F472790
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 653 | 295 | 653 | 254 |
Family's Representative Sequence
| Representative Sequence | 3300045976|Ga0466967_0030567|Ga0466967_0030567_2222_2998 |
| Length | 246 |
| Sequence | VIIKKSPAEIDAMAAAGAIHTAVLDLLSRKVRPGVTTLELDQAAEKLIRSRGAEPSFKGYRGFTGSICASPNHMVVHGIPGPFKLQRGDVISIDVGVTKDGWVADGAITLPVGEVSPVAAKLLEVTKESLFKAVEQCVAGNHLGDVGHAVQQHVEGHIGRSMHEDPQIPNYGTPGKGVLLEEGMVLAIEPMTTAGRHAVRMGDDGWAIYSQDGSVAAHFEFTVAITSDGPRILTPWHETVSVAAAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 2 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 3 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 4 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 27 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 36 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 37 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 38 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 40 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 41 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 42 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 43 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 44 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 45 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 46 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 47 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 48 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 49 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 50 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 51 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 52 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 53 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 56 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 58 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 59 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 60 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 61 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 62 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009993 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG | Metagenome | Rhizosphere |
| 73 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 86 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 87 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 136 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 137 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 138 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 139 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 140 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 141 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 142 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 143 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 144 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 145 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 146 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 147 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 148 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 149 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 150 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 151 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 152 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 153 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 154 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 155 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 156 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 157 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 158 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 159 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 160 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 161 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 162 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 163 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 164 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 165 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 166 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 167 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 168 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 169 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 170 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 171 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 172 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 173 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 174 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 175 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 226 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 227 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 228 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 229 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 230 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 231 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 232 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 233 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 234 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 235 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 236 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 237 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 238 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 239 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 240 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 241 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 242 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 243 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 244 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 245 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 248 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 250 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 256 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 268 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 282 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 289 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 290 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 291 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 292 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 295 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.69 |
| Metatranscriptomes | 0.31 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.38 |
| Nodule | 0 |
| Rhizoplane | 11.18 |
| Rhizosphere | 85.45 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.99 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1000007 | 3300001977 | Bacteria | 20037 |
| 2 | JGI24748J21848_1000247 | 3300002074 | Bacteria | 6416 |
| 3 | JGI24034J26672_10000068 | 3300002239 | Bacteria | 28347 |
| 4 | JGI25406J46586_10005551 | 3300003203 | Bacteria | 5842 |
| 5 | JGI25406J46586_10043175 | 3300003203 | Bacteria | 1572 |
| 6 | Ga0070658_10129346 | 3300005327 | Bacteria | 2104 |
| 7 | Ga0070683_100003330 | 3300005329 | Bacteria | 12996 |
| 8 | Ga0070683_100011264 | 3300005329 | Bacteria | 7719 |
| 9 | Ga0070683_100082704 | 3300005329 | Bacteria | 3007 |
| 10 | Ga0070683_100103396 | 3300005329 | Bacteria | 2684 |
| 11 | Ga0070670_100042140 | 3300005331 | Bacteria | 3924 |
| 12 | Ga0070677_10001062 | 3300005333 | Bacteria | 8863 |
| 13 | Ga0070682_100000009 | 3300005337 | Bacteria | 291635 |
| 14 | Ga0070682_100000032 | 3300005337 | Bacteria | 155141 |
| 15 | Ga0068868_100000306 | 3300005338 | Bacteria | 32899 |
| 16 | Ga0068868_100008360 | 3300005338 | Bacteria | 7408 |
| 17 | Ga0068868_100143213 | 3300005338 | Bacteria | 1964 |
| 18 | Ga0068868_100265670 | 3300005338 | Bacteria | 1448 |
| 19 | Ga0070691_10065164 | 3300005341 | Bacteria | 1759 |
| 20 | Ga0070691_10113937 | 3300005341 | Bacteria | 1355 |
| 21 | Ga0070691_10162945 | 3300005341 | Bacteria | 1151 |
| 22 | Ga0070661_100000236 | 3300005344 | Bacteria | 45535 |
| 23 | Ga0070668_100618852 | 3300005347 | Bacteria | 949 |
| 24 | Ga0070675_100003153 | 3300005354 | Bacteria | 12477 |
| 25 | Ga0070674_100000047 | 3300005356 | Bacteria | 52597 |
| 26 | Ga0070673_100003060 | 3300005364 | Bacteria | 10351 |
| 27 | Ga0070688_100000562 | 3300005365 | Bacteria | 18826 |
| 28 | Ga0070714_100018243 | 3300005435 | Bacteria | 5696 |
| 29 | Ga0070714_100036840 | 3300005435 | Bacteria | 4106 |
| 30 | Ga0070713_100000171 | 3300005436 | Bacteria | 43503 |
| 31 | Ga0070713_100102600 | 3300005436 | Bacteria | 2481 |
| 32 | Ga0070701_10035945 | 3300005438 | Bacteria | 2493 |
| 33 | Ga0070701_10234072 | 3300005438 | Bacteria | 1101 |
| 34 | Ga0070711_100261378 | 3300005439 | Bacteria | 1362 |
| 35 | Ga0070700_100040018 | 3300005441 | Bacteria | 2867 |
| 36 | Ga0070663_100177069 | 3300005455 | Bacteria | 1652 |
| 37 | Ga0070678_100023357 | 3300005456 | Bacteria | 4119 |
| 38 | Ga0070678_100433769 | 3300005456 | Bacteria | 1148 |
| 39 | Ga0070662_100000007 | 3300005457 | Bacteria | 168761 |
| 40 | Ga0070662_100075278 | 3300005457 | Bacteria | 2500 |
| 41 | Ga0070662_100353189 | 3300005457 | Bacteria | 1205 |
| 42 | Ga0068867_100006857 | 3300005459 | Bacteria | 8056 |
| 43 | Ga0070685_10001063 | 3300005466 | Bacteria | 14725 |
| 44 | Ga0070685_10049807 | 3300005466 | Bacteria | 2417 |
| 45 | Ga0070685_10131056 | 3300005466 | Bacteria | 1568 |
| 46 | Ga0070685_10397569 | 3300005466 | Bacteria | 954 |
| 47 | Ga0070679_100245596 | 3300005530 | Bacteria | 1747 |
| 48 | Ga0070684_100067227 | 3300005535 | Bacteria | 3147 |
| 49 | Ga0070684_100113330 | 3300005535 | Bacteria | 2433 |
| 50 | Ga0070684_100197095 | 3300005535 | Bacteria | 1834 |
| 51 | Ga0070684_100367329 | 3300005535 | Bacteria | 1325 |
| 52 | Ga0070672_100000104 | 3300005543 | Bacteria | 42077 |
| 53 | Ga0070686_100079879 | 3300005544 | Bacteria | 2163 |
| 54 | Ga0070686_100107663 | 3300005544 | Bacteria | 1893 |
| 55 | Ga0070693_100003220 | 3300005547 | Bacteria | 7574 |
| 56 | Ga0070693_100277605 | 3300005547 | Bacteria | 1121 |
| 57 | Ga0070665_100000022 | 3300005548 | Bacteria | 379286 |
| 58 | Ga0070665_100051471 | 3300005548 | Bacteria | 4130 |
| 59 | Ga0070665_100065177 | 3300005548 | Bacteria | 3654 |
| 60 | Ga0070665_100093761 | 3300005548 | Bacteria | 3007 |
| 61 | Ga0070665_100188803 | 3300005548 | Bacteria | 2062 |
| 62 | Ga0070664_100094140 | 3300005564 | Bacteria | 2597 |
| 63 | Ga0070664_100271437 | 3300005564 | Bacteria | 1528 |
| 64 | Ga0068857_100120727 | 3300005577 | Bacteria | 2359 |
| 65 | Ga0068854_100000939 | 3300005578 | Bacteria | 17543 |
| 66 | Ga0068854_100048974 | 3300005578 | Bacteria | 3017 |
| 67 | Ga0068854_100110371 | 3300005578 | Bacteria | 2074 |
| 68 | Ga0068856_100007857 | 3300005614 | Bacteria | 10417 |
| 69 | Ga0070702_100020483 | 3300005615 | Bacteria | 3466 |
| 70 | Ga0068852_100000024 | 3300005616 | Bacteria | 120479 |
| 71 | Ga0068852_100058793 | 3300005616 | Bacteria | 3332 |
| 72 | Ga0068852_100574244 | 3300005616 | Bacteria | 1130 |
| 73 | Ga0068859_100179316 | 3300005617 | Bacteria | 2201 |
| 74 | Ga0068859_100304584 | 3300005617 | Bacteria | 1687 |
| 75 | Ga0068864_100000023 | 3300005618 | Bacteria | 257064 |
| 76 | Ga0068864_100196647 | 3300005618 | Bacteria | 1851 |
| 77 | Ga0068866_10000274 | 3300005718 | Bacteria | 24536 |
| 78 | Ga0068866_10117488 | 3300005718 | Bacteria | 1493 |
| 79 | Ga0068861_100095518 | 3300005719 | Bacteria | 2354 |
| 80 | Ga0068861_100175447 | 3300005719 | Bacteria | 1780 |
| 81 | Ga0068851_10018801 | 3300005834 | Bacteria | 3334 |
| 82 | Ga0068858_100000150 | 3300005842 | Bacteria | 73075 |
| 83 | Ga0068858_100000287 | 3300005842 | Bacteria | 54456 |
| 84 | Ga0068860_100033741 | 3300005843 | Bacteria | 4911 |
| 85 | Ga0081455_10020035 | 3300005937 | Bacteria | 6313 |
| 86 | Ga0081455_10027552 | 3300005937 | Bacteria | 5206 |
| 87 | Ga0081455_10054050 | 3300005937 | Bacteria | 3426 |
| 88 | Ga0081455_10165181 | 3300005937 | Bacteria | 1692 |
| 89 | Ga0081455_10303292 | 3300005937 | Bacteria | 1145 |
| 90 | Ga0081538_10027694 | 3300005981 | Bacteria | 3920 |
| 91 | Ga0081538_10073847 | 3300005981 | Bacteria | 1861 |
| 92 | Ga0081540_1049619 | 3300005983 | Bacteria | 2092 |
| 93 | Ga0081539_10001787 | 3300005985 | Bacteria | 34104 |
| 94 | Ga0081539_10002195 | 3300005985 | Bacteria | 28613 |
| 95 | Ga0081539_10069802 | 3300005985 | Bacteria | 1889 |
| 96 | Ga0081539_10151069 | 3300005985 | Bacteria | 1117 |
| 97 | Ga0075363_100270149 | 3300006048 | Bacteria | 982 |
| 98 | Ga0075364_10121829 | 3300006051 | Bacteria | 1746 |
| 99 | Ga0070715_10000003 | 3300006163 | Bacteria | 345282 |
| 100 | Ga0070712_100073343 | 3300006175 | Bacteria | 2455 |
| 101 | Ga0070712_100271821 | 3300006175 | Bacteria | 1362 |
| 102 | Ga0075367_10156081 | 3300006178 | Bacteria | 1418 |
| 103 | Ga0097621_100660377 | 3300006237 | Bacteria | 960 |
| 104 | Ga0075428_100032589 | 3300006844 | Bacteria | 5756 |
| 105 | Ga0075428_100074767 | 3300006844 | Bacteria | 3701 |
| 106 | Ga0075430_100017410 | 3300006846 | Bacteria | 6120 |
| 107 | Ga0075431_100017217 | 3300006847 | Bacteria | 7344 |
| 108 | Ga0075431_100303078 | 3300006847 | Bacteria | 1614 |
| 109 | Ga0075433_10004429 | 3300006852 | Bacteria | 10932 |
| 110 | Ga0075433_10036483 | 3300006852 | Bacteria | 4236 |
| 111 | Ga0068865_100000024 | 3300006881 | Bacteria | 94969 |
| 112 | Ga0068865_100044260 | 3300006881 | Bacteria | 3046 |
| 113 | Ga0097620_100179314 | 3300006931 | Bacteria | 2201 |
| 114 | Ga0097620_100304584 | 3300006931 | Bacteria | 1687 |
| 115 | Ga0111539_10476644 | 3300009094 | Bacteria | 1453 |
| 116 | Ga0111539_10815498 | 3300009094 | Bacteria | 1086 |
| 117 | Ga0105245_10000022 | 3300009098 | Bacteria | 181225 |
| 118 | Ga0105245_10000528 | 3300009098 | Bacteria | 35016 |
| 119 | Ga0105245_10019614 | 3300009098 | Bacteria | 5924 |
| 120 | Ga0105245_10219643 | 3300009098 | Bacteria | 1833 |
| 121 | Ga0105245_10946771 | 3300009098 | Bacteria | 904 |
| 122 | Ga0105247_10000064 | 3300009101 | Bacteria | 123994 |
| 123 | Ga0114129_10593115 | 3300009147 | Bacteria | 1436 |
| 124 | Ga0105243_10006175 | 3300009148 | Bacteria | 9263 |
| 125 | Ga0105243_10165271 | 3300009148 | Bacteria | 1912 |
| 126 | Ga0105243_10185937 | 3300009148 | Bacteria | 1811 |
| 127 | Ga0105243_10293287 | 3300009148 | Bacteria | 1471 |
| 128 | Ga0105242_10000123 | 3300009176 | Bacteria | 56900 |
| 129 | Ga0105242_10083889 | 3300009176 | Bacteria | 2669 |
| 130 | Ga0105248_10001735 | 3300009177 | Bacteria | 24226 |
| 131 | Ga0105248_10150674 | 3300009177 | Bacteria | 2624 |
| 132 | Ga0105248_10328110 | 3300009177 | Bacteria | 1724 |
| 133 | Ga0105248_10506754 | 3300009177 | Bacteria | 1361 |
| 134 | Ga0105238_10814416 | 3300009551 | Bacteria | 950 |
| 135 | Ga0105249_10000181 | 3300009553 | Bacteria | 73946 |
| 136 | Ga0105249_10231867 | 3300009553 | Bacteria | 1821 |
| 137 | Ga0105249_10962192 | 3300009553 | Bacteria | 922 |
| 138 | Ga0105028_106004 | 3300009993 | Bacteria | 1265 |
| 139 | Ga0105239_10034512 | 3300010375 | Bacteria | 5556 |
| 140 | Ga0105246_10139084 | 3300011119 | Bacteria | 1824 |
| 141 | Ga0157373_10406142 | 3300013100 | Bacteria | 977 |
| 142 | Ga0157371_10000818 | 3300013102 | Bacteria | 35712 |
| 143 | Ga0157370_10457680 | 3300013104 | Bacteria | 1173 |
| 144 | Ga0157369_10000068 | 3300013105 | Bacteria | 144274 |
| 145 | Ga0157369_10685281 | 3300013105 | Bacteria | 1056 |
| 146 | Ga0157378_10104189 | 3300013297 | Bacteria | 2593 |
| 147 | Ga0163162_10501097 | 3300013306 | Bacteria | 1345 |
| 148 | Ga0157372_10000809 | 3300013307 | Bacteria | 33940 |
| 149 | Ga0157372_10444173 | 3300013307 | Bacteria | 1512 |
| 150 | Ga0157372_10914320 | 3300013307 | Bacteria | 1018 |
| 151 | Ga0157375_10000126 | 3300013308 | Bacteria | 75410 |
| 152 | Ga0157375_10013539 | 3300013308 | Bacteria | 7263 |
| 153 | Ga0157375_10016258 | 3300013308 | Bacteria | 6675 |
| 154 | Ga0157375_10235762 | 3300013308 | Bacteria | 1989 |
| 155 | Ga0157375_10483148 | 3300013308 | Bacteria | 1404 |
| 156 | Ga0157380_10000326 | 3300014326 | Bacteria | 28781 |
| 157 | Ga0157380_10006736 | 3300014326 | Bacteria | 8119 |
| 158 | Ga0157380_10272336 | 3300014326 | Bacteria | 1544 |
| 159 | Ga0157380_10290888 | 3300014326 | Bacteria | 1500 |
| 160 | Ga0157376_10060903 | 3300014969 | Bacteria | 3172 |
| 161 | Ga0157376_10069866 | 3300014969 | Bacteria | 2979 |
| 162 | Ga0157376_10130173 | 3300014969 | Bacteria | 2244 |
| 163 | Ga0206353_11043234 | 3300020082 | Bacteria | 891 |
| 164 | Ga0224712_10004702 | 3300022467 | Bacteria | 3712 |
| 165 | Ga0207656_10000374 | 3300025321 | Bacteria | 15006 |
| 166 | Ga0207682_10000008 | 3300025893 | Bacteria | 87020 |
| 167 | Ga0207642_10000290 | 3300025899 | Bacteria | 15000 |
| 168 | Ga0207710_10000220 | 3300025900 | Bacteria | 50023 |
| 169 | Ga0207688_10065624 | 3300025901 | Bacteria | 2052 |
| 170 | Ga0207688_10265565 | 3300025901 | Bacteria | 1043 |
| 171 | Ga0207685_10000003 | 3300025905 | Bacteria | 344527 |
| 172 | Ga0207705_10115914 | 3300025909 | Bacteria | 1983 |
| 173 | Ga0207707_10282976 | 3300025912 | Bacteria | 1436 |
| 174 | Ga0207693_10004260 | 3300025915 | Bacteria | 12132 |
| 175 | Ga0207693_10020224 | 3300025915 | Bacteria | 5295 |
| 176 | Ga0207660_10209714 | 3300025917 | Bacteria | 1525 |
| 177 | Ga0207657_10226927 | 3300025919 | Bacteria | 1495 |
| 178 | Ga0207649_10000166 | 3300025920 | Bacteria | 53758 |
| 179 | Ga0207652_10160708 | 3300025921 | Bacteria | 2014 |
| 180 | Ga0207694_10000008 | 3300025924 | Bacteria | 484902 |
| 181 | Ga0207659_10000138 | 3300025926 | Bacteria | 42755 |
| 182 | Ga0207659_10211133 | 3300025926 | Bacteria | 1556 |
| 183 | Ga0207687_10000025 | 3300025927 | Bacteria | 175177 |
| 184 | Ga0207687_10000039 | 3300025927 | Bacteria | 114303 |
| 185 | Ga0207687_10000132 | 3300025927 | Bacteria | 50024 |
| 186 | Ga0207687_10002690 | 3300025927 | Bacteria | 12023 |
| 187 | Ga0207687_10186820 | 3300025927 | Bacteria | 1610 |
| 188 | Ga0207700_10000019 | 3300025928 | Bacteria | 183117 |
| 189 | Ga0207664_10013567 | 3300025929 | Bacteria | 5855 |
| 190 | Ga0207664_10272253 | 3300025929 | Bacteria | 1484 |
| 191 | Ga0207664_10590885 | 3300025929 | Bacteria | 997 |
| 192 | Ga0207690_10003914 | 3300025932 | Bacteria | 8802 |
| 193 | Ga0207690_10189662 | 3300025932 | Bacteria | 1554 |
| 194 | Ga0207706_10000018 | 3300025933 | Bacteria | 168729 |
| 195 | Ga0207706_10099120 | 3300025933 | Bacteria | 2563 |
| 196 | Ga0207686_10000066 | 3300025934 | Bacteria | 95095 |
| 197 | Ga0207709_10002223 | 3300025935 | Bacteria | 12376 |
| 198 | Ga0207709_10056127 | 3300025935 | Bacteria | 2436 |
| 199 | Ga0207669_10000002 | 3300025937 | Bacteria | 377651 |
| 200 | Ga0207669_10178502 | 3300025937 | Bacteria | 1520 |
| 201 | Ga0207704_10000308 | 3300025938 | Bacteria | 22892 |
| 202 | Ga0207704_10089325 | 3300025938 | Bacteria | 2019 |
| 203 | Ga0207704_10106714 | 3300025938 | Bacteria | 1882 |
| 204 | Ga0207704_10205407 | 3300025938 | Bacteria | 1445 |
| 205 | Ga0207691_10000430 | 3300025940 | Bacteria | 41789 |
| 206 | Ga0207691_10170670 | 3300025940 | Bacteria | 1905 |
| 207 | Ga0207691_10674546 | 3300025940 | Bacteria | 872 |
| 208 | Ga0207711_10000011 | 3300025941 | Bacteria | 518817 |
| 209 | Ga0207711_10139056 | 3300025941 | Bacteria | 2184 |
| 210 | Ga0207661_10000518 | 3300025944 | Bacteria | 24943 |
| 211 | Ga0207661_10000616 | 3300025944 | Bacteria | 22858 |
| 212 | Ga0207661_10001510 | 3300025944 | Bacteria | 15776 |
| 213 | Ga0207661_10009756 | 3300025944 | Bacteria | 6896 |
| 214 | Ga0207661_10035272 | 3300025944 | Bacteria | 3896 |
| 215 | Ga0207661_10083827 | 3300025944 | Bacteria | 2639 |
| 216 | Ga0207661_10307093 | 3300025944 | Bacteria | 1423 |
| 217 | Ga0207661_10541758 | 3300025944 | Bacteria | 1066 |
| 218 | Ga0207679_10006381 | 3300025945 | Bacteria | 7448 |
| 219 | Ga0207679_10321841 | 3300025945 | Bacteria | 1339 |
| 220 | Ga0207679_10652407 | 3300025945 | Bacteria | 952 |
| 221 | Ga0207651_10000746 | 3300025960 | Bacteria | 13950 |
| 222 | Ga0207712_10000067 | 3300025961 | Bacteria | 130079 |
| 223 | Ga0207668_10296374 | 3300025972 | Bacteria | 1333 |
| 224 | Ga0207640_10000821 | 3300025981 | Bacteria | 17670 |
| 225 | Ga0207640_10002941 | 3300025981 | Bacteria | 9162 |
| 226 | Ga0207640_10364690 | 3300025981 | Bacteria | 1165 |
| 227 | Ga0207677_10000046 | 3300026023 | Bacteria | 105382 |
| 228 | Ga0207677_10001476 | 3300026023 | Bacteria | 12436 |
| 229 | Ga0207677_10103388 | 3300026023 | Bacteria | 2103 |
| 230 | Ga0207703_10000122 | 3300026035 | Bacteria | 92656 |
| 231 | Ga0207639_10017220 | 3300026041 | Bacteria | 5123 |
| 232 | Ga0207639_10124457 | 3300026041 | Bacteria | 2124 |
| 233 | Ga0207678_10028326 | 3300026067 | Bacteria | 4891 |
| 234 | Ga0207678_10134526 | 3300026067 | Bacteria | 2109 |
| 235 | Ga0207678_10233411 | 3300026067 | Bacteria | 1575 |
| 236 | Ga0207678_10397596 | 3300026067 | Bacteria | 1193 |
| 237 | Ga0207678_10734607 | 3300026067 | Bacteria | 870 |
| 238 | Ga0207708_10022090 | 3300026075 | Bacteria | 4805 |
| 239 | Ga0207702_10002042 | 3300026078 | Bacteria | 19546 |
| 240 | Ga0207702_10017871 | 3300026078 | Bacteria | 5869 |
| 241 | Ga0207702_10164250 | 3300026078 | Bacteria | 2030 |
| 242 | Ga0207641_10000065 | 3300026088 | Bacteria | 156066 |
| 243 | Ga0207648_10004057 | 3300026089 | Bacteria | 15196 |
| 244 | Ga0207676_10000025 | 3300026095 | Bacteria | 261714 |
| 245 | Ga0207674_10190001 | 3300026116 | Bacteria | 2003 |
| 246 | Ga0207674_10313116 | 3300026116 | Bacteria | 1519 |
| 247 | Ga0207674_10396319 | 3300026116 | Bacteria | 1334 |
| 248 | Ga0207675_100082600 | 3300026118 | Bacteria | 3013 |
| 249 | Ga0207675_100121616 | 3300026118 | Bacteria | 2471 |
| 250 | Ga0207675_100625522 | 3300026118 | Bacteria | 1081 |
| 251 | Ga0207675_100961112 | 3300026118 | Bacteria | 872 |
| 252 | Ga0207683_10038808 | 3300026121 | Bacteria | 4154 |
| 253 | Ga0207698_10000014 | 3300026142 | Bacteria | 240703 |
| 254 | Ga0207698_10032167 | 3300026142 | Bacteria | 3797 |
| 255 | Ga0207698_10694028 | 3300026142 | Bacteria | 1012 |
| 256 | Ga0268266_10000029 | 3300028379 | Bacteria | 424015 |
| 257 | Ga0268266_10018264 | 3300028379 | Bacteria | 5979 |
| 258 | Ga0268266_10055970 | 3300028379 | Bacteria | 3392 |
| 259 | Ga0268266_10080327 | 3300028379 | Bacteria | 2841 |
| 260 | Ga0268265_10348199 | 3300028380 | Bacteria | 1352 |
| 261 | Ga0268264_10039342 | 3300028381 | Bacteria | 3907 |
| 262 | Ga0268264_10067600 | 3300028381 | Bacteria | 3017 |
| 263 | Ga0265319_1000030 | 3300028563 | Bacteria | 129742 |
| 264 | Ga0265318_10090314 | 3300028577 | Bacteria | 1128 |
| 265 | Ga0265338_10000156 | 3300028800 | Bacteria | 125065 |
| 266 | Ga0265325_10010101 | 3300031241 | Bacteria | 5483 |
| 267 | Ga0265331_10105172 | 3300031250 | Bacteria | 1297 |
| 268 | Ga0265327_10002567 | 3300031251 | Bacteria | 18810 |
| 269 | Ga0307405_10152409 | 3300031731 | Bacteria | 1627 |
| 270 | Ga0307413_10438786 | 3300031824 | Bacteria | 1033 |
| 271 | Ga0307406_10437629 | 3300031901 | Bacteria | 1046 |
| 272 | Ga0307407_10012271 | 3300031903 | Bacteria | 4112 |
| 273 | Ga0307407_10192379 | 3300031903 | Bacteria | 1361 |
| 274 | Ga0307407_10349805 | 3300031903 | Bacteria | 1046 |
| 275 | Ga0307412_10469627 | 3300031911 | Bacteria | 1041 |
| 276 | Ga0307409_100008475 | 3300031995 | Bacteria | 6244 |
| 277 | Ga0307409_100019697 | 3300031995 | Bacteria | 4577 |
| 278 | Ga0307409_100287696 | 3300031995 | Bacteria | 1522 |
| 279 | Ga0307409_100412180 | 3300031995 | Bacteria | 1294 |
| 280 | Ga0307409_100667724 | 3300031995 | Bacteria | 1035 |
| 281 | Ga0307409_100767858 | 3300031995 | Bacteria | 969 |
| 282 | Ga0307416_100035326 | 3300032002 | Bacteria | 3815 |
| 283 | Ga0307416_100077786 | 3300032002 | Bacteria | 2788 |
| 284 | Ga0307416_100342458 | 3300032002 | Bacteria | 1509 |
| 285 | Ga0307416_100726444 | 3300032002 | Bacteria | 1084 |
| 286 | Ga0307414_10017391 | 3300032004 | Bacteria | 4398 |
| 287 | Ga0307411_10098326 | 3300032005 | Bacteria | 2062 |
| 288 | Ga0307415_100002491 | 3300032126 | Bacteria | 9198 |
| 289 | Ga0307415_100010091 | 3300032126 | Bacteria | 5330 |
| 290 | Ga0307415_100013172 | 3300032126 | Bacteria | 4817 |
| 291 | Ga0307415_100025248 | 3300032126 | Bacteria | 3725 |
| 292 | Ga0307415_100044685 | 3300032126 | Bacteria | 2963 |
| 293 | Ga0373942_0079747 | 3300035207 | Bacteria | 970 |
| 294 | Ga0373937_0038132 | 3300036401 | Bacteria | 4380 |
| 295 | Ga0395899_0134176 | 3300037312 | Bacteria | 1766 |
| 296 | Ga0395900_0072801 | 3300037418 | Bacteria | 3532 |
| 297 | Ga0395900_0463763 | 3300037418 | Bacteria | 1221 |
| 298 | Ga0395898_0009239 | 3300037466 | Bacteria | 10370 |
| 299 | Ga0395898_0040875 | 3300037466 | Bacteria | 4583 |
| 300 | Ga0395898_0283873 | 3300037466 | Bacteria | 1579 |
| 301 | Ga0395898_0312125 | 3300037466 | Bacteria | 1500 |
| 302 | Ga0395898_0321994 | 3300037466 | Bacteria | 1475 |
| 303 | Ga0395898_0910505 | 3300037466 | Bacteria | 817 |
| 304 | Ga0395901_0024727 | 3300038443 | Bacteria | 6166 |
| 305 | Ga0395901_0025795 | 3300038443 | Bacteria | 6034 |
| 306 | Ga0395901_0082956 | 3300038443 | Bacteria | 3350 |
| 307 | Ga0395901_0190287 | 3300038443 | Bacteria | 2152 |
| 308 | Ga0395901_0241075 | 3300038443 | Bacteria | 1886 |
| 309 | Ga0395901_0468617 | 3300038443 | Bacteria | 1286 |
| 310 | Ga0395901_0483435 | 3300038443 | Bacteria | 1263 |
| 311 | Ga0451845_0823628 | 3300041501 | Bacteria | 1919 |
| 312 | Ga0451849_0498249 | 3300041505 | Bacteria | 898 |
| 313 | Ga0451843_0198215 | 3300041509 | Bacteria | 841 |
| 314 | Ga0451843_1563928 | 3300041509 | Bacteria | 1134 |
| 315 | Ga0451853_2591154 | 3300041512 | Bacteria | 4158 |
| 316 | Ga0451853_3433959 | 3300041512 | Bacteria | 957 |
| 317 | Ga0451853_3641588 | 3300041512 | Bacteria | 3868 |
| 318 | Ga0439454_010784 | 3300042011 | Bacteria | 1210 |
| 319 | Ga0439456_044060 | 3300042013 | Bacteria | 970 |
| 320 | Ga0466965_0076411 | 3300044683 | Bacteria | 1690 |
| 321 | Ga0466965_0159844 | 3300044683 | Bacteria | 1181 |
| 322 | Ga0466966_0058483 | 3300044684 | Bacteria | 2436 |
| 323 | Ga0466961_0148442 | 3300044693 | Bacteria | 1465 |
| 324 | Ga0466963_0012957 | 3300044694 | Bacteria | 5111 |
| 325 | Ga0466963_0023486 | 3300044694 | Bacteria | 3917 |
| 326 | Ga0466963_0055527 | 3300044694 | Bacteria | 2634 |
| 327 | Ga0466963_0126235 | 3300044694 | Bacteria | 1764 |
| 328 | Ga0466963_0130524 | 3300044694 | Bacteria | 1735 |
| 329 | Ga0466963_0193776 | 3300044694 | Bacteria | 1420 |
| 330 | Ga0466963_0202256 | 3300044694 | Bacteria | 1389 |
| 331 | Ga0466964_0150548 | 3300044706 | Bacteria | 1078 |
| 332 | Ga0453684_0080379 | 3300044712 | Bacteria | 4071 |
| 333 | Ga0466971_0033430 | 3300044719 | Bacteria | 2305 |
| 334 | Ga0466957_0004792 | 3300044842 | Bacteria | 7572 |
| 335 | Ga0466957_0043709 | 3300044842 | Bacteria | 2714 |
| 336 | Ga0466957_0150974 | 3300044842 | Bacteria | 1502 |
| 337 | Ga0466957_0203871 | 3300044842 | Bacteria | 1300 |
| 338 | Ga0466957_0328556 | 3300044842 | Bacteria | 1033 |
| 339 | Ga0466960_0000460 | 3300044901 | Bacteria | 13965 |
| 340 | Ga0466960_0027690 | 3300044901 | Bacteria | 2588 |
| 341 | Ga0466960_0144359 | 3300044901 | Bacteria | 1267 |
| 342 | Ga0466960_0199484 | 3300044901 | Bacteria | 1092 |
| 343 | Ga0466960_0362066 | 3300044901 | Bacteria | 829 |
| 344 | Ga0466959_0009134 | 3300045049 | Bacteria | 7040 |
| 345 | Ga0466959_0217491 | 3300045049 | Bacteria | 1326 |
| 346 | Ga0466958_0076506 | 3300045836 | Bacteria | 2054 |
| 347 | Ga0466958_0135071 | 3300045836 | Bacteria | 1551 |
| 348 | Ga0466958_0323430 | 3300045836 | Bacteria | 991 |
| 349 | Ga0466967_0000003 | 3300045976 | Bacteria | 169144 |
| 350 | Ga0466967_0002408 | 3300045976 | Bacteria | 11613 |
| 351 | Ga0466967_0008949 | 3300045976 | Bacteria | 7392 |
| 352 | Ga0466967_0029422 | 3300045976 | Bacteria | 4597 |
| 353 | Ga0466967_0030567 | 3300045976 | Bacteria | 4522 |
| 354 | Ga0466967_0034352 | 3300045976 | Bacteria | 4303 |
| 355 | Ga0466967_0103409 | 3300045976 | Bacteria | 2606 |
| 356 | Ga0466967_0109548 | 3300045976 | Bacteria | 2535 |
| 357 | Ga0466967_0109663 | 3300045976 | Bacteria | 2534 |
| 358 | Ga0466967_0123584 | 3300045976 | Bacteria | 2394 |
| 359 | Ga0466967_0136654 | 3300045976 | Bacteria | 2280 |
| 360 | Ga0466967_0183824 | 3300045976 | Bacteria | 1973 |
| 361 | Ga0466967_0339224 | 3300045976 | Bacteria | 1453 |
| 362 | Ga0466967_0403017 | 3300045976 | Bacteria | 1331 |
| 363 | Ga0466967_0427548 | 3300045976 | Bacteria | 1292 |
| 364 | Ga0466967_0653762 | 3300045976 | Bacteria | 1040 |
| 365 | Ga0466967_0732095 | 3300045976 | Bacteria | 980 |
| 366 | Ga0495592_0001496 | 3300046454 | Bacteria | 16278 |
| 367 | Ga0495592_0079775 | 3300046454 | Bacteria | 2369 |
| 368 | Ga0495592_0087018 | 3300046454 | Bacteria | 2249 |
| 369 | Ga0495592_0281832 | 3300046454 | Bacteria | 1087 |
| 370 | Ga0495603_0000323 | 3300046455 | Bacteria | 25798 |
| 371 | Ga0495603_0000484 | 3300046455 | Bacteria | 22028 |
| 372 | Ga0495603_0158301 | 3300046455 | Bacteria | 1314 |
| 373 | Ga0495629_0000543 | 3300046459 | Bacteria | 31107 |
| 374 | Ga0495629_0006510 | 3300046459 | Bacteria | 8654 |
| 375 | Ga0495641_0000400 | 3300046461 | Bacteria | 36235 |
| 376 | Ga0495641_0019407 | 3300046461 | Bacteria | 3478 |
| 377 | Ga0495641_0023186 | 3300046461 | Bacteria | 3089 |
| 378 | Ga0495641_0057959 | 3300046461 | Bacteria | 1754 |
| 379 | Ga0495641_0127454 | 3300046461 | Bacteria | 1136 |
| 380 | Ga0495651_0050048 | 3300046462 | Bacteria | 3225 |
| 381 | Ga0495651_0120977 | 3300046462 | Bacteria | 1924 |
| 382 | Ga0495653_0030114 | 3300046463 | Bacteria | 4327 |
| 383 | Ga0495653_0120417 | 3300046463 | Bacteria | 1872 |
| 384 | Ga0495650_0000121 | 3300046471 | Bacteria | 183055 |
| 385 | Ga0495582_0000006 | 3300046473 | Bacteria | 140434 |
| 386 | Ga0495662_0000236 | 3300046476 | Bacteria | 23206 |
| 387 | Ga0495662_0004441 | 3300046476 | Bacteria | 7042 |
| 388 | Ga0495664_0142988 | 3300046477 | Bacteria | 1450 |
| 389 | Ga0495664_0299108 | 3300046477 | Bacteria | 971 |
| 390 | Ga0495594_0000001 | 3300046499 | Bacteria | 293051 |
| 391 | Ga0495606_0000283 | 3300046507 | Bacteria | 88309 |
| 392 | Ga0495608_0000010 | 3300046511 | Bacteria | 258660 |
| 393 | Ga0495608_0001727 | 3300046511 | Bacteria | 15654 |
| 394 | Ga0495608_0043662 | 3300046511 | Bacteria | 2994 |
| 395 | Ga0495620_0000668 | 3300046515 | Bacteria | 21158 |
| 396 | Ga0495620_0103173 | 3300046515 | Bacteria | 1135 |
| 397 | Ga0495628_0000864 | 3300046516 | Bacteria | 28036 |
| 398 | Ga0495628_0076311 | 3300046516 | Bacteria | 2608 |
| 399 | Ga0495630_0000148 | 3300046517 | Bacteria | 54619 |
| 400 | Ga0495644_0003645 | 3300046523 | Bacteria | 6070 |
| 401 | Ga0495652_0198398 | 3300046529 | Bacteria | 1525 |
| 402 | Ga0495640_0009674 | 3300046533 | Bacteria | 7495 |
| 403 | Ga0495640_0046086 | 3300046533 | Bacteria | 3023 |
| 404 | Ga0495587_0071897 | 3300046536 | Bacteria | 2012 |
| 405 | Ga0495598_0049838 | 3300046537 | Bacteria | 1257 |
| 406 | Ga0495645_0004698 | 3300046543 | Bacteria | 9326 |
| 407 | Ga0495622_0000069 | 3300046557 | Bacteria | 89759 |
| 408 | Ga0495633_0080939 | 3300046558 | Bacteria | 1511 |
| 409 | Ga0495667_0000067 | 3300046559 | Bacteria | 81751 |
| 410 | Ga0495667_0010689 | 3300046559 | Bacteria | 6207 |
| 411 | Ga0495667_0130209 | 3300046559 | Bacteria | 1623 |
| 412 | Ga0495656_0002090 | 3300046615 | Bacteria | 6591 |
| 413 | Ga0495656_0071008 | 3300046615 | Bacteria | 1547 |
| 414 | Ga0495634_0000021 | 3300046642 | Bacteria | 120521 |
| 415 | Ga0495634_0000993 | 3300046642 | Bacteria | 26739 |
| 416 | Ga0495625_0000109 | 3300046660 | Bacteria | 125064 |
| 417 | Ga0495635_0100778 | 3300046663 | Bacteria | 1974 |
| 418 | Ga0495588_0000175 | 3300046674 | Bacteria | 80911 |
| 419 | Ga0495657_0000005 | 3300046675 | Bacteria | 254860 |
| 420 | Ga0495657_0001760 | 3300046675 | Bacteria | 18520 |
| 421 | Ga0495599_0013297 | 3300046678 | Bacteria | 5087 |
| 422 | Ga0495647_0000114 | 3300046681 | Bacteria | 20349 |
| 423 | Ga0495647_0006403 | 3300046681 | Bacteria | 3896 |
| 424 | Ga0495647_0195749 | 3300046681 | Bacteria | 885 |
| 425 | Ga0495658_0000094 | 3300046683 | Bacteria | 46061 |
| 426 | Ga0495658_0006678 | 3300046683 | Bacteria | 5671 |
| 427 | Ga0495669_0000189 | 3300046684 | Bacteria | 38286 |
| 428 | Ga0495613_0000087 | 3300046689 | Bacteria | 88644 |
| 429 | Ga0495613_0036945 | 3300046689 | Bacteria | 3621 |
| 430 | Ga0495624_0000429 | 3300046690 | Bacteria | 33305 |
| 431 | Ga0495624_0000767 | 3300046690 | Bacteria | 25280 |
| 432 | Ga0495670_0009083 | 3300046691 | Bacteria | 4888 |
| 433 | Ga0495649_0004973 | 3300046694 | Bacteria | 8555 |
| 434 | Ga0495600_0019425 | 3300046809 | Bacteria | 4339 |
| 435 | Ga0495600_0053148 | 3300046809 | Bacteria | 2645 |
| 436 | Ga0495581_0119853 | 3300047315 | Bacteria | 1531 |
| 437 | Ga0495581_0258316 | 3300047315 | Bacteria | 1019 |
| 438 | Ga0495604_0000294 | 3300047317 | Bacteria | 44723 |
| 439 | Ga0495604_0000322 | 3300047317 | Bacteria | 42966 |
| 440 | Ga0495604_0128702 | 3300047317 | Bacteria | 1822 |
| 441 | Ga0495674_0000141 | 3300047319 | Bacteria | 55539 |
| 442 | Ga0495676_0001315 | 3300047321 | Bacteria | 21280 |
| 443 | Ga0495676_0048203 | 3300047321 | Bacteria | 3437 |
| 444 | Ga0495676_0249983 | 3300047321 | Bacteria | 1210 |
| 445 | Ga0495680_0001951 | 3300047322 | Bacteria | 21721 |
| 446 | Ga0495680_0002419 | 3300047322 | Bacteria | 19096 |
| 447 | Ga0495680_0075724 | 3300047322 | Bacteria | 2553 |
| 448 | Ga0495680_0227865 | 3300047322 | Bacteria | 1328 |
| 449 | Ga0495675_0000398 | 3300047444 | Bacteria | 30075 |
| 450 | Ga0495675_0218491 | 3300047444 | Bacteria | 1154 |
| 451 | Ga0495679_066319 | 3300047446 | Bacteria | 1048 |
| 452 | Ga0495686_0227749 | 3300047472 | Bacteria | 1057 |
| 453 | Ga0495686_0244644 | 3300047472 | Bacteria | 1010 |
| 454 | Ga0495593_0238833 | 3300047673 | Bacteria | 910 |
| 455 | Ga0495602_0000038 | 3300048088 | Bacteria | 130758 |
| 456 | Ga0495602_0003702 | 3300048088 | Bacteria | 15861 |
| 457 | Ga0495602_0037972 | 3300048088 | Bacteria | 4460 |
| 458 | Ga0495602_0053710 | 3300048088 | Bacteria | 3565 |
| 459 | Ga0496100_0000004 | 3300048903 | Bacteria | 321778 |
| 460 | Ga0496101_0000007 | 3300048904 | Bacteria | 321778 |
| 461 | Ga0496101_0011807 | 3300048904 | Bacteria | 5810 |
| 462 | Ga0496101_0111249 | 3300048904 | Bacteria | 2062 |
| 463 | Ga0496101_0274789 | 3300048904 | Bacteria | 1316 |
| 464 | Ga0496101_0385239 | 3300048904 | Bacteria | 1103 |
| 465 | Ga0496102_0000021 | 3300048905 | Bacteria | 246920 |
| 466 | Ga0496102_0187168 | 3300048905 | Bacteria | 1951 |
| 467 | Ga0496102_0341715 | 3300048905 | Bacteria | 1410 |
| 468 | Ga0496103_0000001 | 3300048906 | Bacteria | 643471 |
| 469 | Ga0496103_0015888 | 3300048906 | Bacteria | 4487 |
| 470 | Ga0496103_0489109 | 3300048906 | Bacteria | 788 |
| 471 | Ga0496104_0000008 | 3300048907 | Bacteria | 516976 |
| 472 | Ga0496104_0004081 | 3300048907 | Bacteria | 12671 |
| 473 | Ga0496104_0037414 | 3300048907 | Bacteria | 4539 |
| 474 | Ga0496104_0110347 | 3300048907 | Bacteria | 2637 |
| 475 | Ga0496105_0000002 | 3300048908 | Bacteria | 753215 |
| 476 | Ga0496105_0000003 | 3300048908 | Bacteria | 713251 |
| 477 | Ga0496105_0000070 | 3300048908 | Bacteria | 80117 |
| 478 | Ga0496105_0071324 | 3300048908 | Bacteria | 2871 |
| 479 | Ga0496106_0000004 | 3300048909 | Bacteria | 279896 |
| 480 | Ga0496106_0001451 | 3300048909 | Bacteria | 17805 |
| 481 | Ga0496106_0106511 | 3300048909 | Bacteria | 2179 |
| 482 | Ga0496106_0424051 | 3300048909 | Bacteria | 1069 |
| 483 | Ga0496107_0000001 | 3300048910 | Bacteria | 321778 |
| 484 | Ga0496107_0007562 | 3300048910 | Bacteria | 7494 |
| 485 | Ga0496107_0048186 | 3300048910 | Bacteria | 3069 |
| 486 | Ga0496107_0180549 | 3300048910 | Bacteria | 1567 |
| 487 | Ga0496108_0000004 | 3300048911 | Bacteria | 545055 |
| 488 | Ga0496108_0000042 | 3300048911 | Bacteria | 146397 |
| 489 | Ga0496108_0000339 | 3300048911 | Bacteria | 39428 |
| 490 | Ga0496108_0002451 | 3300048911 | Bacteria | 14838 |
| 491 | Ga0496108_0057211 | 3300048911 | Bacteria | 3276 |
| 492 | Ga0496108_0079573 | 3300048911 | Bacteria | 2775 |
| 493 | Ga0496108_0343565 | 3300048911 | Bacteria | 1302 |
| 494 | Ga0496109_0000034 | 3300048912 | Bacteria | 160397 |
| 495 | Ga0496109_0000036 | 3300048912 | Bacteria | 153972 |
| 496 | Ga0496109_0000062 | 3300048912 | Bacteria | 112843 |
| 497 | Ga0496109_0000550 | 3300048912 | Bacteria | 31748 |
| 498 | Ga0496109_0350753 | 3300048912 | Bacteria | 1394 |
| 499 | Ga0496109_0359702 | 3300048912 | Bacteria | 1375 |
| 500 | Ga0496109_0366013 | 3300048912 | Bacteria | 1362 |
| 501 | Ga0496110_0000325 | 3300048913 | Bacteria | 31707 |
| 502 | Ga0496110_0077462 | 3300048913 | Bacteria | 2958 |
| 503 | Ga0496110_0139814 | 3300048913 | Bacteria | 2189 |
| 504 | Ga0496110_0150938 | 3300048913 | Bacteria | 2104 |
| 505 | Ga0496110_0528878 | 3300048913 | Bacteria | 1072 |
| 506 | Ga0496110_0577391 | 3300048913 | Bacteria | 1021 |
| 507 | Ga0496110_0866528 | 3300048913 | Bacteria | 809 |
| 508 | Ga0496111_0000171 | 3300048914 | Bacteria | 29367 |
| 509 | Ga0496111_0010712 | 3300048914 | Bacteria | 6167 |
| 510 | Ga0496111_0036271 | 3300048914 | Bacteria | 3525 |
| 511 | Ga0496111_0049910 | 3300048914 | Bacteria | 3017 |
| 512 | Ga0496111_0052355 | 3300048914 | Bacteria | 2947 |
| 513 | Ga0496111_0102252 | 3300048914 | Bacteria | 2106 |
| 514 | Ga0496111_0123300 | 3300048914 | Bacteria | 1915 |
| 515 | Ga0496111_0150604 | 3300048914 | Bacteria | 1725 |
| 516 | Ga0496111_0419569 | 3300048914 | Bacteria | 988 |
| 517 | Ga0496111_0436824 | 3300048914 | Bacteria | 966 |
| 518 | Ga0496112_0000002 | 3300048915 | Bacteria | 782039 |
| 519 | Ga0496112_0017988 | 3300048915 | Bacteria | 6650 |
| 520 | Ga0496112_0032041 | 3300048915 | Bacteria | 5102 |
| 521 | Ga0496112_0034473 | 3300048915 | Bacteria | 4926 |
| 522 | Ga0496112_0034566 | 3300048915 | Bacteria | 4919 |
| 523 | Ga0496112_0174886 | 3300048915 | Bacteria | 2112 |
| 524 | Ga0496113_0000002 | 3300048916 | Bacteria | 220193 |
| 525 | Ga0496113_0009761 | 3300048916 | Bacteria | 6310 |
| 526 | Ga0496113_0087777 | 3300048916 | Bacteria | 2392 |
| 527 | Ga0496113_0202829 | 3300048916 | Bacteria | 1576 |
| 528 | Ga0496114_0137030 | 3300048917 | Bacteria | 2117 |
| 529 | Ga0496114_0151098 | 3300048917 | Bacteria | 2015 |
| 530 | Ga0496114_0171783 | 3300048917 | Bacteria | 1889 |
| 531 | Ga0496114_0533770 | 3300048917 | Bacteria | 1037 |
| 532 | Ga0496119_0014960 | 3300048922 | Bacteria | 6023 |
| 533 | Ga0496119_0041652 | 3300048922 | Bacteria | 2922 |
| 534 | Ga0496120_0104518 | 3300048923 | Bacteria | 1490 |
| 535 | Ga0496121_0010570 | 3300048924 | Bacteria | 10377 |
| 536 | Ga0496125_0066986 | 3300048928 | Bacteria | 2833 |
| 537 | Ga0496126_0016119 | 3300048929 | Bacteria | 7488 |
| 538 | Ga0501031_0026581 | 3300049568 | Bacteria | 3773 |
| 539 | Ga0501031_0026834 | 3300049568 | Bacteria | 3755 |
| 540 | Ga0501032_0001419 | 3300049569 | Bacteria | 19025 |
| 541 | Ga0501033_0022982 | 3300049570 | Bacteria | 4700 |
| 542 | Ga0501033_0222241 | 3300049570 | Bacteria | 1344 |
| 543 | Ga0501034_0004487 | 3300049571 | Bacteria | 15515 |
| 544 | Ga0501034_0382839 | 3300049571 | Bacteria | 1331 |
| 545 | Ga0501034_0708529 | 3300049571 | Bacteria | 905 |
| 546 | Ga0501036_0056081 | 3300049572 | Bacteria | 3337 |
| 547 | Ga0501036_0368307 | 3300049572 | Bacteria | 1199 |
| 548 | Ga0501037_0105955 | 3300049573 | Bacteria | 2026 |
| 549 | Ga0501038_0007184 | 3300049574 | Bacteria | 10295 |
| 550 | Ga0501038_0171028 | 3300049574 | Unclassified | 1759 |
| 551 | Ga0501039_0022063 | 3300049575 | Bacteria | 4886 |
| 552 | Ga0501039_0111261 | 3300049575 | Bacteria | 2141 |
| 553 | Ga0501039_0311554 | 3300049575 | Bacteria | 1237 |
| 554 | Ga0501040_0049974 | 3300049576 | Bacteria | 2859 |
| 555 | Ga0501040_0221476 | 3300049576 | Bacteria | 1346 |
| 556 | Ga0501041_0177052 | 3300049577 | Bacteria | 1335 |
| 557 | Ga0501042_0001923 | 3300049578 | Bacteria | 12499 |
| 558 | Ga0501042_0095787 | 3300049578 | Bacteria | 2132 |
| 559 | Ga0501042_0117250 | 3300049578 | Bacteria | 1917 |
| 560 | Ga0501043_0110501 | 3300049579 | Bacteria | 2158 |
| 561 | Ga0501046_0008154 | 3300049580 | Bacteria | 9150 |
| 562 | Ga0501046_0226711 | 3300049580 | Bacteria | 1382 |
| 563 | Ga0501047_0060675 | 3300049581 | Bacteria | 3649 |
| 564 | Ga0501047_0188097 | 3300049581 | Bacteria | 1929 |
| 565 | Ga0501048_0002360 | 3300049582 | Bacteria | 14414 |
| 566 | Ga0501048_0096926 | 3300049582 | Bacteria | 2080 |
| 567 | Ga0501068_0127195 | 3300049584 | Bacteria | 1592 |
| 568 | Ga0501068_0146113 | 3300049584 | Bacteria | 1484 |
| 569 | Ga0501068_0360953 | 3300049584 | Bacteria | 934 |
| 570 | Ga0501069_0001568 | 3300049585 | Bacteria | 11306 |
| 571 | Ga0501069_0022074 | 3300049585 | Bacteria | 3459 |
| 572 | Ga0501069_0323128 | 3300049585 | Bacteria | 907 |
| 573 | Ga0501070_0064865 | 3300049586 | Bacteria | 3024 |
| 574 | Ga0501070_0112009 | 3300049586 | Bacteria | 2255 |
| 575 | Ga0501070_0249330 | 3300049586 | Bacteria | 1452 |
| 576 | Ga0501070_0330536 | 3300049586 | Bacteria | 1239 |
| 577 | Ga0501070_0429254 | 3300049586 | Bacteria | 1067 |
| 578 | Ga0501070_0518801 | 3300049586 | Unclassified | 956 |
| 579 | Ga0501070_0603957 | 3300049586 | Bacteria | 874 |
| 580 | Ga0501071_0161256 | 3300049587 | Bacteria | 1676 |
| 581 | Ga0501071_0212892 | 3300049587 | Bacteria | 1453 |
| 582 | Ga0501071_0308413 | 3300049587 | Bacteria | 1201 |
| 583 | Ga0501072_0279384 | 3300049588 | Bacteria | 1328 |
| 584 | Ga0501072_0290036 | 3300049588 | Bacteria | 1301 |
| 585 | Ga0501073_0005329 | 3300049589 | Bacteria | 9645 |
| 586 | Ga0501074_0025643 | 3300049590 | Bacteria | 4278 |
| 587 | Ga0501074_0030502 | 3300049590 | Bacteria | 3908 |
| 588 | Ga0501074_0105602 | 3300049590 | Bacteria | 2016 |
| 589 | Ga0501075_0000876 | 3300049591 | Bacteria | 19068 |
| 590 | Ga0501075_0041409 | 3300049591 | Bacteria | 3452 |
| 591 | Ga0501075_0044341 | 3300049591 | Bacteria | 3337 |
| 592 | Ga0501076_0077091 | 3300049592 | Bacteria | 2674 |
| 593 | Ga0501076_0096251 | 3300049592 | Bacteria | 2384 |
| 594 | Ga0501076_0163483 | 3300049592 | Unclassified | 1814 |
| 595 | Ga0501076_0192907 | 3300049592 | Bacteria | 1663 |
| 596 | Ga0501077_0319061 | 3300049593 | Bacteria | 990 |
| 597 | Ga0501077_0337524 | 3300049593 | Bacteria | 961 |
| 598 | Ga0501077_0394061 | 3300049593 | Bacteria | 885 |
| 599 | Ga0501079_0122656 | 3300049741 | Bacteria | 2021 |
| 600 | Ga0501079_0161416 | 3300049741 | Bacteria | 1748 |
| 601 | Ga0501079_0176103 | 3300049741 | Bacteria | 1668 |
| 602 | Ga0501079_0380657 | 3300049741 | Bacteria | 1106 |
| 603 | Ga0501080_0116077 | 3300049742 | Bacteria | 2482 |
| 604 | Ga0501080_0388009 | 3300049742 | Bacteria | 1257 |
| 605 | Ga0501083_0043410 | 3300049744 | Bacteria | 3046 |
| 606 | Ga0501083_0188392 | 3300049744 | Bacteria | 1346 |
| 607 | Ga0501035_0685903 | 3300049822 | Bacteria | 827 |
| 608 | Ga0501044_0045201 | 3300049823 | Bacteria | 4564 |
| 609 | Ga0501044_0217646 | 3300049823 | Bacteria | 1861 |
| 610 | Ga0501044_0376820 | 3300049823 | Bacteria | 1335 |
| 611 | Ga0501045_0094375 | 3300049824 | Bacteria | 2213 |
| 612 | Ga0501045_0095262 | 3300049824 | Bacteria | 2202 |
| 613 | Ga0501045_0109271 | 3300049824 | Bacteria | 2050 |
| 614 | Ga0501045_0514831 | 3300049824 | Bacteria | 888 |
| 615 | nmdc:mga05p37_366036_c1 | 3300050507 | Bacteria | 1693 |
| 616 | nmdc:mga09592_61724_c1 | 3300050508 | Bacteria | 3170 |
| 617 | nmdc:mga0qj67_52476_c1 | 3300050509 | Bacteria | 3227 |
| 618 | nmdc:mga06r32_45944_c1 | 3300050510 | Bacteria | 4165 |
| 619 | nmdc:mga08y16_32980_c1 | 3300050511 | Bacteria | 5442 |
| 620 | nmdc:mga0rr50_564992_c1 | 3300050513 | Bacteria | 969 |
| 621 | nmdc:mga0a205_15_c2 | 3300050515 | Bacteria | 75060 |
| 622 | nmdc:mga0a205_6812_c1 | 3300050515 | Bacteria | 10339 |
| 623 | Ga0495601_0000698 | 3300053077 | Bacteria | 18035 |
| 624 | Ga0495601_0003864 | 3300053077 | Bacteria | 8624 |
| 625 | Ga0495612_0000820 | 3300053078 | Bacteria | 12636 |
| 626 | Ga0495612_0001451 | 3300053078 | Bacteria | 9769 |
| 627 | Ga0495612_0029568 | 3300053078 | Bacteria | 2207 |
| 628 | Ga0495612_0106594 | 3300053078 | Bacteria | 1197 |
| 629 | Ga0495655_0000120 | 3300053083 | Bacteria | 14477 |
| 630 | Ga0495595_0000005 | 3300053084 | Bacteria | 258660 |
| 631 | Ga0495595_0082519 | 3300053084 | Bacteria | 1533 |
| 632 | Ga0495619_0000036 | 3300053085 | Bacteria | 125188 |
| 633 | Ga0495619_0000069 | 3300053085 | Bacteria | 82755 |
| 634 | Ga0495619_0000489 | 3300053085 | Bacteria | 26595 |
| 635 | Ga0495619_0001663 | 3300053085 | Bacteria | 14686 |
| 636 | Ga0495619_0005994 | 3300053085 | Bacteria | 7695 |
| 637 | Ga0495619_0045797 | 3300053085 | Bacteria | 2874 |
| 638 | Ga0500566_0013929 | 3300053094 | Bacteria | 4727 |
| 639 | Ga0500614_001602 | 3300053123 | Bacteria | 5337 |
| 640 | Ga0500568_0059994 | 3300053139 | Bacteria | 1474 |
| 641 | Ga0500568_0086558 | 3300053139 | Bacteria | 1185 |
| 642 | Ga0500616_0006627 | 3300053153 | Bacteria | 7544 |
| 643 | Ga0500616_0041688 | 3300053153 | Bacteria | 2462 |
| 644 | Ga0501084_0050011 | 3300054114 | Bacteria | 3499 |
| 645 | Ga0501084_0201975 | 3300054114 | Bacteria | 1677 |
| 646 | Ga0501084_0215435 | 3300054114 | Bacteria | 1620 |
| 647 | Ga0501082_0141078 | 3300060353 | Bacteria | 2091 |
| 648 | Ga0501082_0578542 | 3300060353 | Bacteria | 982 |
| 649 | Ga0466962_0020444 | 3300061719 | Bacteria | 3181 |
| 650 | Ga0466962_0068897 | 3300061719 | Bacteria | 1689 |
| 651 | Ga0530510_0075269 | 3300061734 | Bacteria | 2452 |
| 652 | Ga0530510_0088632 | 3300061734 | Bacteria | 2255 |
| 653 | Ga0530510_0354185 | 3300061734 | Bacteria | 1103 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044712 | Ga0453684_0080379 | Ga0453684_0080379_2684_3343 | 218 |
| 2 | 3300047673 | Ga0495593_0238833 | Ga0495593_0238833_18_680 | 220 |
| 3 | 3300044901 | Ga0466960_0199484 | Ga0466960_0199484_12_692 | 226 |
| 4 | 3300041505 | Ga0451849_0498249 | Ga0451849_0498249_189_872 | 227 |
| 5 | 3300041512 | Ga0451853_3433959 | Ga0451853_3433959_13_696 | 227 |
| 6 | 3300048914 | Ga0496111_0436824 | Ga0496111_0436824_257_943 | 227 |
| 7 | 3300053085 | Ga0495619_0001663 | Ga0495619_0001663_12_695 | 227 |
| 8 | 3300045836 | Ga0466958_0323430 | Ga0466958_0323430_277_981 | 228 |
| 9 | 3300049570 | Ga0501033_0222241 | Ga0501033_0222241_15_719 | 228 |
| 10 | 3300037418 | Ga0395900_0463763 | Ga0395900_0463763_511_1209 | 229 |
| 11 | 3300047472 | Ga0495686_0244644 | Ga0495686_0244644_11_700 | 229 |
| 12 | 3300005937 | Ga0081455_10303292 | Ga0081455_103032922 | 239 |
| 13 | 3300006847 | Ga0075431_100303078 | Ga0075431_1003030782 | 239 |
| 14 | 3300025972 | Ga0207668_10296374 | Ga0207668_102963743 | 239 |
| 15 | 3300044901 | Ga0466960_0362066 | Ga0466960_0362066_26_763 | 239 |
| 16 | 3300048906 | Ga0496103_0489109 | Ga0496103_0489109_11_733 | 239 |
| 17 | 3300049574 | Ga0501038_0171028 | Ga0501038_0171028_287_1006 | 239 |
| 18 | 3300049577 | Ga0501041_0177052 | Ga0501041_0177052_588_1325 | 239 |
| 19 | 3300049586 | Ga0501070_0518801 | Ga0501070_0518801_23_742 | 239 |
| 20 | 3300005338 | Ga0068868_100008360 | Ga0068868_10000836013 | 240 |
| 21 | 3300005543 | Ga0070672_100000104 | Ga0070672_10000010416 | 240 |
| 22 | 3300005564 | Ga0070664_100271437 | Ga0070664_1002714372 | 240 |
| 23 | 3300025940 | Ga0207691_10000430 | Ga0207691_1000043016 | 240 |
| 24 | 3300025944 | Ga0207661_10083827 | Ga0207661_100838274 | 240 |
| 25 | 3300026023 | Ga0207677_10001476 | Ga0207677_100014763 | 240 |
| 26 | 3300028577 | Ga0265318_10090314 | Ga0265318_100903141 | 240 |
| 27 | 3300031251 | Ga0265327_10002567 | Ga0265327_1000256721 | 240 |
| 28 | 3300045976 | Ga0466967_0030567 | Ga0466967_0030567_2222_2998 | 240 |
| 29 | 3300048912 | Ga0496109_0359702 | Ga0496109_0359702_195_968 | 240 |
| 30 | 3300048913 | Ga0496110_0866528 | Ga0496110_0866528_52_774 | 240 |
| 31 | 3300048914 | Ga0496111_0049910 | Ga0496111_0049910_842_1615 | 240 |
| 32 | 3300049586 | Ga0501070_0603957 | Ga0501070_0603957_21_743 | 240 |
| 33 | 3300053139 | Ga0500568_0059994 | Ga0500568_0059994_366_1145 | 244 |
| 34 | 3300053153 | Ga0500616_0041688 | Ga0500616_0041688_1093_1872 | 244 |
| 35 | 3300026142 | Ga0207698_10694028 | Ga0207698_106940282 | 245 |
| 36 | 3300003203 | JGI25406J46586_10043175 | JGI25406J46586_100431752 | 250 |
| 37 | 3300005985 | Ga0081539_10002195 | Ga0081539_1000219534 | 250 |
| 38 | 3300013105 | Ga0157369_10685281 | Ga0157369_106852812 | 250 |
| 39 | 3300046660 | Ga0495625_0000109 | Ga0495625_0000109_77108_77869 | 250 |
| 40 | 3300047472 | Ga0495686_0227749 | Ga0495686_0227749_210_962 | 250 |
| 41 | 3300003203 | JGI25406J46586_10005551 | JGI25406J46586_100055517 | 251 |
| 42 | 3300005327 | Ga0070658_10129346 | Ga0070658_101293462 | 251 |
| 43 | 3300005329 | Ga0070683_100082704 | Ga0070683_1000827042 | 251 |
| 44 | 3300005338 | Ga0068868_100143213 | Ga0068868_1001432132 | 251 |
| 45 | 3300005338 | Ga0068868_100265670 | Ga0068868_1002656702 | 251 |
| 46 | 3300005341 | Ga0070691_10065164 | Ga0070691_100651642 | 251 |
| 47 | 3300005341 | Ga0070691_10162945 | Ga0070691_101629452 | 251 |
| 48 | 3300005347 | Ga0070668_100618852 | Ga0070668_1006188521 | 251 |
| 49 | 3300005438 | Ga0070701_10035945 | Ga0070701_100359454 | 251 |
| 50 | 3300005438 | Ga0070701_10234072 | Ga0070701_102340722 | 251 |
| 51 | 3300005439 | Ga0070711_100261378 | Ga0070711_1002613782 | 251 |
| 52 | 3300005441 | Ga0070700_100040018 | Ga0070700_1000400183 | 251 |
| 53 | 3300005456 | Ga0070678_100433769 | Ga0070678_1004337692 | 251 |
| 54 | 3300005457 | Ga0070662_100075278 | Ga0070662_1000752782 | 251 |
| 55 | 3300005457 | Ga0070662_100353189 | Ga0070662_1003531892 | 251 |
| 56 | 3300005466 | Ga0070685_10049807 | Ga0070685_100498072 | 251 |
| 57 | 3300005466 | Ga0070685_10397569 | Ga0070685_103975691 | 251 |
| 58 | 3300005530 | Ga0070679_100245596 | Ga0070679_1002455963 | 251 |
| 59 | 3300005535 | Ga0070684_100113330 | Ga0070684_1001133304 | 251 |
| 60 | 3300005535 | Ga0070684_100197095 | Ga0070684_1001970952 | 251 |
| 61 | 3300005535 | Ga0070684_100367329 | Ga0070684_1003673292 | 251 |
| 62 | 3300005544 | Ga0070686_100079879 | Ga0070686_1000798792 | 251 |
| 63 | 3300005544 | Ga0070686_100107663 | Ga0070686_1001076632 | 251 |
| 64 | 3300005547 | Ga0070693_100277605 | Ga0070693_1002776052 | 251 |
| 65 | 3300005548 | Ga0070665_100188803 | Ga0070665_1001888033 | 251 |
| 66 | 3300005564 | Ga0070664_100094140 | Ga0070664_1000941403 | 251 |
| 67 | 3300005578 | Ga0068854_100110371 | Ga0068854_1001103712 | 251 |
| 68 | 3300005615 | Ga0070702_100020483 | Ga0070702_1000204833 | 251 |
| 69 | 3300005616 | Ga0068852_100574244 | Ga0068852_1005742442 | 251 |
| 70 | 3300005617 | Ga0068859_100179316 | Ga0068859_1001793162 | 251 |
| 71 | 3300005617 | Ga0068859_100304584 | Ga0068859_1003045842 | 251 |
| 72 | 3300005618 | Ga0068864_100196647 | Ga0068864_1001966472 | 251 |
| 73 | 3300005718 | Ga0068866_10117488 | Ga0068866_101174882 | 251 |
| 74 | 3300005719 | Ga0068861_100095518 | Ga0068861_1000955183 | 251 |
| 75 | 3300005719 | Ga0068861_100175447 | Ga0068861_1001754471 | 251 |
| 76 | 3300005937 | Ga0081455_10020035 | Ga0081455_100200356 | 251 |
| 77 | 3300005937 | Ga0081455_10027552 | Ga0081455_100275525 | 251 |
| 78 | 3300005937 | Ga0081455_10054050 | Ga0081455_100540502 | 251 |
| 79 | 3300005981 | Ga0081538_10027694 | Ga0081538_100276943 | 251 |
| 80 | 3300005981 | Ga0081538_10073847 | Ga0081538_100738471 | 251 |
| 81 | 3300005983 | Ga0081540_1049619 | Ga0081540_10496193 | 251 |
| 82 | 3300005985 | Ga0081539_10001787 | Ga0081539_1000178736 | 251 |
| 83 | 3300005985 | Ga0081539_10069802 | Ga0081539_100698022 | 251 |
| 84 | 3300005985 | Ga0081539_10151069 | Ga0081539_101510692 | 251 |
| 85 | 3300006048 | Ga0075363_100270149 | Ga0075363_1002701492 | 251 |
| 86 | 3300006051 | Ga0075364_10121829 | Ga0075364_101218293 | 251 |
| 87 | 3300006175 | Ga0070712_100073343 | Ga0070712_1000733435 | 251 |
| 88 | 3300006237 | Ga0097621_100660377 | Ga0097621_1006603771 | 251 |
| 89 | 3300006844 | Ga0075428_100032589 | Ga0075428_1000325892 | 251 |
| 90 | 3300006844 | Ga0075428_100074767 | Ga0075428_1000747674 | 251 |
| 91 | 3300006846 | Ga0075430_100017410 | Ga0075430_1000174104 | 251 |
| 92 | 3300006847 | Ga0075431_100017217 | Ga0075431_1000172174 | 251 |
| 93 | 3300006881 | Ga0068865_100044260 | Ga0068865_1000442602 | 251 |
| 94 | 3300006931 | Ga0097620_100179314 | Ga0097620_1001793142 | 251 |
| 95 | 3300006931 | Ga0097620_100304584 | Ga0097620_1003045842 | 251 |
| 96 | 3300009094 | Ga0111539_10476644 | Ga0111539_104766441 | 251 |
| 97 | 3300009094 | Ga0111539_10815498 | Ga0111539_108154982 | 251 |
| 98 | 3300009098 | Ga0105245_10219643 | Ga0105245_102196431 | 251 |
| 99 | 3300009098 | Ga0105245_10946771 | Ga0105245_109467711 | 251 |
| 100 | 3300009148 | Ga0105243_10165271 | Ga0105243_101652712 | 251 |
| 101 | 3300009148 | Ga0105243_10185937 | Ga0105243_101859373 | 251 |
| 102 | 3300009148 | Ga0105243_10293287 | Ga0105243_102932872 | 251 |
| 103 | 3300009177 | Ga0105248_10150674 | Ga0105248_101506743 | 251 |
| 104 | 3300009177 | Ga0105248_10506754 | Ga0105248_105067542 | 251 |
| 105 | 3300009553 | Ga0105249_10962192 | Ga0105249_109621922 | 251 |
| 106 | 3300010375 | Ga0105239_10034512 | Ga0105239_100345123 | 251 |
| 107 | 3300011119 | Ga0105246_10139084 | Ga0105246_101390841 | 251 |
| 108 | 3300013306 | Ga0163162_10501097 | Ga0163162_105010972 | 251 |
| 109 | 3300013307 | Ga0157372_10444173 | Ga0157372_104441732 | 251 |
| 110 | 3300013307 | Ga0157372_10914320 | Ga0157372_109143202 | 251 |
| 111 | 3300013308 | Ga0157375_10013539 | Ga0157375_100135399 | 251 |
| 112 | 3300013308 | Ga0157375_10235762 | Ga0157375_102357623 | 251 |
| 113 | 3300013308 | Ga0157375_10483148 | Ga0157375_104831482 | 251 |
| 114 | 3300014326 | Ga0157380_10272336 | Ga0157380_102723362 | 251 |
| 115 | 3300014326 | Ga0157380_10290888 | Ga0157380_102908882 | 251 |
| 116 | 3300014969 | Ga0157376_10069866 | Ga0157376_100698662 | 251 |
| 117 | 3300014969 | Ga0157376_10130173 | Ga0157376_101301733 | 251 |
| 118 | 3300025901 | Ga0207688_10065624 | Ga0207688_100656242 | 251 |
| 119 | 3300025901 | Ga0207688_10265565 | Ga0207688_102655651 | 251 |
| 120 | 3300025909 | Ga0207705_10115914 | Ga0207705_101159142 | 251 |
| 121 | 3300025912 | Ga0207707_10282976 | Ga0207707_102829762 | 251 |
| 122 | 3300025915 | Ga0207693_10004260 | Ga0207693_100042602 | 251 |
| 123 | 3300025917 | Ga0207660_10209714 | Ga0207660_102097142 | 251 |
| 124 | 3300025919 | Ga0207657_10226927 | Ga0207657_102269272 | 251 |
| 125 | 3300025921 | Ga0207652_10160708 | Ga0207652_101607084 | 251 |
| 126 | 3300025926 | Ga0207659_10211133 | Ga0207659_102111331 | 251 |
| 127 | 3300025927 | Ga0207687_10186820 | Ga0207687_101868202 | 251 |
| 128 | 3300025932 | Ga0207690_10189662 | Ga0207690_101896622 | 251 |
| 129 | 3300025933 | Ga0207706_10099120 | Ga0207706_100991202 | 251 |
| 130 | 3300025935 | Ga0207709_10056127 | Ga0207709_100561272 | 251 |
| 131 | 3300025937 | Ga0207669_10178502 | Ga0207669_101785022 | 251 |
| 132 | 3300025938 | Ga0207704_10089325 | Ga0207704_100893251 | 251 |
| 133 | 3300025938 | Ga0207704_10106714 | Ga0207704_101067143 | 251 |
| 134 | 3300025938 | Ga0207704_10205407 | Ga0207704_102054072 | 251 |
| 135 | 3300025940 | Ga0207691_10170670 | Ga0207691_101706702 | 251 |
| 136 | 3300025940 | Ga0207691_10674546 | Ga0207691_106745461 | 251 |
| 137 | 3300025944 | Ga0207661_10035272 | Ga0207661_100352722 | 251 |
| 138 | 3300025944 | Ga0207661_10541758 | Ga0207661_105417581 | 251 |
| 139 | 3300025945 | Ga0207679_10321841 | Ga0207679_103218412 | 251 |
| 140 | 3300025945 | Ga0207679_10652407 | Ga0207679_106524072 | 251 |
| 141 | 3300025981 | Ga0207640_10364690 | Ga0207640_103646901 | 251 |
| 142 | 3300026023 | Ga0207677_10103388 | Ga0207677_101033883 | 251 |
| 143 | 3300026067 | Ga0207678_10028326 | Ga0207678_100283264 | 251 |
| 144 | 3300026067 | Ga0207678_10233411 | Ga0207678_102334111 | 251 |
| 145 | 3300026067 | Ga0207678_10397596 | Ga0207678_103975962 | 251 |
| 146 | 3300026067 | Ga0207678_10734607 | Ga0207678_107346071 | 251 |
| 147 | 3300026075 | Ga0207708_10022090 | Ga0207708_100220903 | 251 |
| 148 | 3300026116 | Ga0207674_10190001 | Ga0207674_101900011 | 251 |
| 149 | 3300026116 | Ga0207674_10313116 | Ga0207674_103131162 | 251 |
| 150 | 3300026116 | Ga0207674_10396319 | Ga0207674_103963192 | 251 |
| 151 | 3300026118 | Ga0207675_100121616 | Ga0207675_1001216162 | 251 |
| 152 | 3300026118 | Ga0207675_100625522 | Ga0207675_1006255221 | 251 |
| 153 | 3300028380 | Ga0268265_10348199 | Ga0268265_103481992 | 251 |
| 154 | 3300028381 | Ga0268264_10067600 | Ga0268264_100676002 | 251 |
| 155 | 3300031731 | Ga0307405_10152409 | Ga0307405_101524092 | 251 |
| 156 | 3300031824 | Ga0307413_10438786 | Ga0307413_104387861 | 251 |
| 157 | 3300031901 | Ga0307406_10437629 | Ga0307406_104376292 | 251 |
| 158 | 3300031903 | Ga0307407_10012271 | Ga0307407_100122716 | 251 |
| 159 | 3300031903 | Ga0307407_10192379 | Ga0307407_101923792 | 251 |
| 160 | 3300031903 | Ga0307407_10349805 | Ga0307407_103498051 | 251 |
| 161 | 3300031911 | Ga0307412_10469627 | Ga0307412_104696271 | 251 |
| 162 | 3300031995 | Ga0307409_100008475 | Ga0307409_1000084753 | 251 |
| 163 | 3300031995 | Ga0307409_100019697 | Ga0307409_1000196972 | 251 |
| 164 | 3300031995 | Ga0307409_100287696 | Ga0307409_1002876961 | 251 |
| 165 | 3300031995 | Ga0307409_100412180 | Ga0307409_1004121802 | 251 |
| 166 | 3300031995 | Ga0307409_100667724 | Ga0307409_1006677241 | 251 |
| 167 | 3300032002 | Ga0307416_100035326 | Ga0307416_1000353261 | 251 |
| 168 | 3300032002 | Ga0307416_100077786 | Ga0307416_1000777862 | 251 |
| 169 | 3300032002 | Ga0307416_100342458 | Ga0307416_1003424582 | 251 |
| 170 | 3300032002 | Ga0307416_100726444 | Ga0307416_1007264442 | 251 |
| 171 | 3300032004 | Ga0307414_10017391 | Ga0307414_100173911 | 251 |
| 172 | 3300032005 | Ga0307411_10098326 | Ga0307411_100983261 | 251 |
| 173 | 3300032126 | Ga0307415_100010091 | Ga0307415_1000100913 | 251 |
| 174 | 3300032126 | Ga0307415_100013172 | Ga0307415_1000131723 | 251 |
| 175 | 3300032126 | Ga0307415_100025248 | Ga0307415_1000252483 | 251 |
| 176 | 3300032126 | Ga0307415_100044685 | Ga0307415_1000446854 | 251 |
| 177 | 3300035207 | Ga0373942_0079747 | Ga0373942_0079747_177_950 | 251 |
| 178 | 3300037312 | Ga0395899_0134176 | Ga0395899_0134176_144_902 | 251 |
| 179 | 3300037418 | Ga0395900_0072801 | Ga0395900_0072801_2428_3183 | 251 |
| 180 | 3300037466 | Ga0395898_0009239 | Ga0395898_0009239_11_766 | 251 |
| 181 | 3300037466 | Ga0395898_0040875 | Ga0395898_0040875_1433_2191 | 251 |
| 182 | 3300037466 | Ga0395898_0321994 | Ga0395898_0321994_67_840 | 251 |
| 183 | 3300037466 | Ga0395898_0910505 | Ga0395898_0910505_11_766 | 251 |
| 184 | 3300038443 | Ga0395901_0024727 | Ga0395901_0024727_1607_2365 | 251 |
| 185 | 3300038443 | Ga0395901_0025795 | Ga0395901_0025795_3692_4459 | 251 |
| 186 | 3300038443 | Ga0395901_0082956 | Ga0395901_0082956_2385_3158 | 251 |
| 187 | 3300038443 | Ga0395901_0468617 | Ga0395901_0468617_320_1078 | 251 |
| 188 | 3300041509 | Ga0451843_0198215 | Ga0451843_0198215_64_819 | 251 |
| 189 | 3300041509 | Ga0451843_1563928 | Ga0451843_1563928_252_1028 | 251 |
| 190 | 3300041512 | Ga0451853_3641588 | Ga0451853_3641588_1429_2196 | 251 |
| 191 | 3300042011 | Ga0439454_010784 | Ga0439454_010784_106_879 | 251 |
| 192 | 3300042013 | Ga0439456_044060 | Ga0439456_044060_31_804 | 251 |
| 193 | 3300044683 | Ga0466965_0076411 | Ga0466965_0076411_770_1543 | 251 |
| 194 | 3300044683 | Ga0466965_0159844 | Ga0466965_0159844_66_839 | 251 |
| 195 | 3300044694 | Ga0466963_0055527 | Ga0466963_0055527_939_1712 | 251 |
| 196 | 3300044694 | Ga0466963_0126235 | Ga0466963_0126235_599_1372 | 251 |
| 197 | 3300044694 | Ga0466963_0130524 | Ga0466963_0130524_862_1635 | 251 |
| 198 | 3300044706 | Ga0466964_0150548 | Ga0466964_0150548_39_812 | 251 |
| 199 | 3300044842 | Ga0466957_0203871 | Ga0466957_0203871_492_1265 | 251 |
| 200 | 3300044901 | Ga0466960_0144359 | Ga0466960_0144359_470_1243 | 251 |
| 201 | 3300045836 | Ga0466958_0135071 | Ga0466958_0135071_37_810 | 251 |
| 202 | 3300045976 | Ga0466967_0002408 | Ga0466967_0002408_4543_5316 | 251 |
| 203 | 3300045976 | Ga0466967_0008949 | Ga0466967_0008949_1468_2232 | 251 |
| 204 | 3300045976 | Ga0466967_0029422 | Ga0466967_0029422_3754_4512 | 251 |
| 205 | 3300045976 | Ga0466967_0103409 | Ga0466967_0103409_1130_1906 | 251 |
| 206 | 3300045976 | Ga0466967_0109548 | Ga0466967_0109548_17_790 | 251 |
| 207 | 3300045976 | Ga0466967_0109663 | Ga0466967_0109663_334_1107 | 251 |
| 208 | 3300045976 | Ga0466967_0123584 | Ga0466967_0123584_27_800 | 251 |
| 209 | 3300045976 | Ga0466967_0136654 | Ga0466967_0136654_728_1501 | 251 |
| 210 | 3300045976 | Ga0466967_0183824 | Ga0466967_0183824_1032_1805 | 251 |
| 211 | 3300045976 | Ga0466967_0403017 | Ga0466967_0403017_439_1221 | 251 |
| 212 | 3300045976 | Ga0466967_0427548 | Ga0466967_0427548_212_967 | 251 |
| 213 | 3300045976 | Ga0466967_0653762 | Ga0466967_0653762_126_899 | 251 |
| 214 | 3300046455 | Ga0495603_0158301 | Ga0495603_0158301_334_1089 | 251 |
| 215 | 3300046461 | Ga0495641_0019407 | Ga0495641_0019407_777_1532 | 251 |
| 216 | 3300046461 | Ga0495641_0127454 | Ga0495641_0127454_331_1086 | 251 |
| 217 | 3300046473 | Ga0495582_0000006 | Ga0495582_0000006_43191_43949 | 251 |
| 218 | 3300046536 | Ga0495587_0071897 | Ga0495587_0071897_1040_1798 | 251 |
| 219 | 3300046615 | Ga0495656_0071008 | Ga0495656_0071008_412_1185 | 251 |
| 220 | 3300046683 | Ga0495658_0000094 | Ga0495658_0000094_2789_3547 | 251 |
| 221 | 3300047315 | Ga0495581_0258316 | Ga0495581_0258316_198_953 | 251 |
| 222 | 3300047321 | Ga0495676_0048203 | Ga0495676_0048203_1995_2750 | 251 |
| 223 | 3300048904 | Ga0496101_0011807 | Ga0496101_0011807_3669_4424 | 251 |
| 224 | 3300048904 | Ga0496101_0111249 | Ga0496101_0111249_171_929 | 251 |
| 225 | 3300048904 | Ga0496101_0274789 | Ga0496101_0274789_406_1161 | 251 |
| 226 | 3300048905 | Ga0496102_0187168 | Ga0496102_0187168_1055_1810 | 251 |
| 227 | 3300048905 | Ga0496102_0341715 | Ga0496102_0341715_564_1337 | 251 |
| 228 | 3300048906 | Ga0496103_0015888 | Ga0496103_0015888_3442_4197 | 251 |
| 229 | 3300048907 | Ga0496104_0110347 | Ga0496104_0110347_1495_2253 | 251 |
| 230 | 3300048909 | Ga0496106_0001451 | Ga0496106_0001451_221_976 | 251 |
| 231 | 3300048909 | Ga0496106_0106511 | Ga0496106_0106511_650_1423 | 251 |
| 232 | 3300048909 | Ga0496106_0424051 | Ga0496106_0424051_121_876 | 251 |
| 233 | 3300048910 | Ga0496107_0007562 | Ga0496107_0007562_5115_5870 | 251 |
| 234 | 3300048910 | Ga0496107_0048186 | Ga0496107_0048186_996_1754 | 251 |
| 235 | 3300048910 | Ga0496107_0180549 | Ga0496107_0180549_22_777 | 251 |
| 236 | 3300048911 | Ga0496108_0057211 | Ga0496108_0057211_1322_2077 | 251 |
| 237 | 3300048911 | Ga0496108_0343565 | Ga0496108_0343565_454_1212 | 251 |
| 238 | 3300048912 | Ga0496109_0366013 | Ga0496109_0366013_243_1019 | 251 |
| 239 | 3300048913 | Ga0496110_0577391 | Ga0496110_0577391_68_844 | 251 |
| 240 | 3300048914 | Ga0496111_0052355 | Ga0496111_0052355_733_1491 | 251 |
| 241 | 3300048914 | Ga0496111_0102252 | Ga0496111_0102252_1027_1782 | 251 |
| 242 | 3300048914 | Ga0496111_0123300 | Ga0496111_0123300_129_905 | 251 |
| 243 | 3300048915 | Ga0496112_0034566 | Ga0496112_0034566_3675_4430 | 251 |
| 244 | 3300048915 | Ga0496112_0174886 | Ga0496112_0174886_526_1305 | 251 |
| 245 | 3300048916 | Ga0496113_0202829 | Ga0496113_0202829_394_1149 | 251 |
| 246 | 3300048917 | Ga0496114_0171783 | Ga0496114_0171783_694_1449 | 251 |
| 247 | 3300048917 | Ga0496114_0533770 | Ga0496114_0533770_86_847 | 251 |
| 248 | 3300049568 | Ga0501031_0026581 | Ga0501031_0026581_690_1463 | 251 |
| 249 | 3300049568 | Ga0501031_0026834 | Ga0501031_0026834_1198_1974 | 251 |
| 250 | 3300049569 | Ga0501032_0001419 | Ga0501032_0001419_13456_14229 | 251 |
| 251 | 3300049570 | Ga0501033_0022982 | Ga0501033_0022982_1448_2221 | 251 |
| 252 | 3300049571 | Ga0501034_0382839 | Ga0501034_0382839_503_1276 | 251 |
| 253 | 3300049571 | Ga0501034_0708529 | Ga0501034_0708529_39_818 | 251 |
| 254 | 3300049572 | Ga0501036_0056081 | Ga0501036_0056081_74_847 | 251 |
| 255 | 3300049572 | Ga0501036_0368307 | Ga0501036_0368307_352_1125 | 251 |
| 256 | 3300049573 | Ga0501037_0105955 | Ga0501037_0105955_150_923 | 251 |
| 257 | 3300049574 | Ga0501038_0007184 | Ga0501038_0007184_1025_1798 | 251 |
| 258 | 3300049575 | Ga0501039_0022063 | Ga0501039_0022063_1840_2613 | 251 |
| 259 | 3300049575 | Ga0501039_0111261 | Ga0501039_0111261_409_1185 | 251 |
| 260 | 3300049575 | Ga0501039_0311554 | Ga0501039_0311554_412_1185 | 251 |
| 261 | 3300049576 | Ga0501040_0049974 | Ga0501040_0049974_1197_1970 | 251 |
| 262 | 3300049576 | Ga0501040_0221476 | Ga0501040_0221476_249_1022 | 251 |
| 263 | 3300049578 | Ga0501042_0001923 | Ga0501042_0001923_3084_3857 | 251 |
| 264 | 3300049578 | Ga0501042_0095787 | Ga0501042_0095787_1290_2063 | 251 |
| 265 | 3300049578 | Ga0501042_0117250 | Ga0501042_0117250_479_1234 | 251 |
| 266 | 3300049579 | Ga0501043_0110501 | Ga0501043_0110501_503_1276 | 251 |
| 267 | 3300049580 | Ga0501046_0008154 | Ga0501046_0008154_7812_8585 | 251 |
| 268 | 3300049580 | Ga0501046_0226711 | Ga0501046_0226711_25_798 | 251 |
| 269 | 3300049582 | Ga0501048_0002360 | Ga0501048_0002360_5057_5830 | 251 |
| 270 | 3300049582 | Ga0501048_0096926 | Ga0501048_0096926_1292_2065 | 251 |
| 271 | 3300049584 | Ga0501068_0146113 | Ga0501068_0146113_546_1319 | 251 |
| 272 | 3300049585 | Ga0501069_0022074 | Ga0501069_0022074_1749_2522 | 251 |
| 273 | 3300049585 | Ga0501069_0323128 | Ga0501069_0323128_37_810 | 251 |
| 274 | 3300049586 | Ga0501070_0112009 | Ga0501070_0112009_86_859 | 251 |
| 275 | 3300049586 | Ga0501070_0330536 | Ga0501070_0330536_40_819 | 251 |
| 276 | 3300049586 | Ga0501070_0429254 | Ga0501070_0429254_58_831 | 251 |
| 277 | 3300049587 | Ga0501071_0161256 | Ga0501071_0161256_763_1536 | 251 |
| 278 | 3300049587 | Ga0501071_0308413 | Ga0501071_0308413_372_1139 | 251 |
| 279 | 3300049588 | Ga0501072_0279384 | Ga0501072_0279384_354_1127 | 251 |
| 280 | 3300049588 | Ga0501072_0290036 | Ga0501072_0290036_20_796 | 251 |
| 281 | 3300049589 | Ga0501073_0005329 | Ga0501073_0005329_8076_8849 | 251 |
| 282 | 3300049590 | Ga0501074_0030502 | Ga0501074_0030502_1668_2444 | 251 |
| 283 | 3300049590 | Ga0501074_0105602 | Ga0501074_0105602_516_1289 | 251 |
| 284 | 3300049591 | Ga0501075_0041409 | Ga0501075_0041409_1520_2293 | 251 |
| 285 | 3300049591 | Ga0501075_0044341 | Ga0501075_0044341_1966_2721 | 251 |
| 286 | 3300049592 | Ga0501076_0077091 | Ga0501076_0077091_860_1633 | 251 |
| 287 | 3300049592 | Ga0501076_0096251 | Ga0501076_0096251_1339_2112 | 251 |
| 288 | 3300049592 | Ga0501076_0163483 | Ga0501076_0163483_1006_1761 | 251 |
| 289 | 3300049592 | Ga0501076_0192907 | Ga0501076_0192907_77_844 | 251 |
| 290 | 3300049593 | Ga0501077_0319061 | Ga0501077_0319061_205_978 | 251 |
| 291 | 3300049593 | Ga0501077_0337524 | Ga0501077_0337524_51_824 | 251 |
| 292 | 3300049741 | Ga0501079_0122656 | Ga0501079_0122656_784_1560 | 251 |
| 293 | 3300049741 | Ga0501079_0161416 | Ga0501079_0161416_936_1691 | 251 |
| 294 | 3300049741 | Ga0501079_0176103 | Ga0501079_0176103_519_1292 | 251 |
| 295 | 3300049742 | Ga0501080_0116077 | Ga0501080_0116077_748_1521 | 251 |
| 296 | 3300049742 | Ga0501080_0388009 | Ga0501080_0388009_460_1236 | 251 |
| 297 | 3300049744 | Ga0501083_0188392 | Ga0501083_0188392_183_956 | 251 |
| 298 | 3300049822 | Ga0501035_0685903 | Ga0501035_0685903_19_792 | 251 |
| 299 | 3300049823 | Ga0501044_0217646 | Ga0501044_0217646_526_1299 | 251 |
| 300 | 3300049823 | Ga0501044_0376820 | Ga0501044_0376820_123_896 | 251 |
| 301 | 3300049824 | Ga0501045_0094375 | Ga0501045_0094375_1336_2091 | 251 |
| 302 | 3300049824 | Ga0501045_0095262 | Ga0501045_0095262_1380_2153 | 251 |
| 303 | 3300049824 | Ga0501045_0109271 | Ga0501045_0109271_775_1551 | 251 |
| 304 | 3300049824 | Ga0501045_0514831 | Ga0501045_0514831_100_873 | 251 |
| 305 | 3300050508 | nmdc:mga09592_61724_c1 | nmdc:mga09592_61724_c1_1527_2294 | 251 |
| 306 | 3300050509 | nmdc:mga0qj67_52476_c1 | nmdc:mga0qj67_52476_c1_15_782 | 251 |
| 307 | 3300050510 | nmdc:mga06r32_45944_c1 | nmdc:mga06r32_45944_c1_900_1667 | 251 |
| 308 | 3300050511 | nmdc:mga08y16_32980_c1 | nmdc:mga08y16_32980_c1_1891_2667 | 251 |
| 309 | 3300050513 | nmdc:mga0rr50_564992_c1 | nmdc:mga0rr50_564992_c1_28_783 | 251 |
| 310 | 3300054114 | Ga0501084_0050011 | Ga0501084_0050011_2167_2940 | 251 |
| 311 | 3300054114 | Ga0501084_0201975 | Ga0501084_0201975_840_1613 | 251 |
| 312 | 3300060353 | Ga0501082_0141078 | Ga0501082_0141078_386_1159 | 251 |
| 313 | 3300060353 | Ga0501082_0578542 | Ga0501082_0578542_107_880 | 251 |
| 314 | 3300061719 | Ga0466962_0068897 | Ga0466962_0068897_860_1633 | 251 |
| 315 | 3300061734 | Ga0530510_0075269 | Ga0530510_0075269_708_1463 | 251 |
| 316 | 3300061734 | Ga0530510_0088632 | Ga0530510_0088632_1353_2126 | 251 |
| 317 | 3300061734 | Ga0530510_0354185 | Ga0530510_0354185_135_902 | 251 |
| 318 | 3300001977 | JGI24746J21847_1000007 | JGI24746J21847_100000727 | 252 |
| 319 | 3300002074 | JGI24748J21848_1000247 | JGI24748J21848_10002472 | 252 |
| 320 | 3300002239 | JGI24034J26672_10000068 | JGI24034J26672_100000685 | 252 |
| 321 | 3300005329 | Ga0070683_100003330 | Ga0070683_1000033302 | 252 |
| 322 | 3300005329 | Ga0070683_100011264 | Ga0070683_1000112642 | 252 |
| 323 | 3300005329 | Ga0070683_100103396 | Ga0070683_1001033963 | 252 |
| 324 | 3300005331 | Ga0070670_100042140 | Ga0070670_1000421401 | 252 |
| 325 | 3300005333 | Ga0070677_10001062 | Ga0070677_1000106213 | 252 |
| 326 | 3300005337 | Ga0070682_100000009 | Ga0070682_100000009276 | 252 |
| 327 | 3300005337 | Ga0070682_100000032 | Ga0070682_100000032152 | 252 |
| 328 | 3300005338 | Ga0068868_100000306 | Ga0068868_10000030633 | 252 |
| 329 | 3300005341 | Ga0070691_10113937 | Ga0070691_101139372 | 252 |
| 330 | 3300005344 | Ga0070661_100000236 | Ga0070661_10000023618 | 252 |
| 331 | 3300005354 | Ga0070675_100003153 | Ga0070675_10000315311 | 252 |
| 332 | 3300005356 | Ga0070674_100000047 | Ga0070674_10000004733 | 252 |
| 333 | 3300005364 | Ga0070673_100003060 | Ga0070673_1000030601 | 252 |
| 334 | 3300005365 | Ga0070688_100000562 | Ga0070688_1000005626 | 252 |
| 335 | 3300005435 | Ga0070714_100018243 | Ga0070714_1000182433 | 252 |
| 336 | 3300005435 | Ga0070714_100036840 | Ga0070714_1000368404 | 252 |
| 337 | 3300005436 | Ga0070713_100000171 | Ga0070713_10000017135 | 252 |
| 338 | 3300005436 | Ga0070713_100102600 | Ga0070713_1001026002 | 252 |
| 339 | 3300005455 | Ga0070663_100177069 | Ga0070663_1001770691 | 252 |
| 340 | 3300005456 | Ga0070678_100023357 | Ga0070678_1000233572 | 252 |
| 341 | 3300005457 | Ga0070662_100000007 | Ga0070662_10000000748 | 252 |
| 342 | 3300005459 | Ga0068867_100006857 | Ga0068867_1000068572 | 252 |
| 343 | 3300005466 | Ga0070685_10001063 | Ga0070685_100010636 | 252 |
| 344 | 3300005466 | Ga0070685_10131056 | Ga0070685_101310562 | 252 |
| 345 | 3300005535 | Ga0070684_100067227 | Ga0070684_1000672273 | 252 |
| 346 | 3300005547 | Ga0070693_100003220 | Ga0070693_1000032208 | 252 |
| 347 | 3300005548 | Ga0070665_100000022 | Ga0070665_100000022384 | 252 |
| 348 | 3300005548 | Ga0070665_100051471 | Ga0070665_1000514713 | 252 |
| 349 | 3300005548 | Ga0070665_100065177 | Ga0070665_1000651772 | 252 |
| 350 | 3300005548 | Ga0070665_100093761 | Ga0070665_1000937614 | 252 |
| 351 | 3300005577 | Ga0068857_100120727 | Ga0068857_1001207272 | 252 |
| 352 | 3300005578 | Ga0068854_100000939 | Ga0068854_10000093914 | 252 |
| 353 | 3300005578 | Ga0068854_100048974 | Ga0068854_1000489741 | 252 |
| 354 | 3300005614 | Ga0068856_100007857 | Ga0068856_1000078577 | 252 |
| 355 | 3300005616 | Ga0068852_100000024 | Ga0068852_1000000246 | 252 |
| 356 | 3300005616 | Ga0068852_100058793 | Ga0068852_1000587932 | 252 |
| 357 | 3300005618 | Ga0068864_100000023 | Ga0068864_100000023235 | 252 |
| 358 | 3300005718 | Ga0068866_10000274 | Ga0068866_100002747 | 252 |
| 359 | 3300005834 | Ga0068851_10018801 | Ga0068851_100188013 | 252 |
| 360 | 3300005842 | Ga0068858_100000150 | Ga0068858_10000015033 | 252 |
| 361 | 3300005842 | Ga0068858_100000287 | Ga0068858_10000028733 | 252 |
| 362 | 3300005843 | Ga0068860_100033741 | Ga0068860_1000337412 | 252 |
| 363 | 3300005937 | Ga0081455_10165181 | Ga0081455_101651812 | 252 |
| 364 | 3300006163 | Ga0070715_10000003 | Ga0070715_10000003261 | 252 |
| 365 | 3300006175 | Ga0070712_100271821 | Ga0070712_1002718212 | 252 |
| 366 | 3300006178 | Ga0075367_10156081 | Ga0075367_101560812 | 252 |
| 367 | 3300006852 | Ga0075433_10004429 | Ga0075433_1000442915 | 252 |
| 368 | 3300006852 | Ga0075433_10036483 | Ga0075433_100364833 | 252 |
| 369 | 3300006881 | Ga0068865_100000024 | Ga0068865_10000002494 | 252 |
| 370 | 3300009098 | Ga0105245_10000022 | Ga0105245_10000022167 | 252 |
| 371 | 3300009098 | Ga0105245_10000528 | Ga0105245_1000052824 | 252 |
| 372 | 3300009098 | Ga0105245_10019614 | Ga0105245_100196146 | 252 |
| 373 | 3300009101 | Ga0105247_10000064 | Ga0105247_10000064109 | 252 |
| 374 | 3300009147 | Ga0114129_10593115 | Ga0114129_105931152 | 252 |
| 375 | 3300009148 | Ga0105243_10006175 | Ga0105243_100061758 | 252 |
| 376 | 3300009176 | Ga0105242_10000123 | Ga0105242_1000012325 | 252 |
| 377 | 3300009176 | Ga0105242_10083889 | Ga0105242_100838893 | 252 |
| 378 | 3300009177 | Ga0105248_10001735 | Ga0105248_100017354 | 252 |
| 379 | 3300009177 | Ga0105248_10328110 | Ga0105248_103281102 | 252 |
| 380 | 3300009551 | Ga0105238_10814416 | Ga0105238_108144161 | 252 |
| 381 | 3300009553 | Ga0105249_10000181 | Ga0105249_1000018173 | 252 |
| 382 | 3300009553 | Ga0105249_10231867 | Ga0105249_102318672 | 252 |
| 383 | 3300009993 | Ga0105028_106004 | Ga0105028_1060041 | 252 |
| 384 | 3300013100 | Ga0157373_10406142 | Ga0157373_104061421 | 252 |
| 385 | 3300013102 | Ga0157371_10000818 | Ga0157371_1000081831 | 252 |
| 386 | 3300013104 | Ga0157370_10457680 | Ga0157370_104576802 | 252 |
| 387 | 3300013105 | Ga0157369_10000068 | Ga0157369_10000068132 | 252 |
| 388 | 3300013297 | Ga0157378_10104189 | Ga0157378_101041892 | 252 |
| 389 | 3300013307 | Ga0157372_10000809 | Ga0157372_1000080925 | 252 |
| 390 | 3300013308 | Ga0157375_10000126 | Ga0157375_1000012626 | 252 |
| 391 | 3300013308 | Ga0157375_10016258 | Ga0157375_100162586 | 252 |
| 392 | 3300014326 | Ga0157380_10000326 | Ga0157380_100003266 | 252 |
| 393 | 3300014326 | Ga0157380_10006736 | Ga0157380_100067362 | 252 |
| 394 | 3300014969 | Ga0157376_10060903 | Ga0157376_100609034 | 252 |
| 395 | 3300020082 | Ga0206353_11043234 | Ga0206353_110432341 | 252 |
| 396 | 3300022467 | Ga0224712_10004702 | Ga0224712_100047023 | 252 |
| 397 | 3300025321 | Ga0207656_10000374 | Ga0207656_1000037415 | 252 |
| 398 | 3300025893 | Ga0207682_10000008 | Ga0207682_100000084 | 252 |
| 399 | 3300025899 | Ga0207642_10000290 | Ga0207642_1000029023 | 252 |
| 400 | 3300025900 | Ga0207710_10000220 | Ga0207710_1000022051 | 252 |
| 401 | 3300025905 | Ga0207685_10000003 | Ga0207685_10000003258 | 252 |
| 402 | 3300025915 | Ga0207693_10020224 | Ga0207693_100202244 | 252 |
| 403 | 3300025920 | Ga0207649_10000166 | Ga0207649_1000016611 | 252 |
| 404 | 3300025924 | Ga0207694_10000008 | Ga0207694_1000000847 | 252 |
| 405 | 3300025926 | Ga0207659_10000138 | Ga0207659_1000013832 | 252 |
| 406 | 3300025927 | Ga0207687_10000025 | Ga0207687_1000002532 | 252 |
| 407 | 3300025927 | Ga0207687_10000039 | Ga0207687_1000003967 | 252 |
| 408 | 3300025927 | Ga0207687_10000132 | Ga0207687_1000013231 | 252 |
| 409 | 3300025927 | Ga0207687_10002690 | Ga0207687_1000269019 | 252 |
| 410 | 3300025928 | Ga0207700_10000019 | Ga0207700_10000019174 | 252 |
| 411 | 3300025929 | Ga0207664_10013567 | Ga0207664_100135677 | 252 |
| 412 | 3300025929 | Ga0207664_10272253 | Ga0207664_102722532 | 252 |
| 413 | 3300025929 | Ga0207664_10590885 | Ga0207664_105908851 | 252 |
| 414 | 3300025932 | Ga0207690_10003914 | Ga0207690_100039148 | 252 |
| 415 | 3300025933 | Ga0207706_10000018 | Ga0207706_10000018137 | 252 |
| 416 | 3300025934 | Ga0207686_10000066 | Ga0207686_1000006681 | 252 |
| 417 | 3300025935 | Ga0207709_10002223 | Ga0207709_100022238 | 252 |
| 418 | 3300025937 | Ga0207669_10000002 | Ga0207669_10000002377 | 252 |
| 419 | 3300025938 | Ga0207704_10000308 | Ga0207704_1000030813 | 252 |
| 420 | 3300025941 | Ga0207711_10000011 | Ga0207711_1000001145 | 252 |
| 421 | 3300025941 | Ga0207711_10139056 | Ga0207711_101390562 | 252 |
| 422 | 3300025944 | Ga0207661_10000518 | Ga0207661_1000051817 | 252 |
| 423 | 3300025944 | Ga0207661_10000616 | Ga0207661_1000061616 | 252 |
| 424 | 3300025944 | Ga0207661_10001510 | Ga0207661_1000151017 | 252 |
| 425 | 3300025944 | Ga0207661_10009756 | Ga0207661_100097563 | 252 |
| 426 | 3300025944 | Ga0207661_10307093 | Ga0207661_103070932 | 252 |
| 427 | 3300025945 | Ga0207679_10006381 | Ga0207679_100063812 | 252 |
| 428 | 3300025960 | Ga0207651_10000746 | Ga0207651_1000074623 | 252 |
| 429 | 3300025961 | Ga0207712_10000067 | Ga0207712_1000006773 | 252 |
| 430 | 3300025981 | Ga0207640_10000821 | Ga0207640_1000082113 | 252 |
| 431 | 3300025981 | Ga0207640_10002941 | Ga0207640_100029418 | 252 |
| 432 | 3300026023 | Ga0207677_10000046 | Ga0207677_1000004681 | 252 |
| 433 | 3300026035 | Ga0207703_10000122 | Ga0207703_1000012278 | 252 |
| 434 | 3300026041 | Ga0207639_10017220 | Ga0207639_100172201 | 252 |
| 435 | 3300026041 | Ga0207639_10124457 | Ga0207639_101244573 | 252 |
| 436 | 3300026067 | Ga0207678_10134526 | Ga0207678_101345263 | 252 |
| 437 | 3300026078 | Ga0207702_10002042 | Ga0207702_1000204211 | 252 |
| 438 | 3300026078 | Ga0207702_10017871 | Ga0207702_100178711 | 252 |
| 439 | 3300026078 | Ga0207702_10164250 | Ga0207702_101642502 | 252 |
| 440 | 3300026088 | Ga0207641_10000065 | Ga0207641_10000065106 | 252 |
| 441 | 3300026089 | Ga0207648_10004057 | Ga0207648_1000405711 | 252 |
| 442 | 3300026095 | Ga0207676_10000025 | Ga0207676_1000002546 | 252 |
| 443 | 3300026118 | Ga0207675_100082600 | Ga0207675_1000826003 | 252 |
| 444 | 3300026118 | Ga0207675_100961112 | Ga0207675_1009611121 | 252 |
| 445 | 3300026121 | Ga0207683_10038808 | Ga0207683_100388083 | 252 |
| 446 | 3300026142 | Ga0207698_10000014 | Ga0207698_1000001463 | 252 |
| 447 | 3300026142 | Ga0207698_10032167 | Ga0207698_100321672 | 252 |
| 448 | 3300028379 | Ga0268266_10000029 | Ga0268266_1000002971 | 252 |
| 449 | 3300028379 | Ga0268266_10018264 | Ga0268266_100182645 | 252 |
| 450 | 3300028379 | Ga0268266_10055970 | Ga0268266_100559704 | 252 |
| 451 | 3300028379 | Ga0268266_10080327 | Ga0268266_100803273 | 252 |
| 452 | 3300028381 | Ga0268264_10039342 | Ga0268264_100393422 | 252 |
| 453 | 3300028563 | Ga0265319_1000030 | Ga0265319_100003056 | 252 |
| 454 | 3300028800 | Ga0265338_10000156 | Ga0265338_1000015656 | 252 |
| 455 | 3300031241 | Ga0265325_10010101 | Ga0265325_100101017 | 252 |
| 456 | 3300031250 | Ga0265331_10105172 | Ga0265331_101051722 | 252 |
| 457 | 3300031995 | Ga0307409_100767858 | Ga0307409_1007678581 | 252 |
| 458 | 3300032126 | Ga0307415_100002491 | Ga0307415_1000024912 | 252 |
| 459 | 3300036401 | Ga0373937_0038132 | Ga0373937_0038132_2718_3476 | 252 |
| 460 | 3300037466 | Ga0395898_0283873 | Ga0395898_0283873_235_1002 | 252 |
| 461 | 3300037466 | Ga0395898_0312125 | Ga0395898_0312125_716_1486 | 252 |
| 462 | 3300038443 | Ga0395901_0190287 | Ga0395901_0190287_384_1154 | 252 |
| 463 | 3300038443 | Ga0395901_0241075 | Ga0395901_0241075_1046_1813 | 252 |
| 464 | 3300038443 | Ga0395901_0483435 | Ga0395901_0483435_119_886 | 252 |
| 465 | 3300041501 | Ga0451845_0823628 | Ga0451845_0823628_114_872 | 252 |
| 466 | 3300041512 | Ga0451853_2591154 | Ga0451853_2591154_2263_3021 | 252 |
| 467 | 3300044684 | Ga0466966_0058483 | Ga0466966_0058483_752_1531 | 252 |
| 468 | 3300044693 | Ga0466961_0148442 | Ga0466961_0148442_384_1193 | 252 |
| 469 | 3300044694 | Ga0466963_0012957 | Ga0466963_0012957_3863_4621 | 252 |
| 470 | 3300044694 | Ga0466963_0023486 | Ga0466963_0023486_445_1254 | 252 |
| 471 | 3300044694 | Ga0466963_0193776 | Ga0466963_0193776_501_1280 | 252 |
| 472 | 3300044694 | Ga0466963_0202256 | Ga0466963_0202256_579_1337 | 252 |
| 473 | 3300044719 | Ga0466971_0033430 | Ga0466971_0033430_220_999 | 252 |
| 474 | 3300044842 | Ga0466957_0004792 | Ga0466957_0004792_649_1407 | 252 |
| 475 | 3300044842 | Ga0466957_0043709 | Ga0466957_0043709_1620_2378 | 252 |
| 476 | 3300044842 | Ga0466957_0150974 | Ga0466957_0150974_703_1464 | 252 |
| 477 | 3300044842 | Ga0466957_0328556 | Ga0466957_0328556_240_1016 | 252 |
| 478 | 3300044901 | Ga0466960_0000460 | Ga0466960_0000460_10308_11075 | 252 |
| 479 | 3300044901 | Ga0466960_0027690 | Ga0466960_0027690_1292_2059 | 252 |
| 480 | 3300045049 | Ga0466959_0009134 | Ga0466959_0009134_3984_4793 | 252 |
| 481 | 3300045049 | Ga0466959_0217491 | Ga0466959_0217491_73_852 | 252 |
| 482 | 3300045836 | Ga0466958_0076506 | Ga0466958_0076506_28_804 | 252 |
| 483 | 3300045976 | Ga0466967_0000003 | Ga0466967_0000003_34482_35240 | 252 |
| 484 | 3300045976 | Ga0466967_0034352 | Ga0466967_0034352_279_1037 | 252 |
| 485 | 3300045976 | Ga0466967_0339224 | Ga0466967_0339224_213_986 | 252 |
| 486 | 3300045976 | Ga0466967_0732095 | Ga0466967_0732095_149_925 | 252 |
| 487 | 3300046454 | Ga0495592_0001496 | Ga0495592_0001496_2813_3571 | 252 |
| 488 | 3300046454 | Ga0495592_0079775 | Ga0495592_0079775_388_1146 | 252 |
| 489 | 3300046454 | Ga0495592_0087018 | Ga0495592_0087018_257_1015 | 252 |
| 490 | 3300046454 | Ga0495592_0281832 | Ga0495592_0281832_26_784 | 252 |
| 491 | 3300046455 | Ga0495603_0000323 | Ga0495603_0000323_4355_5113 | 252 |
| 492 | 3300046455 | Ga0495603_0000484 | Ga0495603_0000484_19684_20442 | 252 |
| 493 | 3300046459 | Ga0495629_0000543 | Ga0495629_0000543_17775_18533 | 252 |
| 494 | 3300046459 | Ga0495629_0006510 | Ga0495629_0006510_328_1086 | 252 |
| 495 | 3300046461 | Ga0495641_0000400 | Ga0495641_0000400_251_1009 | 252 |
| 496 | 3300046461 | Ga0495641_0023186 | Ga0495641_0023186_1319_2077 | 252 |
| 497 | 3300046461 | Ga0495641_0057959 | Ga0495641_0057959_876_1634 | 252 |
| 498 | 3300046462 | Ga0495651_0050048 | Ga0495651_0050048_1102_1863 | 252 |
| 499 | 3300046462 | Ga0495651_0120977 | Ga0495651_0120977_895_1653 | 252 |
| 500 | 3300046463 | Ga0495653_0030114 | Ga0495653_0030114_1870_2628 | 252 |
| 501 | 3300046463 | Ga0495653_0120417 | Ga0495653_0120417_694_1452 | 252 |
| 502 | 3300046471 | Ga0495650_0000121 | Ga0495650_0000121_96726_97493 | 252 |
| 503 | 3300046476 | Ga0495662_0000236 | Ga0495662_0000236_2803_3561 | 252 |
| 504 | 3300046476 | Ga0495662_0004441 | Ga0495662_0004441_3443_4201 | 252 |
| 505 | 3300046477 | Ga0495664_0142988 | Ga0495664_0142988_296_1057 | 252 |
| 506 | 3300046477 | Ga0495664_0299108 | Ga0495664_0299108_198_956 | 252 |
| 507 | 3300046499 | Ga0495594_0000001 | Ga0495594_0000001_37622_38380 | 252 |
| 508 | 3300046507 | Ga0495606_0000283 | Ga0495606_0000283_54028_54786 | 252 |
| 509 | 3300046511 | Ga0495608_0000010 | Ga0495608_0000010_247450_248208 | 252 |
| 510 | 3300046511 | Ga0495608_0001727 | Ga0495608_0001727_2752_3510 | 252 |
| 511 | 3300046511 | Ga0495608_0043662 | Ga0495608_0043662_427_1185 | 252 |
| 512 | 3300046515 | Ga0495620_0000668 | Ga0495620_0000668_50_811 | 252 |
| 513 | 3300046515 | Ga0495620_0103173 | Ga0495620_0103173_331_1089 | 252 |
| 514 | 3300046516 | Ga0495628_0000864 | Ga0495628_0000864_23539_24297 | 252 |
| 515 | 3300046516 | Ga0495628_0076311 | Ga0495628_0076311_1799_2557 | 252 |
| 516 | 3300046517 | Ga0495630_0000148 | Ga0495630_0000148_40519_41277 | 252 |
| 517 | 3300046523 | Ga0495644_0003645 | Ga0495644_0003645_351_1109 | 252 |
| 518 | 3300046529 | Ga0495652_0198398 | Ga0495652_0198398_628_1386 | 252 |
| 519 | 3300046533 | Ga0495640_0009674 | Ga0495640_0009674_6663_7421 | 252 |
| 520 | 3300046533 | Ga0495640_0046086 | Ga0495640_0046086_2117_2875 | 252 |
| 521 | 3300046537 | Ga0495598_0049838 | Ga0495598_0049838_423_1181 | 252 |
| 522 | 3300046543 | Ga0495645_0004698 | Ga0495645_0004698_2928_3695 | 252 |
| 523 | 3300046557 | Ga0495622_0000069 | Ga0495622_0000069_42101_42859 | 252 |
| 524 | 3300046558 | Ga0495633_0080939 | Ga0495633_0080939_153_911 | 252 |
| 525 | 3300046559 | Ga0495667_0000067 | Ga0495667_0000067_41376_42134 | 252 |
| 526 | 3300046559 | Ga0495667_0010689 | Ga0495667_0010689_1932_2690 | 252 |
| 527 | 3300046559 | Ga0495667_0130209 | Ga0495667_0130209_347_1105 | 252 |
| 528 | 3300046615 | Ga0495656_0002090 | Ga0495656_0002090_2817_3575 | 252 |
| 529 | 3300046642 | Ga0495634_0000021 | Ga0495634_0000021_94784_95542 | 252 |
| 530 | 3300046642 | Ga0495634_0000993 | Ga0495634_0000993_5105_5875 | 252 |
| 531 | 3300046663 | Ga0495635_0100778 | Ga0495635_0100778_23_781 | 252 |
| 532 | 3300046674 | Ga0495588_0000175 | Ga0495588_0000175_45771_46529 | 252 |
| 533 | 3300046675 | Ga0495657_0000005 | Ga0495657_0000005_6653_7411 | 252 |
| 534 | 3300046675 | Ga0495657_0001760 | Ga0495657_0001760_2823_3581 | 252 |
| 535 | 3300046678 | Ga0495599_0013297 | Ga0495599_0013297_1572_2339 | 252 |
| 536 | 3300046681 | Ga0495647_0000114 | Ga0495647_0000114_6823_7581 | 252 |
| 537 | 3300046681 | Ga0495647_0006403 | Ga0495647_0006403_2690_3448 | 252 |
| 538 | 3300046681 | Ga0495647_0195749 | Ga0495647_0195749_96_866 | 252 |
| 539 | 3300046683 | Ga0495658_0006678 | Ga0495658_0006678_3629_4387 | 252 |
| 540 | 3300046684 | Ga0495669_0000189 | Ga0495669_0000189_12252_13010 | 252 |
| 541 | 3300046689 | Ga0495613_0000087 | Ga0495613_0000087_83802_84560 | 252 |
| 542 | 3300046689 | Ga0495613_0036945 | Ga0495613_0036945_2771_3529 | 252 |
| 543 | 3300046690 | Ga0495624_0000429 | Ga0495624_0000429_12979_13737 | 252 |
| 544 | 3300046690 | Ga0495624_0000767 | Ga0495624_0000767_21729_22487 | 252 |
| 545 | 3300046691 | Ga0495670_0009083 | Ga0495670_0009083_1404_2162 | 252 |
| 546 | 3300046694 | Ga0495649_0004973 | Ga0495649_0004973_7711_8469 | 252 |
| 547 | 3300046809 | Ga0495600_0019425 | Ga0495600_0019425_2824_3585 | 252 |
| 548 | 3300046809 | Ga0495600_0053148 | Ga0495600_0053148_1681_2439 | 252 |
| 549 | 3300047315 | Ga0495581_0119853 | Ga0495581_0119853_337_1095 | 252 |
| 550 | 3300047317 | Ga0495604_0000294 | Ga0495604_0000294_10233_11003 | 252 |
| 551 | 3300047317 | Ga0495604_0000322 | Ga0495604_0000322_15871_16629 | 252 |
| 552 | 3300047317 | Ga0495604_0128702 | Ga0495604_0128702_580_1341 | 252 |
| 553 | 3300047319 | Ga0495674_0000141 | Ga0495674_0000141_18479_19237 | 252 |
| 554 | 3300047321 | Ga0495676_0001315 | Ga0495676_0001315_67_825 | 252 |
| 555 | 3300047321 | Ga0495676_0249983 | Ga0495676_0249983_402_1160 | 252 |
| 556 | 3300047322 | Ga0495680_0001951 | Ga0495680_0001951_57_815 | 252 |
| 557 | 3300047322 | Ga0495680_0002419 | Ga0495680_0002419_484_1242 | 252 |
| 558 | 3300047322 | Ga0495680_0075724 | Ga0495680_0075724_1397_2155 | 252 |
| 559 | 3300047322 | Ga0495680_0227865 | Ga0495680_0227865_290_1048 | 252 |
| 560 | 3300047444 | Ga0495675_0000398 | Ga0495675_0000398_2831_3589 | 252 |
| 561 | 3300047444 | Ga0495675_0218491 | Ga0495675_0218491_322_1080 | 252 |
| 562 | 3300047446 | Ga0495679_066319 | Ga0495679_066319_159_917 | 252 |
| 563 | 3300048088 | Ga0495602_0000038 | Ga0495602_0000038_25008_25769 | 252 |
| 564 | 3300048088 | Ga0495602_0003702 | Ga0495602_0003702_11522_12280 | 252 |
| 565 | 3300048088 | Ga0495602_0037972 | Ga0495602_0037972_806_1564 | 252 |
| 566 | 3300048088 | Ga0495602_0053710 | Ga0495602_0053710_2170_2928 | 252 |
| 567 | 3300048903 | Ga0496100_0000004 | Ga0496100_0000004_317437_318198 | 252 |
| 568 | 3300048904 | Ga0496101_0000007 | Ga0496101_0000007_317437_318198 | 252 |
| 569 | 3300048904 | Ga0496101_0385239 | Ga0496101_0385239_149_916 | 252 |
| 570 | 3300048905 | Ga0496102_0000021 | Ga0496102_0000021_169561_170319 | 252 |
| 571 | 3300048906 | Ga0496103_0000001 | Ga0496103_0000001_425588_426346 | 252 |
| 572 | 3300048907 | Ga0496104_0000008 | Ga0496104_0000008_479807_480565 | 252 |
| 573 | 3300048907 | Ga0496104_0004081 | Ga0496104_0004081_4350_5108 | 252 |
| 574 | 3300048907 | Ga0496104_0037414 | Ga0496104_0037414_2869_3627 | 252 |
| 575 | 3300048908 | Ga0496105_0000002 | Ga0496105_0000002_182389_183165 | 252 |
| 576 | 3300048908 | Ga0496105_0000003 | Ga0496105_0000003_479807_480565 | 252 |
| 577 | 3300048908 | Ga0496105_0000070 | Ga0496105_0000070_66280_67038 | 252 |
| 578 | 3300048908 | Ga0496105_0071324 | Ga0496105_0071324_1020_1781 | 252 |
| 579 | 3300048909 | Ga0496106_0000004 | Ga0496106_0000004_278851_279612 | 252 |
| 580 | 3300048910 | Ga0496107_0000001 | Ga0496107_0000001_317437_318198 | 252 |
| 581 | 3300048911 | Ga0496108_0000004 | Ga0496108_0000004_77232_77993 | 252 |
| 582 | 3300048911 | Ga0496108_0000042 | Ga0496108_0000042_114888_115646 | 252 |
| 583 | 3300048911 | Ga0496108_0000339 | Ga0496108_0000339_12237_12995 | 252 |
| 584 | 3300048911 | Ga0496108_0002451 | Ga0496108_0002451_6316_7074 | 252 |
| 585 | 3300048911 | Ga0496108_0079573 | Ga0496108_0079573_271_1029 | 252 |
| 586 | 3300048912 | Ga0496109_0000034 | Ga0496109_0000034_147527_148285 | 252 |
| 587 | 3300048912 | Ga0496109_0000036 | Ga0496109_0000036_75980_76741 | 252 |
| 588 | 3300048912 | Ga0496109_0000062 | Ga0496109_0000062_8881_9639 | 252 |
| 589 | 3300048912 | Ga0496109_0000550 | Ga0496109_0000550_21788_22546 | 252 |
| 590 | 3300048912 | Ga0496109_0350753 | Ga0496109_0350753_216_974 | 252 |
| 591 | 3300048913 | Ga0496110_0000325 | Ga0496110_0000325_15195_15953 | 252 |
| 592 | 3300048913 | Ga0496110_0077462 | Ga0496110_0077462_1472_2230 | 252 |
| 593 | 3300048913 | Ga0496110_0139814 | Ga0496110_0139814_52_810 | 252 |
| 594 | 3300048913 | Ga0496110_0150938 | Ga0496110_0150938_833_1591 | 252 |
| 595 | 3300048913 | Ga0496110_0528878 | Ga0496110_0528878_266_1024 | 252 |
| 596 | 3300048914 | Ga0496111_0000171 | Ga0496111_0000171_13654_14412 | 252 |
| 597 | 3300048914 | Ga0496111_0010712 | Ga0496111_0010712_2006_2764 | 252 |
| 598 | 3300048914 | Ga0496111_0036271 | Ga0496111_0036271_1064_1822 | 252 |
| 599 | 3300048914 | Ga0496111_0150604 | Ga0496111_0150604_889_1647 | 252 |
| 600 | 3300048914 | Ga0496111_0419569 | Ga0496111_0419569_127_885 | 252 |
| 601 | 3300048915 | Ga0496112_0000002 | Ga0496112_0000002_222314_223072 | 252 |
| 602 | 3300048915 | Ga0496112_0017988 | Ga0496112_0017988_4342_5103 | 252 |
| 603 | 3300048915 | Ga0496112_0032041 | Ga0496112_0032041_4047_4814 | 252 |
| 604 | 3300048915 | Ga0496112_0034473 | Ga0496112_0034473_934_1710 | 252 |
| 605 | 3300048916 | Ga0496113_0000002 | Ga0496113_0000002_23825_24586 | 252 |
| 606 | 3300048916 | Ga0496113_0009761 | Ga0496113_0009761_2369_3127 | 252 |
| 607 | 3300048916 | Ga0496113_0087777 | Ga0496113_0087777_148_906 | 252 |
| 608 | 3300048917 | Ga0496114_0137030 | Ga0496114_0137030_152_910 | 252 |
| 609 | 3300048917 | Ga0496114_0151098 | Ga0496114_0151098_379_1137 | 252 |
| 610 | 3300048922 | Ga0496119_0014960 | Ga0496119_0014960_620_1396 | 252 |
| 611 | 3300048922 | Ga0496119_0041652 | Ga0496119_0041652_566_1342 | 252 |
| 612 | 3300048923 | Ga0496120_0104518 | Ga0496120_0104518_274_1050 | 252 |
| 613 | 3300048924 | Ga0496121_0010570 | Ga0496121_0010570_4760_5527 | 252 |
| 614 | 3300048928 | Ga0496125_0066986 | Ga0496125_0066986_1993_2754 | 252 |
| 615 | 3300048929 | Ga0496126_0016119 | Ga0496126_0016119_2323_3081 | 252 |
| 616 | 3300049571 | Ga0501034_0004487 | Ga0501034_0004487_5792_6559 | 252 |
| 617 | 3300049581 | Ga0501047_0060675 | Ga0501047_0060675_1492_2274 | 252 |
| 618 | 3300049581 | Ga0501047_0188097 | Ga0501047_0188097_791_1549 | 252 |
| 619 | 3300049584 | Ga0501068_0127195 | Ga0501068_0127195_607_1365 | 252 |
| 620 | 3300049584 | Ga0501068_0360953 | Ga0501068_0360953_97_855 | 252 |
| 621 | 3300049585 | Ga0501069_0001568 | Ga0501069_0001568_482_1240 | 252 |
| 622 | 3300049586 | Ga0501070_0064865 | Ga0501070_0064865_879_1637 | 252 |
| 623 | 3300049586 | Ga0501070_0249330 | Ga0501070_0249330_382_1140 | 252 |
| 624 | 3300049587 | Ga0501071_0212892 | Ga0501071_0212892_102_860 | 252 |
| 625 | 3300049590 | Ga0501074_0025643 | Ga0501074_0025643_844_1602 | 252 |
| 626 | 3300049591 | Ga0501075_0000876 | Ga0501075_0000876_15503_16261 | 252 |
| 627 | 3300049593 | Ga0501077_0394061 | Ga0501077_0394061_65_823 | 252 |
| 628 | 3300049741 | Ga0501079_0380657 | Ga0501079_0380657_97_855 | 252 |
| 629 | 3300049744 | Ga0501083_0043410 | Ga0501083_0043410_1408_2166 | 252 |
| 630 | 3300049823 | Ga0501044_0045201 | Ga0501044_0045201_828_1586 | 252 |
| 631 | 3300050507 | nmdc:mga05p37_366036_c1 | nmdc:mga05p37_366036_c1_763_1521 | 252 |
| 632 | 3300050515 | nmdc:mga0a205_15_c2 | nmdc:mga0a205_15_c2_16317_17087 | 252 |
| 633 | 3300050515 | nmdc:mga0a205_6812_c1 | nmdc:mga0a205_6812_c1_1616_2374 | 252 |
| 634 | 3300053077 | Ga0495601_0000698 | Ga0495601_0000698_14448_15206 | 252 |
| 635 | 3300053077 | Ga0495601_0003864 | Ga0495601_0003864_58_816 | 252 |
| 636 | 3300053078 | Ga0495612_0000820 | Ga0495612_0000820_9910_10668 | 252 |
| 637 | 3300053078 | Ga0495612_0001451 | Ga0495612_0001451_6316_7074 | 252 |
| 638 | 3300053078 | Ga0495612_0029568 | Ga0495612_0029568_78_836 | 252 |
| 639 | 3300053078 | Ga0495612_0106594 | Ga0495612_0106594_67_825 | 252 |
| 640 | 3300053083 | Ga0495655_0000120 | Ga0495655_0000120_3640_4401 | 252 |
| 641 | 3300053084 | Ga0495595_0000005 | Ga0495595_0000005_10453_11211 | 252 |
| 642 | 3300053084 | Ga0495595_0082519 | Ga0495595_0082519_284_1042 | 252 |
| 643 | 3300053085 | Ga0495619_0000036 | Ga0495619_0000036_92899_93657 | 252 |
| 644 | 3300053085 | Ga0495619_0000069 | Ga0495619_0000069_61052_61810 | 252 |
| 645 | 3300053085 | Ga0495619_0000489 | Ga0495619_0000489_23009_23767 | 252 |
| 646 | 3300053085 | Ga0495619_0005994 | Ga0495619_0005994_167_925 | 252 |
| 647 | 3300053085 | Ga0495619_0045797 | Ga0495619_0045797_1200_1958 | 252 |
| 648 | 3300053094 | Ga0500566_0013929 | Ga0500566_0013929_766_1524 | 252 |
| 649 | 3300053123 | Ga0500614_001602 | Ga0500614_001602_239_997 | 252 |
| 650 | 3300053139 | Ga0500568_0086558 | Ga0500568_0086558_117_884 | 252 |
| 651 | 3300053153 | Ga0500616_0006627 | Ga0500616_0006627_6706_7473 | 252 |
| 652 | 3300054114 | Ga0501084_0215435 | Ga0501084_0215435_65_823 | 252 |
| 653 | 3300061719 | Ga0466962_0020444 | Ga0466962_0020444_2122_2901 | 252 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3mr1-assembly2.cif.gz_B | crystal structure of methionine aminopeptidase from rickettsia prowazekii | 0.9864 | 1 | 246 |
| 1o0x-assembly1.cif.gz_A | crystal structure of methionine aminopeptidase (tm1478) from thermotoga maritima at 1.90 a resolution | 0.9851 | 1 | 246 |
| 3tav-assembly1.cif.gz_A | crystal structure of a methionine aminopeptidase from mycobacterium abscessus | 0.9834 | 2 | 246 |
| 4juq-assembly1.cif.gz_A | pseudomonas aeruginosa metap t2n mutant, in mn form | 0.9816 | 1 | 252 |
| 3tb5-assembly2.cif.gz_B | crystal structure of the enterococcus faecalis methionine aminopeptidase apo form | 0.9799 | 1 | 251 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q6Z3V9_1_121_3.90.230.10 | Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily | 0.9909 | 13 | 124 | 3.90.230.10 |
| 4juqD00 | Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily | 0.9889 | 1 | 246 | 3.90.230.10 |
| af_P9WK21_10_265_3.90.230.10 | Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily | 0.9871 | 1 | 246 | 3.90.230.10 |
| 1o0xA00 | Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily | 0.9851 | 1 | 246 | 3.90.230.10 |
| af_Q9VKV9_33_317_3.90.230.10 | Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily | 0.9803 | 1 | 246 | 3.90.230.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A835FHY3-F1-model_v4 | Peptidase M24 domain-containing protein | 0.9983 | 32 | 110 |
GO:0009507
GO:0070006 |
| AF-A0A7X7PQL7-F1-model_v4 | Methionine aminopeptidase (MAP) (MetAP) (EC 3.4.11.18) (Peptidase M) | 0.9977 | 1 | 246 |
GO:0004239
GO:0005829 GO:0006508 GO:0046872 GO:0070006 |
| AF-A0A7C7DIY6-F1-model_v4 | Methionine aminopeptidase (MAP) (MetAP) (EC 3.4.11.18) (Peptidase M) | 0.9964 | 1 | 246 |
GO:0004239
GO:0005829 GO:0006508 GO:0046872 GO:0070006 |
| AF-A0A7C3XA93-F1-model_v4 | Methionine aminopeptidase (EC 3.4.11.18) | 0.9953 | 1 | 195 |
GO:0004239
GO:0005829 GO:0006508 GO:0046872 GO:0070006 |
| AF-H9GMZ4-F1-model_v4 | Methionyl aminopeptidase type 1D, mitochondrial | 0.9949 | 35 | 150 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar