
| 353 | Ga0439460_0000174 | 3300042461 | Bacteria | 12145 |
| 354 | Ga0450893_0010550 | 3300042532 | Bacteria | 1520 |
| 355 | Ga0453684_0040067 | 3300044712 | Bacteria | 6370 |
| 356 | Ga0495592_0000390 | 3300046454 | Bacteria | 34192 |
| 357 | Ga0495590_0093166 | 3300046457 | Bacteria | 1067 |
| 358 | Ga0495629_0022960 | 3300046459 | Bacteria | 4446 |
| 359 | Ga0495638_0192640 | 3300046460 | Bacteria | 1156 |
| 360 | Ga0495651_0009066 | 3300046462 | Bacteria | 7636 |
| 361 | Ga0495651_0028258 | 3300046462 | Bacteria | 4372 |
| 362 | Ga0495651_0136692 | 3300046462 | Bacteria | 1782 |
| 363 | Ga0495653_0000249 | 3300046463 | Bacteria | 43160 |
| 364 | Ga0495653_0041065 | 3300046463 | Bacteria | 3613 |
| 365 | Ga0495580_0032962 | 3300046472 | Bacteria | 3733 |
| 366 | Ga0495582_0082076 | 3300046473 | Bacteria | 1791 |
| 367 | Ga0495582_0090937 | 3300046473 | Bacteria | 1702 |
| 368 | Ga0495605_0075576 | 3300046474 | Bacteria | 1584 |
| 369 | Ga0495662_0134123 | 3300046476 | Bacteria | 1218 |
| 370 | Ga0495664_0000024 | 3300046477 | Bacteria | 126593 |
| 371 | Ga0495584_0037506 | 3300046491 | Unclassified | 2450 |
| 372 | Ga0495584_0144758 | 3300046491 | Bacteria | 1207 |
| 373 | Ga0495584_0146791 | 3300046491 | Bacteria | 1198 |
| 374 | Ga0495594_0011329 | 3300046499 | Bacteria | 4632 |
| 375 | Ga0495608_0000004 | 3300046511 | Bacteria | 355027 |
| 376 | Ga0495608_0125356 | 3300046511 | Bacteria | 1645 |
| 377 | Ga0495608_0178717 | 3300046511 | Bacteria | 1343 |
| 378 | Ga0495618_0000855 | 3300046514 | Bacteria | 21101 |
| 379 | Ga0495618_0048645 | 3300046514 | Bacteria | 2677 |
| 380 | Ga0495628_0000006 | 3300046516 | Bacteria | 306606 |
| 381 | Ga0495628_0269556 | 3300046516 | Bacteria | 1267 |
| 382 | Ga0495630_0000601 | 3300046517 | Bacteria | 26137 |
| 383 | Ga0495630_0134886 | 3300046517 | Bacteria | 1876 |
| 384 | Ga0495644_0019617 | 3300046523 | Bacteria | 2582 |
| 385 | Ga0495652_0000038 | 3300046529 | Bacteria | 129311 |
| 386 | Ga0495652_0124440 | 3300046529 | Bacteria | 2051 |
| 387 | Ga0495665_0048609 | 3300046531 | Bacteria | 2249 |
| 388 | Ga0495665_0181628 | 3300046531 | Bacteria | 1093 |
| 389 | Ga0495640_0000013 | 3300046533 | Bacteria | 172438 |
| 390 | Ga0495640_0056898 | 3300046533 | Bacteria | 2670 |
| 391 | Ga0495586_0077474 | 3300046535 | Bacteria | 1823 |
| 392 | Ga0495587_0000004 | 3300046536 | Bacteria | 358433 |
| 393 | Ga0495587_0011398 | 3300046536 | Bacteria | 5636 |
| 394 | Ga0495645_0000001 | 3300046543 | Bacteria | 657910 |
| 395 | Ga0495633_0039898 | 3300046558 | Bacteria | 2239 |
| 396 | Ga0495667_0000084 | 3300046559 | Bacteria | 67342 |
| 397 | Ga0495667_0202172 | 3300046559 | Bacteria | 1271 |
| 398 | Ga0495656_0019425 | 3300046615 | Plasmid | 2623 |
| 399 | Ga0495656_0059217 | 3300046615 | Bacteria | 1665 |
| 400 | Ga0495634_0000164 | 3300046642 | Bacteria | 60673 |
| 401 | Ga0495634_0025446 | 3300046642 | Bacteria | 4140 |
| 402 | Ga0495635_0000003 | 3300046663 | Bacteria | 390055 |
| 403 | Ga0495635_0220189 | 3300046663 | Bacteria | 1284 |
| 404 | Ga0495659_0046589 | 3300046664 | Bacteria | 1566 |
| 405 | Ga0495661_0105762 | 3300046665 | Bacteria | 1576 |
| 406 | Ga0495657_0000248 | 3300046675 | Bacteria | 49080 |
| 407 | Ga0495657_0058759 | 3300046675 | Bacteria | 2552 |
| 408 | Ga0495599_0000014 | 3300046678 | Bacteria | 177414 |
| 409 | Ga0495623_0000015 | 3300046679 | Bacteria | 117329 |
| 410 | Ga0495646_0000005 | 3300046680 | Bacteria | 266899 |
| 411 | Ga0495613_0011799 | 3300046689 | Bacteria | 6490 |
| 412 | Ga0495624_0113521 | 3300046690 | Bacteria | 1665 |
| 413 | Ga0495589_0140084 | 3300046794 | Bacteria | 1159 |
| 414 | Ga0495600_0000005 | 3300046809 | Bacteria | 171675 |
| 415 | Ga0495600_0026577 | 3300046809 | Bacteria | 3736 |
| 416 | Ga0495660_0145101 | 3300046810 | Bacteria | 1177 |
| 417 | Ga0495581_0035116 | 3300047315 | Bacteria | 2901 |
| 418 | Ga0495581_0101323 | 3300047315 | Bacteria | 1673 |
| 419 | Ga0495604_0000002 | 3300047317 | Bacteria | 530904 |
| 420 | Ga0495604_0050251 | 3300047317 | Bacteria | 3238 |
| 421 | Ga0495674_0000004 | 3300047319 | Bacteria | 531855 |
| 422 | Ga0495674_0167199 | 3300047319 | Bacteria | 1837 |
| 423 | Ga0495672_0154403 | 3300047320 | Bacteria | 1187 |
| 424 | Ga0495676_0086728 | 3300047321 | Bacteria | 2354 |
| 425 | Ga0495680_0000142 | 3300047322 | Bacteria | 72324 |
| 426 | Ga0495680_0006220 | 3300047322 | Bacteria | 11128 |
| 427 | Ga0495675_0000053 | 3300047444 | Bacteria | 78760 |
| 428 | Ga0495685_082661 | 3300047447 | Bacteria | 1069 |
| 429 | Ga0495684_0000004 | 3300047471 | Bacteria | 307093 |
| 430 | Ga0495593_0001399 | 3300047673 | Bacteria | 14116 |
| 431 | Ga0495602_0000001 | 3300048088 | Bacteria | 510904 |
| 432 | Ga0495602_0039913 | 3300048088 | Bacteria | 4315 |
| 433 | Ga0495602_0130553 | 3300048088 | Bacteria | 2005 |
| 434 | Ga0496100_0068911 | 3300048903 | Bacteria | 2354 |
| 435 | Ga0496100_0089764 | 3300048903 | Bacteria | 2094 |
| 436 | Ga0496100_0096916 | 3300048903 | Bacteria | 2024 |
| 437 | Ga0496100_0159034 | 3300048903 | Bacteria | 1618 |
| 438 | Ga0496101_0074509 | 3300048904 | Bacteria | 2496 |
| 439 | Ga0496101_0076402 | 3300048904 | Bacteria | 2467 |
| 440 | Ga0496101_0095218 | 3300048904 | Bacteria | 2221 |
| 441 | Ga0496102_0030973 | 3300048905 | Bacteria | 4792 |
| 442 | Ga0496102_0102351 | 3300048905 | Bacteria | 2662 |
| 443 | Ga0496103_0021838 | 3300048906 | Bacteria | 3852 |
| 444 | Ga0496103_0022327 | 3300048906 | Bacteria | 3810 |
| 445 | Ga0496103_0115703 | 3300048906 | Bacteria | 1706 |
| 446 | Ga0496104_0000778 | 3300048907 | Bacteria | 27299 |
| 447 | Ga0496104_0004804 | 3300048907 | Bacteria | 11771 |
| 448 | Ga0496104_0020957 | 3300048907 | Bacteria | 5996 |
| 449 | Ga0496104_0175869 | 3300048907 | Bacteria | 2051 |
| 450 | Ga0496104_0187123 | 3300048907 | Bacteria | 1981 |
| 451 | Ga0496104_0202937 | 3300048907 | Bacteria | 1894 |
| 452 | Ga0496105_0016531 | 3300048908 | Bacteria | 5892 |
| 453 | Ga0496105_0051610 | 3300048908 | Bacteria | 3397 |
| 454 | Ga0496105_0071122 | 3300048908 | Bacteria | 2876 |
| 455 | Ga0496105_0089361 | 3300048908 | Bacteria | 2545 |
| 456 | Ga0496105_0177211 | 3300048908 | Bacteria | 1746 |
| 457 | Ga0496106_0009665 | 3300048909 | Bacteria | 7123 |
| 458 | Ga0496106_0022495 | 3300048909 | Bacteria | 4684 |
| 459 | Ga0496106_0041752 | 3300048909 | Bacteria | 3438 |
| 460 | Ga0496106_0140498 | 3300048909 | Bacteria | 1899 |
| 461 | Ga0496107_0010821 | 3300048910 | Bacteria | 6348 |
| 462 | Ga0496107_0152874 | 3300048910 | Bacteria | 1708 |
| 463 | Ga0496108_0003559 | 3300048911 | Bacteria | 12495 |
| 464 | Ga0496108_0181836 | 3300048911 | Bacteria | 1821 |
| 465 | Ga0496109_0001664 | 3300048912 | Bacteria | 18514 |
| 466 | Ga0496109_0025511 | 3300048912 | Bacteria | 5267 |
| 467 | Ga0496109_0052080 | 3300048912 | Bacteria | 3730 |
| 468 | Ga0496109_0192627 | 3300048912 | Bacteria | 1916 |
| 469 | Ga0496109_0302713 | 3300048912 | Bacteria | 1508 |
| 470 | Ga0496110_0008663 | 3300048913 | Bacteria | 8191 |
| 471 | Ga0496110_0055123 | 3300048913 | Bacteria | 3497 |
| 472 | Ga0496110_0259462 | 3300048913 | Bacteria | 1582 |
| 473 | Ga0496110_0265606 | 3300048913 | Bacteria | 1562 |
| 474 | Ga0496111_0038752 | 3300048914 | Bacteria | 3415 |
| 475 | Ga0496111_0056561 | 3300048914 | Bacteria | 2838 |
| 476 | Ga0496111_0063984 | 3300048914 | Bacteria | 2668 |
| 477 | Ga0496111_0099479 | 3300048914 | Bacteria | 2136 |
| 478 | Ga0496112_0123197 | 3300048915 | Bacteria | 2563 |
| 479 | Ga0496112_0124243 | 3300048915 | Bacteria | 2551 |
| 480 | Ga0496112_0172695 | 3300048915 | Bacteria | 2127 |
| 481 | Ga0496113_0001475 | 3300048916 | Bacteria | 13126 |
| 482 | Ga0496113_0204792 | 3300048916 | Bacteria | 1569 |
| 483 | Ga0496114_0007227 | 3300048917 | Bacteria | 8771 |
| 484 | Ga0496114_0007386 | 3300048917 | Bacteria | 8684 |
| 485 | Ga0496114_0134337 | 3300048917 | Bacteria | 2138 |
| 486 | Ga0496115_0015056 | 3300048918 | Bacteria | 5862 |
| 487 | Ga0496115_0126846 | 3300048918 | Bacteria | 2102 |
| 488 | Ga0496115_0178949 | 3300048918 | Bacteria | 1753 |
| 489 | Ga0496115_0235489 | 3300048918 | Bacteria | 1509 |
| 490 | Ga0501031_0032599 | 3300049568 | Bacteria | 3397 |
| 491 | Ga0501031_0239871 | 3300049568 | Bacteria | 1179 |
| 492 | Ga0501032_0017659 | 3300049569 | Bacteria | 5007 |
| 493 | Ga0501033_0043257 | 3300049570 | Bacteria | 3355 |
| 494 | Ga0501034_0258739 | 3300049571 | Bacteria | 1684 |
| 495 | Ga0501036_0003271 | 3300049572 | Bacteria | 12923 |
| 496 | Ga0501036_0004299 | 3300049572 | Bacteria | 11505 |
| 497 | Ga0501036_0134215 | 3300049572 | Bacteria | 2089 |
| 498 | Ga0501037_0026706 | 3300049573 | Bacteria | 4266 |
| 499 | Ga0501038_0001109 | 3300049574 | Bacteria | 24402 |
| 500 | Ga0501038_0038044 | 3300049574 | Bacteria | 4214 |
| 501 | Ga0501038_0065552 | 3300049574 | Bacteria | 3094 |
| 502 | Ga0501039_0015991 | 3300049575 | Bacteria | 5745 |
| 503 | Ga0501039_0092803 | 3300049575 | Bacteria | 2353 |
| 504 | Ga0501040_0001909 | 3300049576 | Bacteria | 13402 |
| 505 | Ga0501040_0026531 | 3300049576 | Bacteria | 3897 |
| 506 | Ga0501041_0003730 | 3300049577 | Bacteria | 8760 |
| 507 | Ga0501041_0137314 | 3300049577 | Bacteria | 1524 |
| 508 | Ga0501041_0173652 | 3300049577 | Unclassified | 1349 |
| 509 | Ga0501042_0000383 | 3300049578 | Bacteria | 22452 |
| 510 | Ga0501043_0039655 | 3300049579 | Bacteria | 3701 |
| 511 | Ga0501046_0001197 | 3300049580 | Bacteria | 25219 |
| 512 | Ga0501046_0005257 | 3300049580 | Bacteria | 11575 |
| 513 | Ga0501047_0131279 | 3300049581 | Bacteria | 2385 |
| 514 | Ga0501047_0136435 | 3300049581 | Bacteria | 2334 |
| 515 | Ga0501047_0192866 | 3300049581 | Bacteria | 1900 |
| 516 | Ga0501048_0030146 | 3300049582 | Bacteria | 3927 |
| 517 | Ga0501067_0047518 | 3300049583 | Bacteria | 2380 |
| 518 | Ga0501068_0009855 | 3300049584 | Bacteria | 5352 |
| 519 | Ga0501069_0001350 | 3300049585 | Bacteria | 12034 |
| 520 | Ga0501070_0015678 | 3300049586 | Bacteria | 6370 |
| 521 | Ga0501071_0011854 | 3300049587 | Bacteria | 5886 |
| 522 | Ga0501071_0020152 | 3300049587 | Bacteria | 4633 |
| 523 | Ga0501071_0030315 | 3300049587 | Bacteria | 3825 |
| 524 | Ga0501071_0044594 | 3300049587 | Bacteria | 3181 |
| 525 | Ga0501071_0184277 | 3300049587 | Bacteria | 1565 |
| 526 | Ga0501072_0001948 | 3300049588 | Bacteria | 15375 |
| 527 | Ga0501072_0002470 | 3300049588 | Bacteria | 13847 |
| 528 | Ga0501072_0022536 | 3300049588 | Bacteria | 4884 |
| 529 | Ga0501072_0102115 | 3300049588 | Bacteria | 2279 |
| 530 | Ga0501072_0359785 | 3300049588 | Bacteria | 1155 |
| 531 | Ga0501073_0064750 | 3300049589 | Bacteria | 2549 |
| 532 | Ga0501073_0098535 | 3300049589 | Bacteria | 2030 |
| 533 | Ga0501074_0014399 | 3300049590 | Bacteria | 5757 |
| 534 | Ga0501075_0000525 | 3300049591 | Bacteria | 23161 |
| 535 | Ga0501075_0004827 | 3300049591 | Bacteria | 9175 |
| 536 | Ga0501075_0007402 | 3300049591 | Bacteria | 7617 |
| 537 | Ga0501075_0263951 | 3300049591 | Bacteria | 1312 |
| 538 | Ga0501076_0001958 | 3300049592 | Bacteria | 14062 |
| 539 | Ga0501076_0013583 | 3300049592 | Bacteria | 6108 |
| 540 | Ga0501076_0095303 | 3300049592 | Bacteria | 2397 |
| 541 | Ga0501076_0257007 | 3300049592 | Bacteria | 1430 |
| 542 | Ga0501077_0031416 | 3300049593 | Bacteria | 3378 |
| 543 | Ga0501079_0000625 | 3300049741 | Bacteria | 23469 |
| 544 | Ga0501079_0015914 | 3300049741 | Bacteria | 5748 |
| 545 | Ga0501079_0018731 | 3300049741 | Bacteria | 5289 |
| 546 | Ga0501079_0145992 | 3300049741 | Bacteria | 1843 |
| 547 | Ga0501080_0054849 | 3300049742 | Bacteria | 3711 |
| 548 | Ga0501080_0110457 | 3300049742 | Bacteria | 2548 |
| 549 | Ga0501081_0000055 | 3300049743 | Bacteria | 43227 |
| 550 | Ga0501081_0061523 | 3300049743 | Bacteria | 2603 |
| 551 | Ga0501081_0322119 | 3300049743 | Bacteria | 1136 |
| 552 | Ga0501083_0006890 | 3300049744 | Bacteria | 8069 |
| 553 | Ga0501044_0000351 | 3300049823 | Bacteria | 57748 |
| 554 | Ga0501044_0005311 | 3300049823 | Bacteria | 14327 |
| 555 | Ga0501044_0049886 | 3300049823 | Bacteria | 4321 |
| 556 | Ga0501044_0155218 | 3300049823 | Bacteria | 2269 |
| 557 | Ga0501045_0000901 | 3300049824 | Bacteria | 19335 |
| 558 | Ga0501045_0006242 | 3300049824 | Bacteria | 8246 |
| 559 | Ga0501045_0015157 | 3300049824 | Bacteria | 5472 |
| 560 | nmdc:mga03683_151558_c1 | 3300050489 | Bacteria | 1046 |
| 561 | nmdc:mga03683_24348_c1 | 3300050489 | Bacteria | 2368 |
| 562 | nmdc:mga03n38_26262_c1 | 3300050490 | Bacteria | 2403 |
| 563 | nmdc:mga03n38_45095_c1 | 3300050490 | Bacteria | 1940 |
| 564 | nmdc:mga03n38_59542_c1 | 3300050490 | Bacteria | 1734 |
| 565 | nmdc:mga00v17_45378_c1 | 3300050491 | Bacteria | 2655 |
| 566 | nmdc:mga00v17_7422_c1 | 3300050491 | Bacteria | 5850 |
| 567 | nmdc:mga0yw44_100884_c1 | 3300050492 | Bacteria | 1839 |
| 568 | nmdc:mga0yw44_78772_c1 | 3300050492 | Bacteria | 2061 |
| 569 | nmdc:mga0k408_143465_c1 | 3300050493 | Bacteria | 1421 |
| 570 | nmdc:mga0k408_153514_c1 | 3300050493 | Bacteria | 1371 |
| 571 | nmdc:mga0k408_194752_c1 | 3300050493 | Bacteria | 1210 |
| 572 | nmdc:mga06z11_272209_c1 | 3300050494 | Bacteria | 1001 |
| 573 | nmdc:mga06z11_42366_c1 | 3300050494 | Bacteria | 2283 |
| 574 | nmdc:mga05p37_223_c1 | 3300050507 | Bacteria | 57418 |
| 575 | nmdc:mga05p37_325786_c1 | 3300050507 | Bacteria | 1817 |
| 576 | nmdc:mga05p37_46700_c1 | 3300050507 | Bacteria | 5324 |
| 577 | nmdc:mga05p37_540137_c1 | 3300050507 | Bacteria | 1329 |
| 578 | nmdc:mga05p37_56359_c1 | 3300050507 | Bacteria | 4838 |
| 579 | nmdc:mga05p37_589816_c1 | 3300050507 | Bacteria | 1257 |
| 580 | nmdc:mga09592_135171_c1 | 3300050508 | Bacteria | 2123 |
| 581 | nmdc:mga09592_14238_c1 | 3300050508 | Bacteria | 6493 |
| 582 | nmdc:mga09592_152742_c1 | 3300050508 | Bacteria | 1992 |
| 583 | nmdc:mga09592_17457_c1 | 3300050508 | Bacteria | 5880 |
| 584 | nmdc:mga09592_27300_c1 | 3300050508 | Bacteria | 4737 |
| 585 | nmdc:mga09592_7453_c1 | 3300050508 | Bacteria | 8891 |
| 586 | nmdc:mga09592_8032_c1 | 3300050508 | Bacteria | 8581 |
| 587 | nmdc:mga09592_83861_c1 | 3300050508 | Bacteria | 2717 |
| 588 | nmdc:mga09592_84627_c1 | 3300050508 | Bacteria | 2704 |
| 589 | nmdc:mga09592_9213_c1 | 3300050508 | Bacteria | 8030 |
| 590 | nmdc:mga0qj67_11276_c1 | 3300050509 | Bacteria | 6694 |
| 591 | nmdc:mga0qj67_1416_c1 | 3300050509 | Bacteria | 16782 |
| 592 | nmdc:mga0qj67_14241_c1 | 3300050509 | Bacteria | 6011 |
| 593 | nmdc:mga0qj67_16218_c1 | 3300050509 | Bacteria | 5646 |
| 594 | nmdc:mga0qj67_3966_c1 | 3300050509 | Bacteria | 10709 |
| 595 | nmdc:mga06r32_1449_c1 | 3300050510 | Bacteria | 21429 |
| 596 | nmdc:mga06r32_17056_c1 | 3300050510 | Bacteria | 6627 |
| 597 | nmdc:mga06r32_210759_c1 | 3300050510 | Bacteria | 1931 |
| 598 | nmdc:mga06r32_39246_c1 | 3300050510 | Bacteria | 4492 |
| 599 | nmdc:mga08y16_118764_c1 | 3300050511 | Bacteria | 2752 |
| 600 | nmdc:mga08y16_5989_c1 | 3300050511 | Bacteria | 12747 |
| 601 | nmdc:mga08y16_813_c1 | 3300050511 | Bacteria | 29890 |
| 602 | nmdc:mga0n895_63420_c1 | 3300050512 | Bacteria | 3654 |
| 603 | nmdc:mga0n895_73026_c1 | 3300050512 | Bacteria | 3405 |
| 604 | nmdc:mga0rr50_134532_c1 | 3300050513 | Bacteria | 1983 |
| 605 | nmdc:mga0rr50_244815_c1 | 3300050513 | Bacteria | 1487 |
| 606 | nmdc:mga0a205_12766_c1 | 3300050515 | Bacteria | 7789 |
| 607 | nmdc:mga0a205_62538_c1 | 3300050515 | Bacteria | 3596 |
| 608 | nmdc:mga0sz30_28053_c1 | 3300050516 | Bacteria | 2315 |
| 609 | Ga0495601_0000026 | 3300053077 | Bacteria | 126257 |
| 610 | Ga0495601_0002532 | 3300053077 | Bacteria | 10391 |
| 611 | Ga0495601_0284322 | 3300053077 | Bacteria | 1078 |
| 612 | Ga0495612_0000005 | 3300053078 | Bacteria | 286943 |
| 613 | Ga0495655_0074377 | 3300053083 | Bacteria | 957 |
| 614 | Ga0495595_0000065 | 3300053084 | Bacteria | 52635 |
| 615 | Ga0495595_0054768 | 3300053084 | Bacteria | 1855 |
| 616 | Ga0495619_0000003 | 3300053085 | Bacteria | 515784 |
| 617 | Ga0495619_0006125 | 3300053085 | Bacteria | 7619 |
| 618 | Ga0495619_0042256 | 3300053085 | Bacteria | 2984 |
| 619 | Ga0495619_0047217 | 3300053085 | Bacteria | 2835 |
| 620 | Ga0495619_0050494 | 3300053085 | Bacteria | 2746 |
| 621 | Ga0495619_0078690 | 3300053085 | Bacteria | 2217 |
| 622 | Ga0500643_000795 | 3300053087 | Bacteria | 20468 |
| 623 | Ga0500562_025786 | 3300053108 | Bacteria | 1540 |
| 624 | Ga0500595_000001 | 3300053119 | Bacteria | 1088438 |
| 625 | Ga0500595_042929 | 3300053119 | Bacteria | 1443 |
| 626 | Ga0500642_0055327 | 3300053130 | Bacteria | 1765 |
| 627 | Ga0500658_0059366 | 3300053134 | Bacteria | 1587 |
| 628 | Ga0500616_0111110 | 3300053153 | Bacteria | 1323 |
| 629 | Ga0501084_0002498 | 3300054114 | Bacteria | 14797 |
| 630 | Ga0501084_0029050 | 3300054114 | Bacteria | 4624 |
| 631 | Ga0501084_0033744 | 3300054114 | Bacteria | 4281 |
| 632 | Ga0501084_0073459 | 3300054114 | Bacteria | 2864 |
| 633 | Ga0501084_0106624 | 3300054114 | Bacteria | 2354 |
| 634 | Ga0501084_0110965 | 3300054114 | Bacteria | 2305 |
| 635 | Ga0501084_0187481 | 3300054114 | Bacteria | 1745 |
| 636 | Ga0501082_0000013 | 3300060353 | Bacteria | 119623 |
| 637 | Ga0501082_0008950 | 3300060353 | Bacteria | 8640 |
| 638 | Ga0501082_0029062 | 3300060353 | Bacteria | 4762 |
| 639 | Ga0501082_0046577 | 3300060353 | Bacteria | 3737 |
| 640 | Ga0501082_0086514 | 3300060353 | Bacteria | 2704 |
| 641 | Ga0501082_0147560 | 3300060353 | Bacteria | 2042 |
| 642 | Ga0501082_0173806 | 3300060353 | Bacteria | 1873 |
| 643 | Ga0530510_0001004 | 3300061734 | Bacteria | 18744 |
| 644 | Ga0530510_0028198 | 3300061734 | Bacteria | 4026 |
| 645 | Ga0530510_0055810 | 3300061734 | Bacteria | 2853 |
| 646 | Ga0530510_0094400 | 3300061734 | Bacteria | 2185 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005455 | Ga0070663_100229800 | Ga0070663_1002298002 | 286 |
| 2 | 3300035692 | Ga0373935_0072350 | Ga0373935_0072350_21_893 | 289 |
| 3 | 3300049590 | Ga0501074_0014399 | Ga0501074_0014399_4852_5733 | 289 |
| 4 | 3300049743 | Ga0501081_0061523 | Ga0501081_0061523_24_899 | 290 |
| 5 | 3300053083 | Ga0495655_0074377 | Ga0495655_0074377_71_946 | 291 |
| 6 | 3300005340 | Ga0070689_100030900 | Ga0070689_1000309004 | 293 |
| 7 | 3300005355 | Ga0070671_100111507 | Ga0070671_1001115071 | 293 |
| 8 | 3300006177 | Ga0075362_10055847 | Ga0075362_100558472 | 293 |
| 9 | 3300009148 | Ga0105243_10108404 | Ga0105243_101084042 | 293 |
| 10 | 3300009176 | Ga0105242_10049576 | Ga0105242_100495763 | 293 |
| 11 | 3300009177 | Ga0105248_10030282 | Ga0105248_100302825 | 293 |
| 12 | 3300013306 | Ga0163162_10306838 | Ga0163162_103068382 | 293 |
| 13 | 3300013308 | Ga0157375_10882193 | Ga0157375_108821931 | 293 |
| 14 | 3300014326 | Ga0157380_10223784 | Ga0157380_102237842 | 293 |
| 15 | 3300014326 | Ga0157380_10392092 | Ga0157380_103920921 | 293 |
| 16 | 3300025901 | Ga0207688_10001481 | Ga0207688_100014812 | 293 |
| 17 | 3300025907 | Ga0207645_10022680 | Ga0207645_100226804 | 293 |
| 18 | 3300025923 | Ga0207681_10126196 | Ga0207681_101261962 | 293 |
| 19 | 3300026095 | Ga0207676_10122216 | Ga0207676_101222162 | 293 |
| 20 | 3300035242 | Ga0373962_0012862 | Ga0373962_0012862_751_1725 | 293 |
| 21 | 3300035691 | Ga0373931_0069082 | Ga0373931_0069082_119_1093 | 293 |
| 22 | 3300048903 | Ga0496100_0089764 | Ga0496100_0089764_626_1600 | 293 |
| 23 | 3300048908 | Ga0496105_0177211 | Ga0496105_0177211_104_1078 | 293 |
| 24 | 3300048910 | Ga0496107_0152874 | Ga0496107_0152874_611_1585 | 293 |
| 25 | 3300048914 | Ga0496111_0099479 | Ga0496111_0099479_48_1022 | 293 |
| 26 | 3300048915 | Ga0496112_0123197 | Ga0496112_0123197_735_1709 | 293 |
| 27 | 3300048917 | Ga0496114_0007386 | Ga0496114_0007386_3894_4868 | 293 |
| 28 | 3300048918 | Ga0496115_0178949 | Ga0496115_0178949_230_1204 | 293 |
| 29 | 3300050489 | nmdc:mga03683_151558_c1 | nmdc:mga03683_151558_c1_31_1014 | 293 |
| 30 | 3300005338 | Ga0068868_100278749 | Ga0068868_1002787492 | 296 |
| 31 | 3300005353 | Ga0070669_100145768 | Ga0070669_1001457682 | 296 |
| 32 | 3300005355 | Ga0070671_100075882 | Ga0070671_1000758822 | 296 |
| 33 | 3300005367 | Ga0070667_100024257 | Ga0070667_1000242573 | 296 |
| 34 | 3300005456 | Ga0070678_100170885 | Ga0070678_1001708851 | 296 |
| 35 | 3300005543 | Ga0070672_100062522 | Ga0070672_1000625223 | 296 |
| 36 | 3300005618 | Ga0068864_100018958 | Ga0068864_1000189583 | 296 |
| 37 | 3300006358 | Ga0068871_100013831 | Ga0068871_1000138314 | 296 |
| 38 | 3300009147 | Ga0114129_10836592 | Ga0114129_108365921 | 296 |
| 39 | 3300014969 | Ga0157376_10066864 | Ga0157376_100668643 | 296 |
| 40 | 3300025923 | Ga0207681_10045506 | Ga0207681_100455062 | 296 |
| 41 | 3300005295 | Ga0065707_10127840 | Ga0065707_101278402 | 297 |
| 42 | 3300005364 | Ga0070673_100091157 | Ga0070673_1000911572 | 297 |
| 43 | 3300006038 | Ga0075365_10223467 | Ga0075365_102234672 | 297 |
| 44 | 3300006042 | Ga0075368_10007461 | Ga0075368_100074612 | 297 |
| 45 | 3300006177 | Ga0075362_10038928 | Ga0075362_100389282 | 297 |
| 46 | 3300006186 | Ga0075369_10058854 | Ga0075369_100588542 | 297 |
| 47 | 3300009553 | Ga0105249_10661184 | Ga0105249_106611842 | 297 |
| 48 | 3300025315 | Ga0207697_10078734 | Ga0207697_100787342 | 297 |
| 49 | 3300049592 | Ga0501076_0257007 | Ga0501076_0257007_94_1047 | 297 |
| 50 | 3300050490 | nmdc:mga03n38_45095_c1 | nmdc:mga03n38_45095_c1_178_1155 | 297 |
| 51 | 3300050490 | nmdc:mga03n38_59542_c1 | nmdc:mga03n38_59542_c1_374_1351 | 297 |
| 52 | 3300050491 | nmdc:mga00v17_7422_c1 | nmdc:mga00v17_7422_c1_4776_5753 | 297 |
| 53 | 3300050493 | nmdc:mga0k408_194752_c1 | nmdc:mga0k408_194752_c1_65_1054 | 297 |
| 54 | 3300050516 | nmdc:mga0sz30_28053_c1 | nmdc:mga0sz30_28053_c1_695_1672 | 297 |
| 55 | 3300053108 | Ga0500562_025786 | Ga0500562_025786_149_1141 | 297 |
| 56 | 3300054114 | Ga0501084_0110965 | Ga0501084_0110965_949_1920 | 297 |
| 57 | 3300005547 | Ga0070693_100188318 | Ga0070693_1001883181 | 298 |
| 58 | 3300005981 | Ga0081538_10037286 | Ga0081538_100372862 | 298 |
| 59 | 3300006844 | Ga0075428_100143852 | Ga0075428_1001438521 | 298 |
| 60 | 3300009147 | Ga0114129_10025557 | Ga0114129_100255576 | 298 |
| 61 | 3300009174 | Ga0105241_10163927 | Ga0105241_101639272 | 298 |
| 62 | 3300049577 | Ga0501041_0173652 | Ga0501041_0173652_379_1332 | 298 |
| 63 | 3300050507 | nmdc:mga05p37_46700_c1 | nmdc:mga05p37_46700_c1_1073_2083 | 298 |
| 64 | 3300053119 | Ga0500595_042929 | Ga0500595_042929_343_1320 | 298 |
| 65 | 3300005983 | Ga0081540_1001200 | Ga0081540_10012006 | 299 |
| 66 | 3300006844 | Ga0075428_100401542 | Ga0075428_1004015421 | 299 |
| 67 | 3300009147 | Ga0114129_10087647 | Ga0114129_100876472 | 299 |
| 68 | 3300009147 | Ga0114129_10100816 | Ga0114129_101008163 | 299 |
| 69 | 3300027682 | Ga0209971_1001897 | Ga0209971_10018972 | 299 |
| 70 | 3300027695 | Ga0209966_1003426 | Ga0209966_10034264 | 299 |
| 71 | 3300042001 | Ga0439441_002576 | Ga0439441_002576_991_1968 | 299 |
| 72 | 3300042003 | Ga0439443_004187 | Ga0439443_004187_378_1355 | 299 |
| 73 | 3300046473 | Ga0495582_0082076 | Ga0495582_0082076_118_1062 | 299 |
| 74 | 3300046491 | Ga0495584_0146791 | Ga0495584_0146791_161_1063 | 299 |
| 75 | 3300046664 | Ga0495659_0046589 | Ga0495659_0046589_30_932 | 299 |
| 76 | 3300049592 | Ga0501076_0001958 | Ga0501076_0001958_2385_3356 | 299 |
| 77 | 3300049741 | Ga0501079_0145992 | Ga0501079_0145992_719_1690 | 299 |
| 78 | 3300050508 | nmdc:mga09592_7453_c1 | nmdc:mga09592_7453_c1_5218_6120 | 299 |
| 79 | 3300054114 | Ga0501084_0187481 | Ga0501084_0187481_130_1101 | 299 |
| 80 | 3300028577 | Ga0265318_10041305 | Ga0265318_100413053 | 300 |
| 81 | 3300031235 | Ga0265330_10020279 | Ga0265330_100202792 | 300 |
| 82 | 3300031241 | Ga0265325_10008016 | Ga0265325_100080166 | 300 |
| 83 | 3300031247 | Ga0265340_10020870 | Ga0265340_100208703 | 300 |
| 84 | 3300031249 | Ga0265339_10071657 | Ga0265339_100716572 | 300 |
| 85 | 3300006880 | Ga0075429_100165815 | Ga0075429_1001658152 | 301 |
| 86 | 3300009147 | Ga0114129_10381487 | Ga0114129_103814872 | 301 |
| 87 | 3300050508 | nmdc:mga09592_17457_c1 | nmdc:mga09592_17457_c1_3317_4291 | 301 |
| 88 | 3300005530 | Ga0070679_100264309 | Ga0070679_1002643091 | 302 |
| 89 | 3300025921 | Ga0207652_10170343 | Ga0207652_101703432 | 302 |
| 90 | 3300046491 | Ga0495584_0144758 | Ga0495584_0144758_57_1001 | 302 |
| 91 | 3300049570 | Ga0501033_0043257 | Ga0501033_0043257_177_1148 | 302 |
| 92 | 3300049576 | Ga0501040_0026531 | Ga0501040_0026531_1104_2075 | 302 |
| 93 | 3300049591 | Ga0501075_0007402 | Ga0501075_0007402_6419_7390 | 302 |
| 94 | 3300049823 | Ga0501044_0155218 | Ga0501044_0155218_12_980 | 302 |
| 95 | 3300060353 | Ga0501082_0029062 | Ga0501082_0029062_116_1087 | 302 |
| 96 | 3300061734 | Ga0530510_0055810 | Ga0530510_0055810_1548_2519 | 302 |
| 97 | 3300005329 | Ga0070683_100310475 | Ga0070683_1003104752 | 303 |
| 98 | 3300005328 | Ga0070676_10031436 | Ga0070676_100314362 | 304 |
| 99 | 3300005330 | Ga0070690_100023376 | Ga0070690_1000233763 | 304 |
| 100 | 3300005340 | Ga0070689_100071554 | Ga0070689_1000715542 | 304 |
| 101 | 3300005347 | Ga0070668_100235344 | Ga0070668_1002353442 | 304 |
| 102 | 3300005355 | Ga0070671_100069285 | Ga0070671_1000692851 | 304 |
| 103 | 3300005457 | Ga0070662_100100583 | Ga0070662_1001005832 | 304 |
| 104 | 3300005459 | Ga0068867_100185278 | Ga0068867_1001852782 | 304 |
| 105 | 3300005578 | Ga0068854_100289669 | Ga0068854_1002896691 | 304 |
| 106 | 3300005615 | Ga0070702_100120695 | Ga0070702_1001206952 | 304 |
| 107 | 3300005841 | Ga0068863_100107054 | Ga0068863_1001070542 | 304 |
| 108 | 3300006028 | Ga0070717_10145746 | Ga0070717_101457461 | 304 |
| 109 | 3300006881 | Ga0068865_100081952 | Ga0068865_1000819522 | 304 |
| 110 | 3300009094 | Ga0111539_10097638 | Ga0111539_100976382 | 304 |
| 111 | 3300009148 | Ga0105243_10076587 | Ga0105243_100765872 | 304 |
| 112 | 3300009176 | Ga0105242_10386853 | Ga0105242_103868531 | 304 |
| 113 | 3300009553 | Ga0105249_10244064 | Ga0105249_102440641 | 304 |
| 114 | 3300011119 | Ga0105246_10178276 | Ga0105246_101782762 | 304 |
| 115 | 3300014325 | Ga0163163_10168951 | Ga0163163_101689511 | 304 |
| 116 | 3300014969 | Ga0157376_10081402 | Ga0157376_100814022 | 304 |
| 117 | 3300025315 | Ga0207697_10007537 | Ga0207697_100075374 | 304 |
| 118 | 3300025893 | Ga0207682_10014593 | Ga0207682_100145932 | 304 |
| 119 | 3300025903 | Ga0207680_10035408 | Ga0207680_100354082 | 304 |
| 120 | 3300025933 | Ga0207706_10074680 | Ga0207706_100746802 | 304 |
| 121 | 3300025934 | Ga0207686_10124359 | Ga0207686_101243592 | 304 |
| 122 | 3300025942 | Ga0207689_10054189 | Ga0207689_100541893 | 304 |
| 123 | 3300026075 | Ga0207708_10025614 | Ga0207708_100256143 | 304 |
| 124 | 3300026089 | Ga0207648_10124461 | Ga0207648_101244611 | 304 |
| 125 | 3300026121 | Ga0207683_10167096 | Ga0207683_101670961 | 304 |
| 126 | 3300028577 | Ga0265318_10006909 | Ga0265318_100069092 | 304 |
| 127 | 3300031238 | Ga0265332_10004771 | Ga0265332_100047713 | 304 |
| 128 | 3300031239 | Ga0265328_10017370 | Ga0265328_100173702 | 304 |
| 129 | 3300031242 | Ga0265329_10032809 | Ga0265329_100328092 | 304 |
| 130 | 3300031250 | Ga0265331_10000872 | Ga0265331_100008722 | 304 |
| 131 | 3300031711 | Ga0265314_10002632 | Ga0265314_1000263217 | 304 |
| 132 | 3300031712 | Ga0265342_10055983 | Ga0265342_100559831 | 304 |
| 133 | 3300042156 | Ga0439446_0031443 | Ga0439446_0031443_221_1165 | 304 |
| 134 | 3300046511 | Ga0495608_0125356 | Ga0495608_0125356_326_1291 | 304 |
| 135 | 3300046516 | Ga0495628_0269556 | Ga0495628_0269556_23_1003 | 304 |
| 136 | 3300048088 | Ga0495602_0130553 | Ga0495602_0130553_853_1833 | 304 |
| 137 | 3300005439 | Ga0070711_100188084 | Ga0070711_1001880842 | 305 |
| 138 | 3300006844 | Ga0075428_100002569 | Ga0075428_1000025697 | 305 |
| 139 | 3300006880 | Ga0075429_100007197 | Ga0075429_10000719712 | 305 |
| 140 | 3300007076 | Ga0075435_100222802 | Ga0075435_1002228022 | 305 |
| 141 | 3300009094 | Ga0111539_10000584 | Ga0111539_1000058419 | 305 |
| 142 | 3300009147 | Ga0114129_10189803 | Ga0114129_101898033 | 305 |
| 143 | 3300010159 | Ga0099796_10001693 | Ga0099796_100016933 | 305 |
| 144 | 3300027378 | Ga0209981_1000108 | Ga0209981_10001089 | 305 |
| 145 | 3300027462 | Ga0210000_1001906 | Ga0210000_10019062 | 305 |
| 146 | 3300027526 | Ga0209968_1002752 | Ga0209968_10027522 | 305 |
| 147 | 3300027543 | Ga0209999_1001768 | Ga0209999_10017682 | 305 |
| 148 | 3300027614 | Ga0209970_1016912 | Ga0209970_10169121 | 305 |
| 149 | 3300037418 | Ga0395900_0001925 | Ga0395900_0001925_12697_13668 | 305 |
| 150 | 3300047673 | Ga0495593_0001399 | Ga0495593_0001399_336_1298 | 305 |
| 151 | 3300050508 | nmdc:mga09592_27300_c1 | nmdc:mga09592_27300_c1_2910_3893 | 305 |
| 152 | 3300050511 | nmdc:mga08y16_813_c1 | nmdc:mga08y16_813_c1_9790_10773 | 305 |
| 153 | 3300050513 | nmdc:mga0rr50_244815_c1 | nmdc:mga0rr50_244815_c1_373_1356 | 305 |
| 154 | 3300060353 | Ga0501082_0000013 | Ga0501082_0000013_38772_39731 | 305 |
| 155 | 3300005340 | Ga0070689_100052061 | Ga0070689_1000520612 | 306 |
| 156 | 3300005458 | Ga0070681_10367590 | Ga0070681_103675901 | 306 |
| 157 | 3300005468 | Ga0070707_100565696 | Ga0070707_1005656961 | 306 |
| 158 | 3300005471 | Ga0070698_100121843 | Ga0070698_1001218433 | 306 |
| 159 | 3300005937 | Ga0081455_10026170 | Ga0081455_100261705 | 306 |
| 160 | 3300005981 | Ga0081538_10001564 | Ga0081538_1000156419 | 306 |
| 161 | 3300005981 | Ga0081538_10058508 | Ga0081538_100585083 | 306 |
| 162 | 3300005983 | Ga0081540_1037669 | Ga0081540_10376693 | 306 |
| 163 | 3300006048 | Ga0075363_100004161 | Ga0075363_1000041613 | 306 |
| 164 | 3300006051 | Ga0075364_10011898 | Ga0075364_100118985 | 306 |
| 165 | 3300006177 | Ga0075362_10001383 | Ga0075362_100013837 | 306 |
| 166 | 3300006846 | Ga0075430_100007026 | Ga0075430_1000070266 | 306 |
| 167 | 3300006846 | Ga0075430_100067686 | Ga0075430_1000676862 | 306 |
| 168 | 3300006847 | Ga0075431_100031216 | Ga0075431_1000312164 | 306 |
| 169 | 3300006880 | Ga0075429_100021973 | Ga0075429_1000219735 | 306 |
| 170 | 3300006880 | Ga0075429_100036588 | Ga0075429_1000365884 | 306 |
| 171 | 3300009551 | Ga0105238_10372598 | Ga0105238_103725982 | 306 |
| 172 | 3300021384 | Ga0213876_10104694 | Ga0213876_101046942 | 306 |
| 173 | 3300025912 | Ga0207707_10303982 | Ga0207707_103039821 | 306 |
| 174 | 3300025917 | Ga0207660_10094826 | Ga0207660_100948262 | 306 |
| 175 | 3300025936 | Ga0207670_10099004 | Ga0207670_100990042 | 306 |
| 176 | 3300028800 | Ga0265338_10256976 | Ga0265338_102569762 | 306 |
| 177 | 3300031241 | Ga0265325_10001522 | Ga0265325_1000152214 | 306 |
| 178 | 3300031241 | Ga0265325_10047880 | Ga0265325_100478803 | 306 |
| 179 | 3300031247 | Ga0265340_10009642 | Ga0265340_100096422 | 306 |
| 180 | 3300035117 | Ga0373953_0031612 | Ga0373953_0031612_33_998 | 306 |
| 181 | 3300035118 | Ga0373954_0057652 | Ga0373954_0057652_150_1115 | 306 |
| 182 | 3300035120 | Ga0373957_0004052 | Ga0373957_0004052_2516_3481 | 306 |
| 183 | 3300035172 | Ga0373955_0003218 | Ga0373955_0003218_5981_6946 | 306 |
| 184 | 3300035724 | Ga0373933_0000591 | Ga0373933_0000591_3799_4764 | 306 |
| 185 | 3300036401 | Ga0373937_0006142 | Ga0373937_0006142_2959_3924 | 306 |
| 186 | 3300037418 | Ga0395900_0029817 | Ga0395900_0029817_1621_2571 | 306 |
| 187 | 3300037853 | Ga0436364_1380890 | Ga0436364_1380890_1001_1960 | 306 |
| 188 | 3300038443 | Ga0395901_0041809 | Ga0395901_0041809_396_1346 | 306 |
| 189 | 3300039437 | Ga0436365_1075974 | Ga0436365_1075974_1491_2450 | 306 |
| 190 | 3300046462 | Ga0495651_0028258 | Ga0495651_0028258_1556_2521 | 306 |
| 191 | 3300046463 | Ga0495653_0041065 | Ga0495653_0041065_2265_3335 | 306 |
| 192 | 3300046511 | Ga0495608_0178717 | Ga0495608_0178717_61_1026 | 306 |
| 193 | 3300046529 | Ga0495652_0124440 | Ga0495652_0124440_96_1061 | 306 |
| 194 | 3300046536 | Ga0495587_0011398 | Ga0495587_0011398_1891_2856 | 306 |
| 195 | 3300046559 | Ga0495667_0202172 | Ga0495667_0202172_278_1243 | 306 |
| 196 | 3300046615 | Ga0495656_0059217 | Ga0495656_0059217_399_1376 | 306 |
| 197 | 3300046675 | Ga0495657_0058759 | Ga0495657_0058759_1251_2216 | 306 |
| 198 | 3300046809 | Ga0495600_0026577 | Ga0495600_0026577_424_1389 | 306 |
| 199 | 3300047317 | Ga0495604_0050251 | Ga0495604_0050251_917_1987 | 306 |
| 200 | 3300047322 | Ga0495680_0006220 | Ga0495680_0006220_6443_7408 | 306 |
| 201 | 3300048088 | Ga0495602_0039913 | Ga0495602_0039913_1878_2843 | 306 |
| 202 | 3300048907 | Ga0496104_0175869 | Ga0496104_0175869_149_1108 | 306 |
| 203 | 3300049571 | Ga0501034_0258739 | Ga0501034_0258739_624_1595 | 306 |
| 204 | 3300049574 | Ga0501038_0065552 | Ga0501038_0065552_67_1017 | 306 |
| 205 | 3300049577 | Ga0501041_0137314 | Ga0501041_0137314_66_1031 | 306 |
| 206 | 3300049581 | Ga0501047_0192866 | Ga0501047_0192866_40_990 | 306 |
| 207 | 3300049587 | Ga0501071_0184277 | Ga0501071_0184277_421_1389 | 306 |
| 208 | 3300049588 | Ga0501072_0001948 | Ga0501072_0001948_6105_7091 | 306 |
| 209 | 3300049588 | Ga0501072_0022536 | Ga0501072_0022536_401_1366 | 306 |
| 210 | 3300049588 | Ga0501072_0102115 | Ga0501072_0102115_517_1488 | 306 |
| 211 | 3300049591 | Ga0501075_0263951 | Ga0501075_0263951_66_1031 | 306 |
| 212 | 3300049741 | Ga0501079_0018731 | Ga0501079_0018731_2253_3218 | 306 |
| 213 | 3300049823 | Ga0501044_0005311 | Ga0501044_0005311_4276_5226 | 306 |
| 214 | 3300050489 | nmdc:mga03683_24348_c1 | nmdc:mga03683_24348_c1_203_1153 | 306 |
| 215 | 3300050490 | nmdc:mga03n38_26262_c1 | nmdc:mga03n38_26262_c1_20_970 | 306 |
| 216 | 3300050491 | nmdc:mga00v17_45378_c1 | nmdc:mga00v17_45378_c1_1615_2565 | 306 |
| 217 | 3300050494 | nmdc:mga06z11_42366_c1 | nmdc:mga06z11_42366_c1_419_1369 | 306 |
| 218 | 3300050507 | nmdc:mga05p37_589816_c1 | nmdc:mga05p37_589816_c1_200_1177 | 306 |
| 219 | 3300050508 | nmdc:mga09592_14238_c1 | nmdc:mga09592_14238_c1_402_1370 | 306 |
| 220 | 3300050509 | nmdc:mga0qj67_11276_c1 | nmdc:mga0qj67_11276_c1_3785_4753 | 306 |
| 221 | 3300050509 | nmdc:mga0qj67_14241_c1 | nmdc:mga0qj67_14241_c1_229_1206 | 306 |
| 222 | 3300050509 | nmdc:mga0qj67_3966_c1 | nmdc:mga0qj67_3966_c1_3547_4509 | 306 |
| 223 | 3300050510 | nmdc:mga06r32_210759_c1 | nmdc:mga06r32_210759_c1_31_999 | 306 |
| 224 | 3300050510 | nmdc:mga06r32_39246_c1 | nmdc:mga06r32_39246_c1_3290_4267 | 306 |
| 225 | 3300050511 | nmdc:mga08y16_118764_c1 | nmdc:mga08y16_118764_c1_330_1286 | 306 |
| 226 | 3300053077 | Ga0495601_0002532 | Ga0495601_0002532_5422_6387 | 306 |
| 227 | 3300053085 | Ga0495619_0006125 | Ga0495619_0006125_364_1329 | 306 |
| 228 | 3300054114 | Ga0501084_0029050 | Ga0501084_0029050_3028_3993 | 306 |
| 229 | 3300054114 | Ga0501084_0106624 | Ga0501084_0106624_372_1340 | 306 |
| 230 | 3300060353 | Ga0501082_0086514 | Ga0501082_0086514_562_1533 | 306 |
| 231 | 3300060353 | Ga0501082_0147560 | Ga0501082_0147560_917_1888 | 306 |
| 232 | 3300060353 | Ga0501082_0173806 | Ga0501082_0173806_421_1386 | 306 |
| 233 | 3300061734 | Ga0530510_0094400 | Ga0530510_0094400_978_1949 | 306 |
| 234 | 2162886007 | SwRhRL2b_contig_619028 | SwRhRL2b_0043.00003980 | 307 |
| 235 | 3300001990 | JGI24737J22298_10035475 | JGI24737J22298_100354751 | 307 |
| 236 | 3300002077 | JGI24744J21845_10010458 | JGI24744J21845_100104582 | 307 |
| 237 | 3300002244 | JGI24742J22300_10002855 | JGI24742J22300_100028552 | 307 |
| 238 | 3300005327 | Ga0070658_10017811 | Ga0070658_100178112 | 307 |
| 239 | 3300005329 | Ga0070683_100160876 | Ga0070683_1001608762 | 307 |
| 240 | 3300005334 | Ga0068869_100200157 | Ga0068869_1002001572 | 307 |
| 241 | 3300005336 | Ga0070680_100052166 | Ga0070680_1000521663 | 307 |
| 242 | 3300005338 | Ga0068868_100050930 | Ga0068868_1000509303 | 307 |
| 243 | 3300005340 | Ga0070689_100030900 | Ga0070689_1000309003 | 307 |
| 244 | 3300005340 | Ga0070689_100057601 | Ga0070689_1000576011 | 307 |
| 245 | 3300005343 | Ga0070687_100018341 | Ga0070687_1000183413 | 307 |
| 246 | 3300005344 | Ga0070661_100227023 | Ga0070661_1002270231 | 307 |
| 247 | 3300005345 | Ga0070692_10132326 | Ga0070692_101323262 | 307 |
| 248 | 3300005347 | Ga0070668_100031290 | Ga0070668_1000312902 | 307 |
| 249 | 3300005353 | Ga0070669_100088741 | Ga0070669_1000887412 | 307 |
| 250 | 3300005353 | Ga0070669_100185492 | Ga0070669_1001854922 | 307 |
| 251 | 3300005354 | Ga0070675_100023649 | Ga0070675_1000236492 | 307 |
| 252 | 3300005355 | Ga0070671_100014076 | Ga0070671_1000140763 | 307 |
| 253 | 3300005355 | Ga0070671_100111507 | Ga0070671_1001115072 | 307 |
| 254 | 3300005356 | Ga0070674_100007137 | Ga0070674_1000071373 | 307 |
| 255 | 3300005364 | Ga0070673_100044391 | Ga0070673_1000443911 | 307 |
| 256 | 3300005364 | Ga0070673_100502695 | Ga0070673_1005026951 | 307 |
| 257 | 3300005366 | Ga0070659_100280320 | Ga0070659_1002803202 | 307 |
| 258 | 3300005435 | Ga0070714_100069870 | Ga0070714_1000698702 | 307 |
| 259 | 3300005435 | Ga0070714_100223682 | Ga0070714_1002236822 | 307 |
| 260 | 3300005436 | Ga0070713_100158006 | Ga0070713_1001580062 | 307 |
| 261 | 3300005437 | Ga0070710_10079388 | Ga0070710_100793882 | 307 |
| 262 | 3300005438 | Ga0070701_10014707 | Ga0070701_100147072 | 307 |
| 263 | 3300005439 | Ga0070711_100048441 | Ga0070711_1000484414 | 307 |
| 264 | 3300005440 | Ga0070705_100080566 | Ga0070705_1000805662 | 307 |
| 265 | 3300005444 | Ga0070694_100002295 | Ga0070694_10000229511 | 307 |
| 266 | 3300005444 | Ga0070694_100009395 | Ga0070694_1000093953 | 307 |
| 267 | 3300005457 | Ga0070662_100155736 | Ga0070662_1001557362 | 307 |
| 268 | 3300005458 | Ga0070681_10043120 | Ga0070681_100431202 | 307 |
| 269 | 3300005459 | Ga0068867_100082922 | Ga0068867_1000829223 | 307 |
| 270 | 3300005466 | Ga0070685_10034266 | Ga0070685_100342661 | 307 |
| 271 | 3300005471 | Ga0070698_100121843 | Ga0070698_1001218432 | 307 |
| 272 | 3300005471 | Ga0070698_100138733 | Ga0070698_1001387332 | 307 |
| 273 | 3300005530 | Ga0070679_100017610 | Ga0070679_1000176104 | 307 |
| 274 | 3300005530 | Ga0070679_100087553 | Ga0070679_1000875533 | 307 |
| 275 | 3300005535 | Ga0070684_100086057 | Ga0070684_1000860571 | 307 |
| 276 | 3300005539 | Ga0068853_100096262 | Ga0068853_1000962622 | 307 |
| 277 | 3300005544 | Ga0070686_100015684 | Ga0070686_1000156844 | 307 |
| 278 | 3300005544 | Ga0070686_100102156 | Ga0070686_1001021562 | 307 |
| 279 | 3300005545 | Ga0070695_100003529 | Ga0070695_1000035293 | 307 |
| 280 | 3300005546 | Ga0070696_100058527 | Ga0070696_1000585272 | 307 |
| 281 | 3300005548 | Ga0070665_100132337 | Ga0070665_1001323373 | 307 |
| 282 | 3300005549 | Ga0070704_100022251 | Ga0070704_1000222513 | 307 |
| 283 | 3300005549 | Ga0070704_100072294 | Ga0070704_1000722942 | 307 |
| 284 | 3300005578 | Ga0068854_100026877 | Ga0068854_1000268774 | 307 |
| 285 | 3300005615 | Ga0070702_100190426 | Ga0070702_1001904261 | 307 |
| 286 | 3300005616 | Ga0068852_100106108 | Ga0068852_1001061082 | 307 |
| 287 | 3300005617 | Ga0068859_100054576 | Ga0068859_1000545763 | 307 |
| 288 | 3300005617 | Ga0068859_100102424 | Ga0068859_1001024242 | 307 |
| 289 | 3300005618 | Ga0068864_100036891 | Ga0068864_1000368911 | 307 |
| 290 | 3300005840 | Ga0068870_10250354 | Ga0068870_102503541 | 307 |
| 291 | 3300005842 | Ga0068858_100025413 | Ga0068858_1000254133 | 307 |
| 292 | 3300005937 | Ga0081455_10000669 | Ga0081455_100006693 | 307 |
| 293 | 3300005937 | Ga0081455_10010322 | Ga0081455_100103227 | 307 |
| 294 | 3300005937 | Ga0081455_10026170 | Ga0081455_100261704 | 307 |
| 295 | 3300005985 | Ga0081539_10001356 | Ga0081539_1000135626 | 307 |
| 296 | 3300006038 | Ga0075365_10075461 | Ga0075365_100754613 | 307 |
| 297 | 3300006175 | Ga0070712_100002654 | Ga0070712_1000026549 | 307 |
| 298 | 3300006175 | Ga0070712_100056890 | Ga0070712_1000568902 | 307 |
| 299 | 3300006177 | Ga0075362_10082246 | Ga0075362_100822461 | 307 |
| 300 | 3300006178 | Ga0075367_10091905 | Ga0075367_100919052 | 307 |
| 301 | 3300006195 | Ga0075366_10097792 | Ga0075366_100977922 | 307 |
| 302 | 3300006358 | Ga0068871_100100950 | Ga0068871_1001009502 | 307 |
| 303 | 3300006844 | Ga0075428_100011624 | Ga0075428_1000116245 | 307 |
| 304 | 3300006844 | Ga0075428_100057483 | Ga0075428_1000574833 | 307 |
| 305 | 3300006844 | Ga0075428_100075150 | Ga0075428_1000751503 | 307 |
| 306 | 3300006844 | Ga0075428_100358587 | Ga0075428_1003585872 | 307 |
| 307 | 3300006846 | Ga0075430_100000063 | Ga0075430_10000006352 | 307 |
| 308 | 3300006846 | Ga0075430_100046155 | Ga0075430_1000461553 | 307 |
| 309 | 3300006847 | Ga0075431_100001682 | Ga0075431_10000168211 | 307 |
| 310 | 3300006847 | Ga0075431_100012395 | Ga0075431_1000123956 | 307 |
| 311 | 3300006847 | Ga0075431_100160476 | Ga0075431_1001604763 | 307 |
| 312 | 3300006871 | Ga0075434_100027816 | Ga0075434_1000278164 | 307 |
| 313 | 3300006871 | Ga0075434_100046120 | Ga0075434_1000461203 | 307 |
| 314 | 3300006871 | Ga0075434_100321966 | Ga0075434_1003219662 | 307 |
| 315 | 3300006880 | Ga0075429_100005500 | Ga0075429_1000055005 | 307 |
| 316 | 3300006880 | Ga0075429_100023196 | Ga0075429_1000231966 | 307 |
| 317 | 3300006880 | Ga0075429_100198236 | Ga0075429_1001982362 | 307 |
| 318 | 3300006880 | Ga0075429_100364929 | Ga0075429_1003649292 | 307 |
| 319 | 3300006881 | Ga0068865_100095941 | Ga0068865_1000959412 | 307 |
| 320 | 3300006931 | Ga0097620_100054576 | Ga0097620_1000545763 | 307 |
| 321 | 3300006931 | Ga0097620_100102422 | Ga0097620_1001024223 | 307 |
| 322 | 3300007076 | Ga0075435_100029006 | Ga0075435_1000290063 | 307 |
| 323 | 3300007265 | Ga0099794_10059093 | Ga0099794_100590932 | 307 |
| 324 | 3300009036 | Ga0105244_10045377 | Ga0105244_100453773 | 307 |
| 325 | 3300009094 | Ga0111539_10002420 | Ga0111539_1000242017 | 307 |
| 326 | 3300009094 | Ga0111539_10004295 | Ga0111539_1000429510 | 307 |
| 327 | 3300009094 | Ga0111539_10038151 | Ga0111539_100381512 | 307 |
| 328 | 3300009094 | Ga0111539_10192490 | Ga0111539_101924902 | 307 |
| 329 | 3300009101 | Ga0105247_10013222 | Ga0105247_100132223 | 307 |
| 330 | 3300009101 | Ga0105247_10114666 | Ga0105247_101146663 | 307 |
| 331 | 3300009147 | Ga0114129_10000199 | Ga0114129_1000019967 | 307 |
| 332 | 3300009147 | Ga0114129_10005299 | Ga0114129_100052996 | 307 |
| 333 | 3300009148 | Ga0105243_10032485 | Ga0105243_100324853 | 307 |
| 334 | 3300009148 | Ga0105243_10108404 | Ga0105243_101084041 | 307 |
| 335 | 3300009177 | Ga0105248_10030282 | Ga0105248_100302826 | 307 |
| 336 | 3300009551 | Ga0105238_10267876 | Ga0105238_102678763 | 307 |
| 337 | 3300009551 | Ga0105238_10421118 | Ga0105238_104211181 | 307 |
| 338 | 3300009553 | Ga0105249_10006518 | Ga0105249_100065183 | 307 |
| 339 | 3300010159 | Ga0099796_10079742 | Ga0099796_100797421 | 307 |
| 340 | 3300010375 | Ga0105239_10049040 | Ga0105239_100490402 | 307 |
| 341 | 3300010375 | Ga0105239_10204024 | Ga0105239_102040243 | 307 |
| 342 | 3300011119 | Ga0105246_10053542 | Ga0105246_100535422 | 307 |
| 343 | 3300013297 | Ga0157378_10232713 | Ga0157378_102327132 | 307 |
| 344 | 3300013306 | Ga0163162_10055029 | Ga0163162_100550292 | 307 |
| 345 | 3300013308 | Ga0157375_10001521 | Ga0157375_1000152117 | 307 |
| 346 | 3300014325 | Ga0163163_10004477 | Ga0163163_100044777 | 307 |
| 347 | 3300014325 | Ga0163163_10246646 | Ga0163163_102466461 | 307 |
| 348 | 3300014326 | Ga0157380_10071822 | Ga0157380_100718222 | 307 |
| 349 | 3300025297 | Ga0209758_1002417 | Ga0209758_100241716 | 307 |
| 350 | 3300025302 | Ga0207426_1025911 | Ga0207426_10259112 | 307 |
| 351 | 3300025901 | Ga0207688_10007736 | Ga0207688_100077365 | 307 |
| 352 | 3300025904 | Ga0207647_10052730 | Ga0207647_100527302 | 307 |
| 353 | 3300025907 | Ga0207645_10022680 | Ga0207645_100226803 | 307 |
| 354 | 3300025907 | Ga0207645_10025867 | Ga0207645_100258672 | 307 |
| 355 | 3300025908 | Ga0207643_10002578 | Ga0207643_100025788 | 307 |
| 356 | 3300025915 | Ga0207693_10033141 | Ga0207693_100331416 | 307 |
| 357 | 3300025915 | Ga0207693_10037884 | Ga0207693_100378841 | 307 |
| 358 | 3300025918 | Ga0207662_10021624 | Ga0207662_100216243 | 307 |
| 359 | 3300025918 | Ga0207662_10098580 | Ga0207662_100985801 | 307 |
| 360 | 3300025919 | Ga0207657_10033671 | Ga0207657_100336712 | 307 |
| 361 | 3300025920 | Ga0207649_10101541 | Ga0207649_101015412 | 307 |
| 362 | 3300025921 | Ga0207652_10004363 | Ga0207652_1000436310 | 307 |
| 363 | 3300025921 | Ga0207652_10229354 | Ga0207652_102293542 | 307 |
| 364 | 3300025924 | Ga0207694_10181188 | Ga0207694_101811882 | 307 |
| 365 | 3300025925 | Ga0207650_10068470 | Ga0207650_100684703 | 307 |
| 366 | 3300025925 | Ga0207650_10106387 | Ga0207650_101063872 | 307 |
| 367 | 3300025927 | Ga0207687_10041231 | Ga0207687_100412312 | 307 |
| 368 | 3300025928 | Ga0207700_10370219 | Ga0207700_103702191 | 307 |
| 369 | 3300025931 | Ga0207644_10096541 | Ga0207644_100965412 | 307 |
| 370 | 3300025932 | Ga0207690_10071916 | Ga0207690_100719162 | 307 |
| 371 | 3300025933 | Ga0207706_10255904 | Ga0207706_102559042 | 307 |
| 372 | 3300025934 | Ga0207686_10083504 | Ga0207686_100835042 | 307 |
| 373 | 3300025936 | Ga0207670_10085017 | Ga0207670_100850173 | 307 |
| 374 | 3300025937 | Ga0207669_10009105 | Ga0207669_100091055 | 307 |
| 375 | 3300025940 | Ga0207691_10077916 | Ga0207691_100779162 | 307 |
| 376 | 3300025941 | Ga0207711_10057574 | Ga0207711_100575742 | 307 |
| 377 | 3300025941 | Ga0207711_10159172 | Ga0207711_101591722 | 307 |
| 378 | 3300025942 | Ga0207689_10052814 | Ga0207689_100528141 | 307 |
| 379 | 3300025981 | Ga0207640_10018223 | Ga0207640_100182233 | 307 |
| 380 | 3300025986 | Ga0207658_10091749 | Ga0207658_100917492 | 307 |
| 381 | 3300026035 | Ga0207703_10063299 | Ga0207703_100632991 | 307 |
| 382 | 3300026035 | Ga0207703_10357318 | Ga0207703_103573181 | 307 |
| 383 | 3300026041 | Ga0207639_10022893 | Ga0207639_100228932 | 307 |
| 384 | 3300026067 | Ga0207678_10017701 | Ga0207678_100177015 | 307 |
| 385 | 3300026067 | Ga0207678_10399546 | Ga0207678_103995461 | 307 |
| 386 | 3300026075 | Ga0207708_10011303 | Ga0207708_100113035 | 307 |
| 387 | 3300026089 | Ga0207648_10006412 | Ga0207648_100064122 | 307 |
| 388 | 3300026095 | Ga0207676_10215743 | Ga0207676_102157432 | 307 |
| 389 | 3300026116 | Ga0207674_10127787 | Ga0207674_101277871 | 307 |
| 390 | 3300026118 | Ga0207675_100033231 | Ga0207675_1000332314 | 307 |
| 391 | 3300026121 | Ga0207683_10047318 | Ga0207683_100473182 | 307 |
| 392 | 3300026121 | Ga0207683_10069648 | Ga0207683_100696483 | 307 |
| 393 | 3300027364 | Ga0209967_1006036 | Ga0209967_10060362 | 307 |
| 394 | 3300027378 | Ga0209981_1009684 | Ga0209981_10096842 | 307 |
| 395 | 3300027543 | Ga0209999_1005358 | Ga0209999_10053583 | 307 |
| 396 | 3300027907 | Ga0207428_10026893 | Ga0207428_100268935 | 307 |
| 397 | 3300028379 | Ga0268266_10073587 | Ga0268266_100735873 | 307 |
| 398 | 3300028380 | Ga0268265_10060002 | Ga0268265_100600021 | 307 |
| 399 | 3300028556 | Ga0265337_1000071 | Ga0265337_100007147 | 307 |
| 400 | 3300031241 | Ga0265325_10006017 | Ga0265325_100060178 | 307 |
| 401 | 3300031241 | Ga0265325_10030664 | Ga0265325_100306642 | 307 |
| 402 | 3300031249 | Ga0265339_10001047 | Ga0265339_100010472 | 307 |
| 403 | 3300031344 | Ga0265316_10042203 | Ga0265316_100422032 | 307 |
| 404 | 3300031595 | Ga0265313_10000977 | Ga0265313_1000097724 | 307 |
| 405 | 3300032005 | Ga0307411_10236922 | Ga0307411_102369222 | 307 |
| 406 | 3300032126 | Ga0307415_100261794 | Ga0307415_1002617942 | 307 |
| 407 | 3300034817 | Ga0373948_0001038 | Ga0373948_0001038_1273_2196 | 307 |
| 408 | 3300034819 | Ga0373958_0000067 | Ga0373958_0000067_1301_2224 | 307 |
| 409 | 3300034820 | Ga0373959_0000605 | Ga0373959_0000605_2763_3686 | 307 |
| 410 | 3300035083 | Ga0373926_0038725 | Ga0373926_0038725_343_1314 | 307 |
| 411 | 3300035084 | Ga0373928_0001080 | Ga0373928_0001080_1416_2339 | 307 |
| 412 | 3300035084 | Ga0373928_0022443 | Ga0373928_0022443_103_1071 | 307 |
| 413 | 3300035085 | Ga0373929_0000479 | Ga0373929_0000479_5703_6626 | 307 |
| 414 | 3300035088 | Ga0373940_0000423 | Ga0373940_0000423_2232_3155 | 307 |
| 415 | 3300035090 | Ga0373949_0000398 | Ga0373949_0000398_30_953 | 307 |
| 416 | 3300035091 | Ga0373951_0000207 | Ga0373951_0000207_1391_2314 | 307 |
| 417 | 3300035092 | Ga0373952_0000046 | Ga0373952_0000046_10251_11174 | 307 |
| 418 | 3300035112 | Ga0373932_0000529 | Ga0373932_0000529_9976_10899 | 307 |
| 419 | 3300035113 | Ga0373936_0014420 | Ga0373936_0014420_1125_2093 | 307 |
| 420 | 3300035113 | Ga0373936_0023790 | Ga0373936_0023790_503_1471 | 307 |
| 421 | 3300035114 | Ga0373939_0000159 | Ga0373939_0000159_7835_8758 | 307 |
| 422 | 3300035114 | Ga0373939_0014094 | Ga0373939_0014094_660_1628 | 307 |
| 423 | 3300035115 | Ga0373941_0000017 | Ga0373941_0000017_25776_26699 | 307 |
| 424 | 3300035116 | Ga0373945_0013465 | Ga0373945_0013465_806_1777 | 307 |
| 425 | 3300035117 | Ga0373953_0072067 | Ga0373953_0072067_255_1223 | 307 |
| 426 | 3300035118 | Ga0373954_0019942 | Ga0373954_0019942_1047_2015 | 307 |
| 427 | 3300035121 | Ga0373960_0000896 | Ga0373960_0000896_2990_3913 | 307 |
| 428 | 3300035170 | Ga0373943_0004464 | Ga0373943_0004464_2537_3505 | 307 |
| 429 | 3300035172 | Ga0373955_0000530 | Ga0373955_0000530_5362_6330 | 307 |
| 430 | 3300035207 | Ga0373942_0000086 | Ga0373942_0000086_2337_3260 | 307 |
| 431 | 3300035241 | Ga0373961_0002182 | Ga0373961_0002182_1456_2379 | 307 |
| 432 | 3300035242 | Ga0373962_0017725 | Ga0373962_0017725_447_1418 | 307 |
| 433 | 3300035410 | Ga0373924_0021780 | Ga0373924_0021780_243_1211 | 307 |
| 434 | 3300035691 | Ga0373931_0008078 | Ga0373931_0008078_1262_2185 | 307 |
| 435 | 3300035691 | Ga0373931_0122941 | Ga0373931_0122941_20_988 | 307 |
| 436 | 3300035692 | Ga0373935_0000108 | Ga0373935_0000108_23734_24702 | 307 |
| 437 | 3300035692 | Ga0373935_0097026 | Ga0373935_0097026_52_1017 | 307 |
| 438 | 3300035695 | Ga0373927_0004068 | Ga0373927_0004068_5458_6426 | 307 |
| 439 | 3300035695 | Ga0373927_0051665 | Ga0373927_0051665_1083_2057 | 307 |
| 440 | 3300035724 | Ga0373933_0003638 | Ga0373933_0003638_2786_3754 | 307 |
| 441 | 3300035725 | Ga0373947_0004424 | Ga0373947_0004424_6429_7397 | 307 |
| 442 | 3300035725 | Ga0373947_0031657 | Ga0373947_0031657_954_1925 | 307 |
| 443 | 3300035725 | Ga0373947_0057763 | Ga0373947_0057763_285_1250 | 307 |
| 444 | 3300036401 | Ga0373937_0000007 | Ga0373937_0000007_18713_19681 | 307 |
| 445 | 3300037068 | Ga0373925_0000011 | Ga0373925_0000011_9964_10932 | 307 |
| 446 | 3300039450 | Ga0436363_0211948 | Ga0436363_0211948_532_1515 | 307 |
| 447 | 3300039450 | Ga0436363_1183097 | Ga0436363_1183097_16_966 | 307 |
| 448 | 3300041512 | Ga0451853_0997442 | Ga0451853_0997442_217_1188 | 307 |
| 449 | 3300042461 | Ga0439460_0000174 | Ga0439460_0000174_10712_11740 | 307 |
| 450 | 3300042532 | Ga0450893_0010550 | Ga0450893_0010550_255_1298 | 307 |
| 451 | 3300044712 | Ga0453684_0040067 | Ga0453684_0040067_1289_2212 | 307 |
| 452 | 3300046454 | Ga0495592_0000390 | Ga0495592_0000390_22702_23670 | 307 |
| 453 | 3300046457 | Ga0495590_0093166 | Ga0495590_0093166_52_1026 | 307 |
| 454 | 3300046459 | Ga0495629_0022960 | Ga0495629_0022960_2616_3584 | 307 |
| 455 | 3300046460 | Ga0495638_0192640 | Ga0495638_0192640_30_1031 | 307 |
| 456 | 3300046462 | Ga0495651_0009066 | Ga0495651_0009066_2882_3850 | 307 |
| 457 | 3300046462 | Ga0495651_0136692 | Ga0495651_0136692_811_1740 | 307 |
| 458 | 3300046463 | Ga0495653_0000249 | Ga0495653_0000249_25174_26142 | 307 |
| 459 | 3300046472 | Ga0495580_0032962 | Ga0495580_0032962_1299_2270 | 307 |
| 460 | 3300046473 | Ga0495582_0090937 | Ga0495582_0090937_167_1138 | 307 |
| 461 | 3300046474 | Ga0495605_0075576 | Ga0495605_0075576_45_1016 | 307 |
| 462 | 3300046476 | Ga0495662_0134123 | Ga0495662_0134123_193_1158 | 307 |
| 463 | 3300046477 | Ga0495664_0000024 | Ga0495664_0000024_98984_99952 | 307 |
| 464 | 3300046491 | Ga0495584_0037506 | Ga0495584_0037506_473_1450 | 307 |
| 465 | 3300046499 | Ga0495594_0011329 | Ga0495594_0011329_1239_2210 | 307 |
| 466 | 3300046511 | Ga0495608_0000004 | Ga0495608_0000004_43074_44042 | 307 |
| 467 | 3300046514 | Ga0495618_0000855 | Ga0495618_0000855_15008_15976 | 307 |
| 468 | 3300046514 | Ga0495618_0048645 | Ga0495618_0048645_1310_2281 | 307 |
| 469 | 3300046516 | Ga0495628_0000006 | Ga0495628_0000006_106691_107659 | 307 |
| 470 | 3300046517 | Ga0495630_0000601 | Ga0495630_0000601_16981_17949 | 307 |
| 471 | 3300046517 | Ga0495630_0134886 | Ga0495630_0134886_636_1607 | 307 |
| 472 | 3300046523 | Ga0495644_0019617 | Ga0495644_0019617_943_2016 | 307 |
| 473 | 3300046529 | Ga0495652_0000038 | Ga0495652_0000038_101702_102670 | 307 |
| 474 | 3300046531 | Ga0495665_0048609 | Ga0495665_0048609_587_1555 | 307 |
| 475 | 3300046531 | Ga0495665_0181628 | Ga0495665_0181628_55_1020 | 307 |
| 476 | 3300046533 | Ga0495640_0000013 | Ga0495640_0000013_7538_8506 | 307 |
| 477 | 3300046533 | Ga0495640_0056898 | Ga0495640_0056898_1176_2141 | 307 |
| 478 | 3300046535 | Ga0495586_0077474 | Ga0495586_0077474_693_1661 | 307 |
| 479 | 3300046536 | Ga0495587_0000004 | Ga0495587_0000004_46539_47507 | 307 |
| 480 | 3300046543 | Ga0495645_0000001 | Ga0495645_0000001_311074_312042 | 307 |
| 481 | 3300046558 | Ga0495633_0039898 | Ga0495633_0039898_1138_2109 | 307 |
| 482 | 3300046559 | Ga0495667_0000084 | Ga0495667_0000084_27736_28704 | 307 |
| 483 | 3300046615 | Ga0495656_0019425 | Ga0495656_0019425_561_1538 | 307 |
| 484 | 3300046642 | Ga0495634_0000164 | Ga0495634_0000164_5178_6146 | 307 |
| 485 | 3300046642 | Ga0495634_0025446 | Ga0495634_0025446_922_1887 | 307 |
| 486 | 3300046663 | Ga0495635_0000003 | Ga0495635_0000003_310705_311673 | 307 |
| 487 | 3300046663 | Ga0495635_0220189 | Ga0495635_0220189_10_981 | 307 |
| 488 | 3300046665 | Ga0495661_0105762 | Ga0495661_0105762_241_1218 | 307 |
| 489 | 3300046675 | Ga0495657_0000248 | Ga0495657_0000248_38563_39531 | 307 |
| 490 | 3300046678 | Ga0495599_0000014 | Ga0495599_0000014_163976_164944 | 307 |
| 491 | 3300046679 | Ga0495623_0000015 | Ga0495623_0000015_23616_24584 | 307 |
| 492 | 3300046680 | Ga0495646_0000005 | Ga0495646_0000005_223245_224213 | 307 |
| 493 | 3300046689 | Ga0495613_0011799 | Ga0495613_0011799_3516_4484 | 307 |
| 494 | 3300046690 | Ga0495624_0113521 | Ga0495624_0113521_14_985 | 307 |
| 495 | 3300046794 | Ga0495589_0140084 | Ga0495589_0140084_131_1102 | 307 |
| 496 | 3300046809 | Ga0495600_0000005 | Ga0495600_0000005_6703_7671 | 307 |
| 497 | 3300046810 | Ga0495660_0145101 | Ga0495660_0145101_81_1052 | 307 |
| 498 | 3300047315 | Ga0495581_0035116 | Ga0495581_0035116_1243_2211 | 307 |
| 499 | 3300047315 | Ga0495581_0101323 | Ga0495581_0101323_479_1450 | 307 |
| 500 | 3300047317 | Ga0495604_0000002 | Ga0495604_0000002_218976_219944 | 307 |
| 501 | 3300047319 | Ga0495674_0000004 | Ga0495674_0000004_218525_219493 | 307 |
| 502 | 3300047319 | Ga0495674_0167199 | Ga0495674_0167199_807_1772 | 307 |
| 503 | 3300047320 | Ga0495672_0154403 | Ga0495672_0154403_136_1107 | 307 |
| 504 | 3300047321 | Ga0495676_0086728 | Ga0495676_0086728_1113_2084 | 307 |
| 505 | 3300047322 | Ga0495680_0000142 | Ga0495680_0000142_6976_7944 | 307 |
| 506 | 3300047444 | Ga0495675_0000053 | Ga0495675_0000053_39137_40105 | 307 |
| 507 | 3300047447 | Ga0495685_082661 | Ga0495685_082661_80_1051 | 307 |
| 508 | 3300047471 | Ga0495684_0000004 | Ga0495684_0000004_199401_200369 | 307 |
| 509 | 3300048088 | Ga0495602_0000001 | Ga0495602_0000001_310747_311715 | 307 |
| 510 | 3300048903 | Ga0496100_0068911 | Ga0496100_0068911_987_1958 | 307 |
| 511 | 3300048903 | Ga0496100_0096916 | Ga0496100_0096916_22_993 | 307 |
| 512 | 3300048903 | Ga0496100_0159034 | Ga0496100_0159034_322_1275 | 307 |
| 513 | 3300048904 | Ga0496101_0074509 | Ga0496101_0074509_494_1465 | 307 |
| 514 | 3300048904 | Ga0496101_0076402 | Ga0496101_0076402_751_1713 | 307 |
| 515 | 3300048904 | Ga0496101_0095218 | Ga0496101_0095218_1041_1964 | 307 |
| 516 | 3300048905 | Ga0496102_0030973 | Ga0496102_0030973_2493_3416 | 307 |
| 517 | 3300048905 | Ga0496102_0102351 | Ga0496102_0102351_448_1419 | 307 |
| 518 | 3300048906 | Ga0496103_0021838 | Ga0496103_0021838_2561_3532 | 307 |
| 519 | 3300048906 | Ga0496103_0022327 | Ga0496103_0022327_2519_3490 | 307 |
| 520 | 3300048906 | Ga0496103_0115703 | Ga0496103_0115703_645_1613 | 307 |
| 521 | 3300048907 | Ga0496104_0000778 | Ga0496104_0000778_5160_6155 | 307 |
| 522 | 3300048907 | Ga0496104_0004804 | Ga0496104_0004804_1156_2151 | 307 |
| 523 | 3300048907 | Ga0496104_0004804 | Ga0496104_0004804_46_1023 | 307 |
| 524 | 3300048907 | Ga0496104_0020957 | Ga0496104_0020957_2435_3406 | 307 |
| 525 | 3300048907 | Ga0496104_0187123 | Ga0496104_0187123_212_1180 | 307 |
| 526 | 3300048907 | Ga0496104_0202937 | Ga0496104_0202937_448_1419 | 307 |
| 527 | 3300048908 | Ga0496105_0016531 | Ga0496105_0016531_3300_4295 | 307 |
| 528 | 3300048908 | Ga0496105_0051610 | Ga0496105_0051610_976_1947 | 307 |
| 529 | 3300048908 | Ga0496105_0071122 | Ga0496105_0071122_140_1135 | 307 |
| 530 | 3300048908 | Ga0496105_0089361 | Ga0496105_0089361_25_978 | 307 |
| 531 | 3300048909 | Ga0496106_0009665 | Ga0496106_0009665_4820_5791 | 307 |
| 532 | 3300048909 | Ga0496106_0022495 | Ga0496106_0022495_2695_3666 | 307 |
| 533 | 3300048909 | Ga0496106_0041752 | Ga0496106_0041752_447_1370 | 307 |
| 534 | 3300048909 | Ga0496106_0140498 | Ga0496106_0140498_811_1788 | 307 |
| 535 | 3300048910 | Ga0496107_0010821 | Ga0496107_0010821_4911_5834 | 307 |
| 536 | 3300048911 | Ga0496108_0003559 | Ga0496108_0003559_2662_3633 | 307 |
| 537 | 3300048911 | Ga0496108_0181836 | Ga0496108_0181836_103_1098 | 307 |
| 538 | 3300048912 | Ga0496109_0001664 | Ga0496109_0001664_10533_11504 | 307 |
| 539 | 3300048912 | Ga0496109_0025511 | Ga0496109_0025511_3061_4032 | 307 |
| 540 | 3300048912 | Ga0496109_0052080 | Ga0496109_0052080_26_949 | 307 |
| 541 | 3300048912 | Ga0496109_0192627 | Ga0496109_0192627_706_1668 | 307 |
| 542 | 3300048912 | Ga0496109_0302713 | Ga0496109_0302713_461_1456 | 307 |
| 543 | 3300048913 | Ga0496110_0008663 | Ga0496110_0008663_1964_2935 | 307 |
| 544 | 3300048913 | Ga0496110_0055123 | Ga0496110_0055123_576_1547 | 307 |
| 545 | 3300048913 | Ga0496110_0259462 | Ga0496110_0259462_315_1295 | 307 |
| 546 | 3300048913 | Ga0496110_0265606 | Ga0496110_0265606_31_1002 | 307 |
| 547 | 3300048914 | Ga0496111_0038752 | Ga0496111_0038752_2276_3247 | 307 |
| 548 | 3300048914 | Ga0496111_0056561 | Ga0496111_0056561_461_1384 | 307 |
| 549 | 3300048914 | Ga0496111_0063984 | Ga0496111_0063984_210_1190 | 307 |
| 550 | 3300048915 | Ga0496112_0124243 | Ga0496112_0124243_132_1103 | 307 |
| 551 | 3300048915 | Ga0496112_0172695 | Ga0496112_0172695_52_1119 | 307 |
| 552 | 3300048916 | Ga0496113_0001475 | Ga0496113_0001475_1623_2594 | 307 |
| 553 | 3300048916 | Ga0496113_0204792 | Ga0496113_0204792_420_1397 | 307 |
| 554 | 3300048917 | Ga0496114_0007227 | Ga0496114_0007227_47_1018 | 307 |
| 555 | 3300048917 | Ga0496114_0007386 | Ga0496114_0007386_4914_5876 | 307 |
| 556 | 3300048917 | Ga0496114_0134337 | Ga0496114_0134337_210_1181 | 307 |
| 557 | 3300048918 | Ga0496115_0015056 | Ga0496115_0015056_1772_2767 | 307 |
| 558 | 3300048918 | Ga0496115_0126846 | Ga0496115_0126846_810_1772 | 307 |
| 559 | 3300048918 | Ga0496115_0235489 | Ga0496115_0235489_213_1190 | 307 |
| 560 | 3300049568 | Ga0501031_0032599 | Ga0501031_0032599_1687_2661 | 307 |
| 561 | 3300049568 | Ga0501031_0239871 | Ga0501031_0239871_19_990 | 307 |
| 562 | 3300049569 | Ga0501032_0017659 | Ga0501032_0017659_2241_3221 | 307 |
| 563 | 3300049572 | Ga0501036_0003271 | Ga0501036_0003271_10842_11816 | 307 |
| 564 | 3300049572 | Ga0501036_0004299 | Ga0501036_0004299_3125_4105 | 307 |
| 565 | 3300049572 | Ga0501036_0134215 | Ga0501036_0134215_668_1654 | 307 |
| 566 | 3300049573 | Ga0501037_0026706 | Ga0501037_0026706_1670_2650 | 307 |
| 567 | 3300049574 | Ga0501038_0001109 | Ga0501038_0001109_11602_12576 | 307 |
| 568 | 3300049574 | Ga0501038_0038044 | Ga0501038_0038044_1490_2470 | 307 |
| 569 | 3300049575 | Ga0501039_0015991 | Ga0501039_0015991_4096_5070 | 307 |
| 570 | 3300049575 | Ga0501039_0092803 | Ga0501039_0092803_11_1036 | 307 |
| 571 | 3300049576 | Ga0501040_0001909 | Ga0501040_0001909_5112_6086 | 307 |
| 572 | 3300049577 | Ga0501041_0003730 | Ga0501041_0003730_4966_5940 | 307 |
| 573 | 3300049578 | Ga0501042_0000383 | Ga0501042_0000383_11800_12774 | 307 |
| 574 | 3300049579 | Ga0501043_0039655 | Ga0501043_0039655_1105_2085 | 307 |
| 575 | 3300049580 | Ga0501046_0001197 | Ga0501046_0001197_12160_13134 | 307 |
| 576 | 3300049580 | Ga0501046_0005257 | Ga0501046_0005257_2687_3667 | 307 |
| 577 | 3300049581 | Ga0501047_0131279 | Ga0501047_0131279_21_971 | 307 |
| 578 | 3300049581 | Ga0501047_0136435 | Ga0501047_0136435_713_1687 | 307 |
| 579 | 3300049582 | Ga0501048_0030146 | Ga0501048_0030146_48_1028 | 307 |
| 580 | 3300049583 | Ga0501067_0047518 | Ga0501067_0047518_459_1439 | 307 |
| 581 | 3300049584 | Ga0501068_0009855 | Ga0501068_0009855_1680_2660 | 307 |
| 582 | 3300049585 | Ga0501069_0001350 | Ga0501069_0001350_1060_2040 | 307 |
| 583 | 3300049586 | Ga0501070_0015678 | Ga0501070_0015678_5160_6140 | 307 |
| 584 | 3300049587 | Ga0501071_0011854 | Ga0501071_0011854_263_1237 | 307 |
| 585 | 3300049587 | Ga0501071_0020152 | Ga0501071_0020152_46_1020 | 307 |
| 586 | 3300049587 | Ga0501071_0030315 | Ga0501071_0030315_2798_3784 | 307 |
| 587 | 3300049587 | Ga0501071_0044594 | Ga0501071_0044594_1431_2411 | 307 |
| 588 | 3300049588 | Ga0501072_0002470 | Ga0501072_0002470_5196_6170 | 307 |
| 589 | 3300049588 | Ga0501072_0359785 | Ga0501072_0359785_114_1094 | 307 |
| 590 | 3300049589 | Ga0501073_0064750 | Ga0501073_0064750_522_1502 | 307 |
| 591 | 3300049589 | Ga0501073_0098535 | Ga0501073_0098535_469_1449 | 307 |
| 592 | 3300049591 | Ga0501075_0000525 | Ga0501075_0000525_11917_12891 | 307 |
| 593 | 3300049591 | Ga0501075_0004827 | Ga0501075_0004827_5677_6663 | 307 |
| 594 | 3300049592 | Ga0501076_0013583 | Ga0501076_0013583_4433_5407 | 307 |
| 595 | 3300049592 | Ga0501076_0095303 | Ga0501076_0095303_1149_2123 | 307 |
| 596 | 3300049593 | Ga0501077_0031416 | Ga0501077_0031416_2120_3094 | 307 |
| 597 | 3300049741 | Ga0501079_0000625 | Ga0501079_0000625_11574_12548 | 307 |
| 598 | 3300049741 | Ga0501079_0015914 | Ga0501079_0015914_3144_4130 | 307 |
| 599 | 3300049742 | Ga0501080_0054849 | Ga0501080_0054849_2539_3519 | 307 |
| 600 | 3300049742 | Ga0501080_0110457 | Ga0501080_0110457_1474_2448 | 307 |
| 601 | 3300049743 | Ga0501081_0000055 | Ga0501081_0000055_5124_6098 | 307 |
| 602 | 3300049743 | Ga0501081_0322119 | Ga0501081_0322119_57_1007 | 307 |
| 603 | 3300049744 | Ga0501083_0006890 | Ga0501083_0006890_2021_3001 | 307 |
| 604 | 3300049823 | Ga0501044_0000351 | Ga0501044_0000351_10467_11447 | 307 |
| 605 | 3300049823 | Ga0501044_0049886 | Ga0501044_0049886_1977_2951 | 307 |
| 606 | 3300049824 | Ga0501045_0000901 | Ga0501045_0000901_7900_8874 | 307 |
| 607 | 3300049824 | Ga0501045_0006242 | Ga0501045_0006242_5933_6919 | 307 |
| 608 | 3300049824 | Ga0501045_0015157 | Ga0501045_0015157_4384_5364 | 307 |
| 609 | 3300050492 | nmdc:mga0yw44_100884_c1 | nmdc:mga0yw44_100884_c1_21_992 | 307 |
| 610 | 3300050492 | nmdc:mga0yw44_78772_c1 | nmdc:mga0yw44_78772_c1_611_1582 | 307 |
| 611 | 3300050493 | nmdc:mga0k408_143465_c1 | nmdc:mga0k408_143465_c1_441_1370 | 307 |
| 612 | 3300050493 | nmdc:mga0k408_153514_c1 | nmdc:mga0k408_153514_c1_343_1314 | 307 |
| 613 | 3300050494 | nmdc:mga06z11_272209_c1 | nmdc:mga06z11_272209_c1_17_967 | 307 |
| 614 | 3300050507 | nmdc:mga05p37_223_c1 | nmdc:mga05p37_223_c1_44028_44987 | 307 |
| 615 | 3300050507 | nmdc:mga05p37_325786_c1 | nmdc:mga05p37_325786_c1_604_1629 | 307 |
| 616 | 3300050507 | nmdc:mga05p37_540137_c1 | nmdc:mga05p37_540137_c1_277_1248 | 307 |
| 617 | 3300050507 | nmdc:mga05p37_56359_c1 | nmdc:mga05p37_56359_c1_1935_2906 | 307 |
| 618 | 3300050508 | nmdc:mga09592_135171_c1 | nmdc:mga09592_135171_c1_346_1320 | 307 |
| 619 | 3300050508 | nmdc:mga09592_152742_c1 | nmdc:mga09592_152742_c1_622_1545 | 307 |
| 620 | 3300050508 | nmdc:mga09592_8032_c1 | nmdc:mga09592_8032_c1_2775_3734 | 307 |
| 621 | 3300050508 | nmdc:mga09592_83861_c1 | nmdc:mga09592_83861_c1_1516_2490 | 307 |
| 622 | 3300050508 | nmdc:mga09592_84627_c1 | nmdc:mga09592_84627_c1_547_1518 | 307 |
| 623 | 3300050508 | nmdc:mga09592_9213_c1 | nmdc:mga09592_9213_c1_2107_3132 | 307 |
| 624 | 3300050509 | nmdc:mga0qj67_1416_c1 | nmdc:mga0qj67_1416_c1_10881_11855 | 307 |
| 625 | 3300050509 | nmdc:mga0qj67_16218_c1 | nmdc:mga0qj67_16218_c1_4278_5219 | 307 |
| 626 | 3300050510 | nmdc:mga06r32_1449_c1 | nmdc:mga06r32_1449_c1_9728_10687 | 307 |
| 627 | 3300050510 | nmdc:mga06r32_17056_c1 | nmdc:mga06r32_17056_c1_576_1601 | 307 |
| 628 | 3300050511 | nmdc:mga08y16_5989_c1 | nmdc:mga08y16_5989_c1_3551_4510 | 307 |
| 629 | 3300050512 | nmdc:mga0n895_63420_c1 | nmdc:mga0n895_63420_c1_1452_2438 | 307 |
| 630 | 3300050512 | nmdc:mga0n895_73026_c1 | nmdc:mga0n895_73026_c1_417_1376 | 307 |
| 631 | 3300050513 | nmdc:mga0rr50_134532_c1 | nmdc:mga0rr50_134532_c1_152_1126 | 307 |
| 632 | 3300050515 | nmdc:mga0a205_12766_c1 | nmdc:mga0a205_12766_c1_6428_7414 | 307 |
| 633 | 3300050515 | nmdc:mga0a205_62538_c1 | nmdc:mga0a205_62538_c1_2213_3187 | 307 |
| 634 | 3300053077 | Ga0495601_0000026 | Ga0495601_0000026_98776_99744 | 307 |
| 635 | 3300053077 | Ga0495601_0284322 | Ga0495601_0284322_31_1002 | 307 |
| 636 | 3300053078 | Ga0495612_0000005 | Ga0495612_0000005_87028_87996 | 307 |
| 637 | 3300053084 | Ga0495595_0000065 | Ga0495595_0000065_38648_39616 | 307 |
| 638 | 3300053084 | Ga0495595_0054768 | Ga0495595_0054768_68_1036 | 307 |
| 639 | 3300053085 | Ga0495619_0000003 | Ga0495619_0000003_315869_316837 | 307 |
| 640 | 3300053085 | Ga0495619_0042256 | Ga0495619_0042256_562_1533 | 307 |
| 641 | 3300053085 | Ga0495619_0047217 | Ga0495619_0047217_1042_2010 | 307 |
| 642 | 3300053085 | Ga0495619_0050494 | Ga0495619_0050494_925_1896 | 307 |
| 643 | 3300053085 | Ga0495619_0078690 | Ga0495619_0078690_844_1791 | 307 |
| 644 | 3300053087 | Ga0500643_000795 | Ga0500643_000795_16554_17525 | 307 |
| 645 | 3300053119 | Ga0500595_000001 | Ga0500595_000001_318616_319587 | 307 |
| 646 | 3300053130 | Ga0500642_0055327 | Ga0500642_0055327_822_1754 | 307 |
| 647 | 3300053134 | Ga0500658_0059366 | Ga0500658_0059366_513_1484 | 307 |
| 648 | 3300053153 | Ga0500616_0111110 | Ga0500616_0111110_255_1229 | 307 |
| 649 | 3300054114 | Ga0501084_0002498 | Ga0501084_0002498_2507_3481 | 307 |
| 650 | 3300054114 | Ga0501084_0033744 | Ga0501084_0033744_107_1087 | 307 |
| 651 | 3300054114 | Ga0501084_0073459 | Ga0501084_0073459_1265_2251 | 307 |
| 652 | 3300060353 | Ga0501082_0008950 | Ga0501082_0008950_3196_4170 | 307 |
| 653 | 3300060353 | Ga0501082_0046577 | Ga0501082_0046577_2715_3695 | 307 |
| 654 | 3300061734 | Ga0530510_0001004 | Ga0530510_0001004_12660_13634 | 307 |
| 655 | 3300061734 | Ga0530510_0028198 | Ga0530510_0028198_977_1981 | 307 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2dvz-assembly1.cif.gz_A | structure of a periplasmic transporter | 0.9668 | 12 | 307 |
| 5oku-assembly1.cif.gz_A | r. palustris rpa4515 with adipate | 0.9646 | 11 | 305 |
| 2f5x-assembly3.cif.gz_C | structure of periplasmic binding protein bugd | 0.9611 | 12 | 305 |
| 8hkb-assembly1.cif.gz_A | tpa bound-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis mutant k184d | 0.9602 | 15 | 305 |
| 2dvz-assembly1.cif.gz_A | structure of a periplasmic transporter | 0.9512 | 12 | 307 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4x9tA02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.953 | 109 | 224 | 3.40.190.10 |
| 2qpqC02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9468 | 109 | 231 | 3.40.190.10 |
| 6hkeC02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9442 | 109 | 231 | 3.40.190.10 |
| 2dvzA01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 | 0.9339 | 12 | 305 | 3.40.190.150 |
| 2qpqC02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9322 | 109 | 231 | 3.40.190.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1F4CWQ1-F1-model_v4 | LacI family transcriptional regulator | 0.979 | 12 | 307 |
|
| AF-A0A1G6LKF5-F1-model_v4 | Tripartite-type tricarboxylate transporter, receptor component TctC | 0.9775 | 11 | 307 |
|
| AF-A0A1B2QZA4-F1-model_v4 | ABC transporter substrate-binding protein | 0.9749 | 10 | 307 |
|
| AF-A0A1J5PQ67-F1-model_v4 | Tripartite tricarboxylate transporter family receptor | 0.9744 | 49 | 300 |
|
| AF-A0A5C8CF86-F1-model_v4 | deleted | 0.9742 | 23 | 305 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar