F472790

General Info

Members Datasets Scaffolds Average Seq Length
653 295 653 254

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0030567|Ga0466967_0030567_2222_2998
Length 246
Sequence VIIKKSPAEIDAMAAAGAIHTAVLDLLSRKVRPGVTTLELDQAAEKLIRSRGAEPSFKGYRGFTGSICASPNHMVVHGIPGPFKLQRGDVISIDVGVTKDGWVADGAITLPVGEVSPVAAKLLEVTKESLFKAVEQCVAGNHLGDVGHAVQQHVEGHIGRSMHEDPQIPNYGTPGKGVLLEEGMVLAIEPMTTAGRHAVRMGDDGWAIYSQDGSVAAHFEFTVAITSDGPRILTPWHETVSVAAAA

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
49 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
52 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
53 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
136 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
137 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
138 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
139 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
140 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
141 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
142 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
143 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
144 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
145 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
146 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
147 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
148 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
149 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
150 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
151 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
152 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
153 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
154 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
155 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
156 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
157 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
158 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
159 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
160 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
161 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
162 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
163 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
164 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
165 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
166 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
167 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
168 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
169 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
170 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
171 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
172 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
173 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
174 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
175 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
176 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
177 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
178 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
179 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
180 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
181 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
182 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
183 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
184 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
185 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
186 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
187 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
188 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
189 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
190 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
191 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
192 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
193 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
194 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
195 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
196 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
197 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
198 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
199 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
200 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
201 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
202 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
203 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
204 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
205 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
206 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
207 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
208 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
209 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
210 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
211 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
212 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
213 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
214 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
215 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
216 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
217 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
218 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
219 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
220 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
221 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
222 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
223 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
224 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
225 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
226 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
227 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
228 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
229 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
230 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
231 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
232 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
233 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
234 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
235 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
236 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
237 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
238 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
239 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
240 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
241 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
242 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
243 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
244 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
245 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
261 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
262 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
263 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
264 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
265 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
266 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
267 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
268 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
269 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
270 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
271 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
272 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
273 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
276 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
277 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
278 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
279 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
280 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
281 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
282 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
283 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
284 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
285 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
286 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
287 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
288 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
289 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
290 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
291 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
292 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
293 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
294 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
295 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.69
Metatranscriptomes 0.31
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.38
Nodule 0
Rhizoplane 11.18
Rhizosphere 85.45
Stem 0
Stem Tuber 0
Unclassified 1.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1000007 3300001977 Bacteria 20037
2 JGI24748J21848_1000247 3300002074 Bacteria 6416
3 JGI24034J26672_10000068 3300002239 Bacteria 28347
4 JGI25406J46586_10005551 3300003203 Bacteria 5842
5 JGI25406J46586_10043175 3300003203 Bacteria 1572
6 Ga0070658_10129346 3300005327 Bacteria 2104
7 Ga0070683_100003330 3300005329 Bacteria 12996
8 Ga0070683_100011264 3300005329 Bacteria 7719
9 Ga0070683_100082704 3300005329 Bacteria 3007
10 Ga0070683_100103396 3300005329 Bacteria 2684
11 Ga0070670_100042140 3300005331 Bacteria 3924
12 Ga0070677_10001062 3300005333 Bacteria 8863
13 Ga0070682_100000009 3300005337 Bacteria 291635
14 Ga0070682_100000032 3300005337 Bacteria 155141
15 Ga0068868_100000306 3300005338 Bacteria 32899
16 Ga0068868_100008360 3300005338 Bacteria 7408
17 Ga0068868_100143213 3300005338 Bacteria 1964
18 Ga0068868_100265670 3300005338 Bacteria 1448
19 Ga0070691_10065164 3300005341 Bacteria 1759
20 Ga0070691_10113937 3300005341 Bacteria 1355
21 Ga0070691_10162945 3300005341 Bacteria 1151
22 Ga0070661_100000236 3300005344 Bacteria 45535
23 Ga0070668_100618852 3300005347 Bacteria 949
24 Ga0070675_100003153 3300005354 Bacteria 12477
25 Ga0070674_100000047 3300005356 Bacteria 52597
26 Ga0070673_100003060 3300005364 Bacteria 10351
27 Ga0070688_100000562 3300005365 Bacteria 18826
28 Ga0070714_100018243 3300005435 Bacteria 5696
29 Ga0070714_100036840 3300005435 Bacteria 4106
30 Ga0070713_100000171 3300005436 Bacteria 43503
31 Ga0070713_100102600 3300005436 Bacteria 2481
32 Ga0070701_10035945 3300005438 Bacteria 2493
33 Ga0070701_10234072 3300005438 Bacteria 1101
34 Ga0070711_100261378 3300005439 Bacteria 1362
35 Ga0070700_100040018 3300005441 Bacteria 2867
36 Ga0070663_100177069 3300005455 Bacteria 1652
37 Ga0070678_100023357 3300005456 Bacteria 4119
38 Ga0070678_100433769 3300005456 Bacteria 1148
39 Ga0070662_100000007 3300005457 Bacteria 168761
40 Ga0070662_100075278 3300005457 Bacteria 2500
41 Ga0070662_100353189 3300005457 Bacteria 1205
42 Ga0068867_100006857 3300005459 Bacteria 8056
43 Ga0070685_10001063 3300005466 Bacteria 14725
44 Ga0070685_10049807 3300005466 Bacteria 2417
45 Ga0070685_10131056 3300005466 Bacteria 1568
46 Ga0070685_10397569 3300005466 Bacteria 954
47 Ga0070679_100245596 3300005530 Bacteria 1747
48 Ga0070684_100067227 3300005535 Bacteria 3147
49 Ga0070684_100113330 3300005535 Bacteria 2433
50 Ga0070684_100197095 3300005535 Bacteria 1834
51 Ga0070684_100367329 3300005535 Bacteria 1325
52 Ga0070672_100000104 3300005543 Bacteria 42077
53 Ga0070686_100079879 3300005544 Bacteria 2163
54 Ga0070686_100107663 3300005544 Bacteria 1893
55 Ga0070693_100003220 3300005547 Bacteria 7574
56 Ga0070693_100277605 3300005547 Bacteria 1121
57 Ga0070665_100000022 3300005548 Bacteria 379286
58 Ga0070665_100051471 3300005548 Bacteria 4130
59 Ga0070665_100065177 3300005548 Bacteria 3654
60 Ga0070665_100093761 3300005548 Bacteria 3007
61 Ga0070665_100188803 3300005548 Bacteria 2062
62 Ga0070664_100094140 3300005564 Bacteria 2597
63 Ga0070664_100271437 3300005564 Bacteria 1528
64 Ga0068857_100120727 3300005577 Bacteria 2359
65 Ga0068854_100000939 3300005578 Bacteria 17543
66 Ga0068854_100048974 3300005578 Bacteria 3017
67 Ga0068854_100110371 3300005578 Bacteria 2074
68 Ga0068856_100007857 3300005614 Bacteria 10417
69 Ga0070702_100020483 3300005615 Bacteria 3466
70 Ga0068852_100000024 3300005616 Bacteria 120479
71 Ga0068852_100058793 3300005616 Bacteria 3332
72 Ga0068852_100574244 3300005616 Bacteria 1130
73 Ga0068859_100179316 3300005617 Bacteria 2201
74 Ga0068859_100304584 3300005617 Bacteria 1687
75 Ga0068864_100000023 3300005618 Bacteria 257064
76 Ga0068864_100196647 3300005618 Bacteria 1851
77 Ga0068866_10000274 3300005718 Bacteria 24536
78 Ga0068866_10117488 3300005718 Bacteria 1493
79 Ga0068861_100095518 3300005719 Bacteria 2354
80 Ga0068861_100175447 3300005719 Bacteria 1780
81 Ga0068851_10018801 3300005834 Bacteria 3334
82 Ga0068858_100000150 3300005842 Bacteria 73075
83 Ga0068858_100000287 3300005842 Bacteria 54456
84 Ga0068860_100033741 3300005843 Bacteria 4911
85 Ga0081455_10020035 3300005937 Bacteria 6313
86 Ga0081455_10027552 3300005937 Bacteria 5206
87 Ga0081455_10054050 3300005937 Bacteria 3426
88 Ga0081455_10165181 3300005937 Bacteria 1692
89 Ga0081455_10303292 3300005937 Bacteria 1145
90 Ga0081538_10027694 3300005981 Bacteria 3920
91 Ga0081538_10073847 3300005981 Bacteria 1861
92 Ga0081540_1049619 3300005983 Bacteria 2092
93 Ga0081539_10001787 3300005985 Bacteria 34104
94 Ga0081539_10002195 3300005985 Bacteria 28613
95 Ga0081539_10069802 3300005985 Bacteria 1889
96 Ga0081539_10151069 3300005985 Bacteria 1117
97 Ga0075363_100270149 3300006048 Bacteria 982
98 Ga0075364_10121829 3300006051 Bacteria 1746
99 Ga0070715_10000003 3300006163 Bacteria 345282
100 Ga0070712_100073343 3300006175 Bacteria 2455
101 Ga0070712_100271821 3300006175 Bacteria 1362
102 Ga0075367_10156081 3300006178 Bacteria 1418
103 Ga0097621_100660377 3300006237 Bacteria 960
104 Ga0075428_100032589 3300006844 Bacteria 5756
105 Ga0075428_100074767 3300006844 Bacteria 3701
106 Ga0075430_100017410 3300006846 Bacteria 6120
107 Ga0075431_100017217 3300006847 Bacteria 7344
108 Ga0075431_100303078 3300006847 Bacteria 1614
109 Ga0075433_10004429 3300006852 Bacteria 10932
110 Ga0075433_10036483 3300006852 Bacteria 4236
111 Ga0068865_100000024 3300006881 Bacteria 94969
112 Ga0068865_100044260 3300006881 Bacteria 3046
113 Ga0097620_100179314 3300006931 Bacteria 2201
114 Ga0097620_100304584 3300006931 Bacteria 1687
115 Ga0111539_10476644 3300009094 Bacteria 1453
116 Ga0111539_10815498 3300009094 Bacteria 1086
117 Ga0105245_10000022 3300009098 Bacteria 181225
118 Ga0105245_10000528 3300009098 Bacteria 35016
119 Ga0105245_10019614 3300009098 Bacteria 5924
120 Ga0105245_10219643 3300009098 Bacteria 1833
121 Ga0105245_10946771 3300009098 Bacteria 904
122 Ga0105247_10000064 3300009101 Bacteria 123994
123 Ga0114129_10593115 3300009147 Bacteria 1436
124 Ga0105243_10006175 3300009148 Bacteria 9263
125 Ga0105243_10165271 3300009148 Bacteria 1912
126 Ga0105243_10185937 3300009148 Bacteria 1811
127 Ga0105243_10293287 3300009148 Bacteria 1471
128 Ga0105242_10000123 3300009176 Bacteria 56900
129 Ga0105242_10083889 3300009176 Bacteria 2669
130 Ga0105248_10001735 3300009177 Bacteria 24226
131 Ga0105248_10150674 3300009177 Bacteria 2624
132 Ga0105248_10328110 3300009177 Bacteria 1724
133 Ga0105248_10506754 3300009177 Bacteria 1361
134 Ga0105238_10814416 3300009551 Bacteria 950
135 Ga0105249_10000181 3300009553 Bacteria 73946
136 Ga0105249_10231867 3300009553 Bacteria 1821
137 Ga0105249_10962192 3300009553 Bacteria 922
138 Ga0105028_106004 3300009993 Bacteria 1265
139 Ga0105239_10034512 3300010375 Bacteria 5556
140 Ga0105246_10139084 3300011119 Bacteria 1824
141 Ga0157373_10406142 3300013100 Bacteria 977
142 Ga0157371_10000818 3300013102 Bacteria 35712
143 Ga0157370_10457680 3300013104 Bacteria 1173
144 Ga0157369_10000068 3300013105 Bacteria 144274
145 Ga0157369_10685281 3300013105 Bacteria 1056
146 Ga0157378_10104189 3300013297 Bacteria 2593
147 Ga0163162_10501097 3300013306 Bacteria 1345
148 Ga0157372_10000809 3300013307 Bacteria 33940
149 Ga0157372_10444173 3300013307 Bacteria 1512
150 Ga0157372_10914320 3300013307 Bacteria 1018
151 Ga0157375_10000126 3300013308 Bacteria 75410
152 Ga0157375_10013539 3300013308 Bacteria 7263
153 Ga0157375_10016258 3300013308 Bacteria 6675
154 Ga0157375_10235762 3300013308 Bacteria 1989
155 Ga0157375_10483148 3300013308 Bacteria 1404
156 Ga0157380_10000326 3300014326 Bacteria 28781
157 Ga0157380_10006736 3300014326 Bacteria 8119
158 Ga0157380_10272336 3300014326 Bacteria 1544
159 Ga0157380_10290888 3300014326 Bacteria 1500
160 Ga0157376_10060903 3300014969 Bacteria 3172
161 Ga0157376_10069866 3300014969 Bacteria 2979
162 Ga0157376_10130173 3300014969 Bacteria 2244
163 Ga0206353_11043234 3300020082 Bacteria 891
164 Ga0224712_10004702 3300022467 Bacteria 3712
165 Ga0207656_10000374 3300025321 Bacteria 15006
166 Ga0207682_10000008 3300025893 Bacteria 87020
167 Ga0207642_10000290 3300025899 Bacteria 15000
168 Ga0207710_10000220 3300025900 Bacteria 50023
169 Ga0207688_10065624 3300025901 Bacteria 2052
170 Ga0207688_10265565 3300025901 Bacteria 1043
171 Ga0207685_10000003 3300025905 Bacteria 344527
172 Ga0207705_10115914 3300025909 Bacteria 1983
173 Ga0207707_10282976 3300025912 Bacteria 1436
174 Ga0207693_10004260 3300025915 Bacteria 12132
175 Ga0207693_10020224 3300025915 Bacteria 5295
176 Ga0207660_10209714 3300025917 Bacteria 1525
177 Ga0207657_10226927 3300025919 Bacteria 1495
178 Ga0207649_10000166 3300025920 Bacteria 53758
179 Ga0207652_10160708 3300025921 Bacteria 2014
180 Ga0207694_10000008 3300025924 Bacteria 484902
181 Ga0207659_10000138 3300025926 Bacteria 42755
182 Ga0207659_10211133 3300025926 Bacteria 1556
183 Ga0207687_10000025 3300025927 Bacteria 175177
184 Ga0207687_10000039 3300025927 Bacteria 114303
185 Ga0207687_10000132 3300025927 Bacteria 50024
186 Ga0207687_10002690 3300025927 Bacteria 12023
187 Ga0207687_10186820 3300025927 Bacteria 1610
188 Ga0207700_10000019 3300025928 Bacteria 183117
189 Ga0207664_10013567 3300025929 Bacteria 5855
190 Ga0207664_10272253 3300025929 Bacteria 1484
191 Ga0207664_10590885 3300025929 Bacteria 997
192 Ga0207690_10003914 3300025932 Bacteria 8802
193 Ga0207690_10189662 3300025932 Bacteria 1554
194 Ga0207706_10000018 3300025933 Bacteria 168729
195 Ga0207706_10099120 3300025933 Bacteria 2563
196 Ga0207686_10000066 3300025934 Bacteria 95095
197 Ga0207709_10002223 3300025935 Bacteria 12376
198 Ga0207709_10056127 3300025935 Bacteria 2436
199 Ga0207669_10000002 3300025937 Bacteria 377651
200 Ga0207669_10178502 3300025937 Bacteria 1520
201 Ga0207704_10000308 3300025938 Bacteria 22892
202 Ga0207704_10089325 3300025938 Bacteria 2019
203 Ga0207704_10106714 3300025938 Bacteria 1882
204 Ga0207704_10205407 3300025938 Bacteria 1445
205 Ga0207691_10000430 3300025940 Bacteria 41789
206 Ga0207691_10170670 3300025940 Bacteria 1905
207 Ga0207691_10674546 3300025940 Bacteria 872
208 Ga0207711_10000011 3300025941 Bacteria 518817
209 Ga0207711_10139056 3300025941 Bacteria 2184
210 Ga0207661_10000518 3300025944 Bacteria 24943
211 Ga0207661_10000616 3300025944 Bacteria 22858
212 Ga0207661_10001510 3300025944 Bacteria 15776
213 Ga0207661_10009756 3300025944 Bacteria 6896
214 Ga0207661_10035272 3300025944 Bacteria 3896
215 Ga0207661_10083827 3300025944 Bacteria 2639
216 Ga0207661_10307093 3300025944 Bacteria 1423
217 Ga0207661_10541758 3300025944 Bacteria 1066
218 Ga0207679_10006381 3300025945 Bacteria 7448
219 Ga0207679_10321841 3300025945 Bacteria 1339
220 Ga0207679_10652407 3300025945 Bacteria 952
221 Ga0207651_10000746 3300025960 Bacteria 13950
222 Ga0207712_10000067 3300025961 Bacteria 130079
223 Ga0207668_10296374 3300025972 Bacteria 1333
224 Ga0207640_10000821 3300025981 Bacteria 17670
225 Ga0207640_10002941 3300025981 Bacteria 9162
226 Ga0207640_10364690 3300025981 Bacteria 1165
227 Ga0207677_10000046 3300026023 Bacteria 105382
228 Ga0207677_10001476 3300026023 Bacteria 12436
229 Ga0207677_10103388 3300026023 Bacteria 2103
230 Ga0207703_10000122 3300026035 Bacteria 92656
231 Ga0207639_10017220 3300026041 Bacteria 5123
232 Ga0207639_10124457 3300026041 Bacteria 2124
233 Ga0207678_10028326 3300026067 Bacteria 4891
234 Ga0207678_10134526 3300026067 Bacteria 2109
235 Ga0207678_10233411 3300026067 Bacteria 1575
236 Ga0207678_10397596 3300026067 Bacteria 1193
237 Ga0207678_10734607 3300026067 Bacteria 870
238 Ga0207708_10022090 3300026075 Bacteria 4805
239 Ga0207702_10002042 3300026078 Bacteria 19546
240 Ga0207702_10017871 3300026078 Bacteria 5869
241 Ga0207702_10164250 3300026078 Bacteria 2030
242 Ga0207641_10000065 3300026088 Bacteria 156066
243 Ga0207648_10004057 3300026089 Bacteria 15196
244 Ga0207676_10000025 3300026095 Bacteria 261714
245 Ga0207674_10190001 3300026116 Bacteria 2003
246 Ga0207674_10313116 3300026116 Bacteria 1519
247 Ga0207674_10396319 3300026116 Bacteria 1334
248 Ga0207675_100082600 3300026118 Bacteria 3013
249 Ga0207675_100121616 3300026118 Bacteria 2471
250 Ga0207675_100625522 3300026118 Bacteria 1081
251 Ga0207675_100961112 3300026118 Bacteria 872
252 Ga0207683_10038808 3300026121 Bacteria 4154
253 Ga0207698_10000014 3300026142 Bacteria 240703
254 Ga0207698_10032167 3300026142 Bacteria 3797
255 Ga0207698_10694028 3300026142 Bacteria 1012
256 Ga0268266_10000029 3300028379 Bacteria 424015
257 Ga0268266_10018264 3300028379 Bacteria 5979
258 Ga0268266_10055970 3300028379 Bacteria 3392
259 Ga0268266_10080327 3300028379 Bacteria 2841
260 Ga0268265_10348199 3300028380 Bacteria 1352
261 Ga0268264_10039342 3300028381 Bacteria 3907
262 Ga0268264_10067600 3300028381 Bacteria 3017
263 Ga0265319_1000030 3300028563 Bacteria 129742
264 Ga0265318_10090314 3300028577 Bacteria 1128
265 Ga0265338_10000156 3300028800 Bacteria 125065
266 Ga0265325_10010101 3300031241 Bacteria 5483
267 Ga0265331_10105172 3300031250 Bacteria 1297
268 Ga0265327_10002567 3300031251 Bacteria 18810
269 Ga0307405_10152409 3300031731 Bacteria 1627
270 Ga0307413_10438786 3300031824 Bacteria 1033
271 Ga0307406_10437629 3300031901 Bacteria 1046
272 Ga0307407_10012271 3300031903 Bacteria 4112
273 Ga0307407_10192379 3300031903 Bacteria 1361
274 Ga0307407_10349805 3300031903 Bacteria 1046
275 Ga0307412_10469627 3300031911 Bacteria 1041
276 Ga0307409_100008475 3300031995 Bacteria 6244
277 Ga0307409_100019697 3300031995 Bacteria 4577
278 Ga0307409_100287696 3300031995 Bacteria 1522
279 Ga0307409_100412180 3300031995 Bacteria 1294
280 Ga0307409_100667724 3300031995 Bacteria 1035
281 Ga0307409_100767858 3300031995 Bacteria 969
282 Ga0307416_100035326 3300032002 Bacteria 3815
283 Ga0307416_100077786 3300032002 Bacteria 2788
284 Ga0307416_100342458 3300032002 Bacteria 1509
285 Ga0307416_100726444 3300032002 Bacteria 1084
286 Ga0307414_10017391 3300032004 Bacteria 4398
287 Ga0307411_10098326 3300032005 Bacteria 2062
288 Ga0307415_100002491 3300032126 Bacteria 9198
289 Ga0307415_100010091 3300032126 Bacteria 5330
290 Ga0307415_100013172 3300032126 Bacteria 4817
291 Ga0307415_100025248 3300032126 Bacteria 3725
292 Ga0307415_100044685 3300032126 Bacteria 2963
293 Ga0373942_0079747 3300035207 Bacteria 970
294 Ga0373937_0038132 3300036401 Bacteria 4380
295 Ga0395899_0134176 3300037312 Bacteria 1766
296 Ga0395900_0072801 3300037418 Bacteria 3532
297 Ga0395900_0463763 3300037418 Bacteria 1221
298 Ga0395898_0009239 3300037466 Bacteria 10370
299 Ga0395898_0040875 3300037466 Bacteria 4583
300 Ga0395898_0283873 3300037466 Bacteria 1579
301 Ga0395898_0312125 3300037466 Bacteria 1500
302 Ga0395898_0321994 3300037466 Bacteria 1475
303 Ga0395898_0910505 3300037466 Bacteria 817
304 Ga0395901_0024727 3300038443 Bacteria 6166
305 Ga0395901_0025795 3300038443 Bacteria 6034
306 Ga0395901_0082956 3300038443 Bacteria 3350
307 Ga0395901_0190287 3300038443 Bacteria 2152
308 Ga0395901_0241075 3300038443 Bacteria 1886
309 Ga0395901_0468617 3300038443 Bacteria 1286
310 Ga0395901_0483435 3300038443 Bacteria 1263
311 Ga0451845_0823628 3300041501 Bacteria 1919
312 Ga0451849_0498249 3300041505 Bacteria 898
313 Ga0451843_0198215 3300041509 Bacteria 841
314 Ga0451843_1563928 3300041509 Bacteria 1134
315 Ga0451853_2591154 3300041512 Bacteria 4158
316 Ga0451853_3433959 3300041512 Bacteria 957
317 Ga0451853_3641588 3300041512 Bacteria 3868
318 Ga0439454_010784 3300042011 Bacteria 1210
319 Ga0439456_044060 3300042013 Bacteria 970
320 Ga0466965_0076411 3300044683 Bacteria 1690
321 Ga0466965_0159844 3300044683 Bacteria 1181
322 Ga0466966_0058483 3300044684 Bacteria 2436
323 Ga0466961_0148442 3300044693 Bacteria 1465
324 Ga0466963_0012957 3300044694 Bacteria 5111
325 Ga0466963_0023486 3300044694 Bacteria 3917
326 Ga0466963_0055527 3300044694 Bacteria 2634
327 Ga0466963_0126235 3300044694 Bacteria 1764
328 Ga0466963_0130524 3300044694 Bacteria 1735
329 Ga0466963_0193776 3300044694 Bacteria 1420
330 Ga0466963_0202256 3300044694 Bacteria 1389
331 Ga0466964_0150548 3300044706 Bacteria 1078
332 Ga0453684_0080379 3300044712 Bacteria 4071
333 Ga0466971_0033430 3300044719 Bacteria 2305
334 Ga0466957_0004792 3300044842 Bacteria 7572
335 Ga0466957_0043709 3300044842 Bacteria 2714
336 Ga0466957_0150974 3300044842 Bacteria 1502
337 Ga0466957_0203871 3300044842 Bacteria 1300
338 Ga0466957_0328556 3300044842 Bacteria 1033
339 Ga0466960_0000460 3300044901 Bacteria 13965
340 Ga0466960_0027690 3300044901 Bacteria 2588
341 Ga0466960_0144359 3300044901 Bacteria 1267
342 Ga0466960_0199484 3300044901 Bacteria 1092
343 Ga0466960_0362066 3300044901 Bacteria 829
344 Ga0466959_0009134 3300045049 Bacteria 7040
345 Ga0466959_0217491 3300045049 Bacteria 1326
346 Ga0466958_0076506 3300045836 Bacteria 2054
347 Ga0466958_0135071 3300045836 Bacteria 1551
348 Ga0466958_0323430 3300045836 Bacteria 991
349 Ga0466967_0000003 3300045976 Bacteria 169144
350 Ga0466967_0002408 3300045976 Bacteria 11613
351 Ga0466967_0008949 3300045976 Bacteria 7392
352 Ga0466967_0029422 3300045976 Bacteria 4597
353 Ga0466967_0030567 3300045976 Bacteria 4522
354 Ga0466967_0034352 3300045976 Bacteria 4303
355 Ga0466967_0103409 3300045976 Bacteria 2606
356 Ga0466967_0109548 3300045976 Bacteria 2535
357 Ga0466967_0109663 3300045976 Bacteria 2534
358 Ga0466967_0123584 3300045976 Bacteria 2394
359 Ga0466967_0136654 3300045976 Bacteria 2280
360 Ga0466967_0183824 3300045976 Bacteria 1973
361 Ga0466967_0339224 3300045976 Bacteria 1453
362 Ga0466967_0403017 3300045976 Bacteria 1331
363 Ga0466967_0427548 3300045976 Bacteria 1292
364 Ga0466967_0653762 3300045976 Bacteria 1040
365 Ga0466967_0732095 3300045976 Bacteria 980
366 Ga0495592_0001496 3300046454 Bacteria 16278
367 Ga0495592_0079775 3300046454 Bacteria 2369
368 Ga0495592_0087018 3300046454 Bacteria 2249
369 Ga0495592_0281832 3300046454 Bacteria 1087
370 Ga0495603_0000323 3300046455 Bacteria 25798
371 Ga0495603_0000484 3300046455 Bacteria 22028
372 Ga0495603_0158301 3300046455 Bacteria 1314
373 Ga0495629_0000543 3300046459 Bacteria 31107
374 Ga0495629_0006510 3300046459 Bacteria 8654
375 Ga0495641_0000400 3300046461 Bacteria 36235
376 Ga0495641_0019407 3300046461 Bacteria 3478
377 Ga0495641_0023186 3300046461 Bacteria 3089
378 Ga0495641_0057959 3300046461 Bacteria 1754
379 Ga0495641_0127454 3300046461 Bacteria 1136
380 Ga0495651_0050048 3300046462 Bacteria 3225
381 Ga0495651_0120977 3300046462 Bacteria 1924
382 Ga0495653_0030114 3300046463 Bacteria 4327
383 Ga0495653_0120417 3300046463 Bacteria 1872
384 Ga0495650_0000121 3300046471 Bacteria 183055
385 Ga0495582_0000006 3300046473 Bacteria 140434
386 Ga0495662_0000236 3300046476 Bacteria 23206
387 Ga0495662_0004441 3300046476 Bacteria 7042
388 Ga0495664_0142988 3300046477 Bacteria 1450
389 Ga0495664_0299108 3300046477 Bacteria 971
390 Ga0495594_0000001 3300046499 Bacteria 293051
391 Ga0495606_0000283 3300046507 Bacteria 88309
392 Ga0495608_0000010 3300046511 Bacteria 258660
393 Ga0495608_0001727 3300046511 Bacteria 15654
394 Ga0495608_0043662 3300046511 Bacteria 2994
395 Ga0495620_0000668 3300046515 Bacteria 21158
396 Ga0495620_0103173 3300046515 Bacteria 1135
397 Ga0495628_0000864 3300046516 Bacteria 28036
398 Ga0495628_0076311 3300046516 Bacteria 2608
399 Ga0495630_0000148 3300046517 Bacteria 54619
400 Ga0495644_0003645 3300046523 Bacteria 6070
401 Ga0495652_0198398 3300046529 Bacteria 1525
402 Ga0495640_0009674 3300046533 Bacteria 7495
403 Ga0495640_0046086 3300046533 Bacteria 3023
404 Ga0495587_0071897 3300046536 Bacteria 2012
405 Ga0495598_0049838 3300046537 Bacteria 1257
406 Ga0495645_0004698 3300046543 Bacteria 9326
407 Ga0495622_0000069 3300046557 Bacteria 89759
408 Ga0495633_0080939 3300046558 Bacteria 1511
409 Ga0495667_0000067 3300046559 Bacteria 81751
410 Ga0495667_0010689 3300046559 Bacteria 6207
411 Ga0495667_0130209 3300046559 Bacteria 1623
412 Ga0495656_0002090 3300046615 Bacteria 6591
413 Ga0495656_0071008 3300046615 Bacteria 1547
414 Ga0495634_0000021 3300046642 Bacteria 120521
415 Ga0495634_0000993 3300046642 Bacteria 26739
416 Ga0495625_0000109 3300046660 Bacteria 125064
417 Ga0495635_0100778 3300046663 Bacteria 1974
418 Ga0495588_0000175 3300046674 Bacteria 80911
419 Ga0495657_0000005 3300046675 Bacteria 254860
420 Ga0495657_0001760 3300046675 Bacteria 18520
421 Ga0495599_0013297 3300046678 Bacteria 5087
422 Ga0495647_0000114 3300046681 Bacteria 20349
423 Ga0495647_0006403 3300046681 Bacteria 3896
424 Ga0495647_0195749 3300046681 Bacteria 885
425 Ga0495658_0000094 3300046683 Bacteria 46061
426 Ga0495658_0006678 3300046683 Bacteria 5671
427 Ga0495669_0000189 3300046684 Bacteria 38286
428 Ga0495613_0000087 3300046689 Bacteria 88644
429 Ga0495613_0036945 3300046689 Bacteria 3621
430 Ga0495624_0000429 3300046690 Bacteria 33305
431 Ga0495624_0000767 3300046690 Bacteria 25280
432 Ga0495670_0009083 3300046691 Bacteria 4888
433 Ga0495649_0004973 3300046694 Bacteria 8555
434 Ga0495600_0019425 3300046809 Bacteria 4339
435 Ga0495600_0053148 3300046809 Bacteria 2645
436 Ga0495581_0119853 3300047315 Bacteria 1531
437 Ga0495581_0258316 3300047315 Bacteria 1019
438 Ga0495604_0000294 3300047317 Bacteria 44723
439 Ga0495604_0000322 3300047317 Bacteria 42966
440 Ga0495604_0128702 3300047317 Bacteria 1822
441 Ga0495674_0000141 3300047319 Bacteria 55539
442 Ga0495676_0001315 3300047321 Bacteria 21280
443 Ga0495676_0048203 3300047321 Bacteria 3437
444 Ga0495676_0249983 3300047321 Bacteria 1210
445 Ga0495680_0001951 3300047322 Bacteria 21721
446 Ga0495680_0002419 3300047322 Bacteria 19096
447 Ga0495680_0075724 3300047322 Bacteria 2553
448 Ga0495680_0227865 3300047322 Bacteria 1328
449 Ga0495675_0000398 3300047444 Bacteria 30075
450 Ga0495675_0218491 3300047444 Bacteria 1154
451 Ga0495679_066319 3300047446 Bacteria 1048
452 Ga0495686_0227749 3300047472 Bacteria 1057
453 Ga0495686_0244644 3300047472 Bacteria 1010
454 Ga0495593_0238833 3300047673 Bacteria 910
455 Ga0495602_0000038 3300048088 Bacteria 130758
456 Ga0495602_0003702 3300048088 Bacteria 15861
457 Ga0495602_0037972 3300048088 Bacteria 4460
458 Ga0495602_0053710 3300048088 Bacteria 3565
459 Ga0496100_0000004 3300048903 Bacteria 321778
460 Ga0496101_0000007 3300048904 Bacteria 321778
461 Ga0496101_0011807 3300048904 Bacteria 5810
462 Ga0496101_0111249 3300048904 Bacteria 2062
463 Ga0496101_0274789 3300048904 Bacteria 1316
464 Ga0496101_0385239 3300048904 Bacteria 1103
465 Ga0496102_0000021 3300048905 Bacteria 246920
466 Ga0496102_0187168 3300048905 Bacteria 1951
467 Ga0496102_0341715 3300048905 Bacteria 1410
468 Ga0496103_0000001 3300048906 Bacteria 643471
469 Ga0496103_0015888 3300048906 Bacteria 4487
470 Ga0496103_0489109 3300048906 Bacteria 788
471 Ga0496104_0000008 3300048907 Bacteria 516976
472 Ga0496104_0004081 3300048907 Bacteria 12671
473 Ga0496104_0037414 3300048907 Bacteria 4539
474 Ga0496104_0110347 3300048907 Bacteria 2637
475 Ga0496105_0000002 3300048908 Bacteria 753215
476 Ga0496105_0000003 3300048908 Bacteria 713251
477 Ga0496105_0000070 3300048908 Bacteria 80117
478 Ga0496105_0071324 3300048908 Bacteria 2871
479 Ga0496106_0000004 3300048909 Bacteria 279896
480 Ga0496106_0001451 3300048909 Bacteria 17805
481 Ga0496106_0106511 3300048909 Bacteria 2179
482 Ga0496106_0424051 3300048909 Bacteria 1069
483 Ga0496107_0000001 3300048910 Bacteria 321778
484 Ga0496107_0007562 3300048910 Bacteria 7494
485 Ga0496107_0048186 3300048910 Bacteria 3069
486 Ga0496107_0180549 3300048910 Bacteria 1567
487 Ga0496108_0000004 3300048911 Bacteria 545055
488 Ga0496108_0000042 3300048911 Bacteria 146397
489 Ga0496108_0000339 3300048911 Bacteria 39428
490 Ga0496108_0002451 3300048911 Bacteria 14838
491 Ga0496108_0057211 3300048911 Bacteria 3276
492 Ga0496108_0079573 3300048911 Bacteria 2775
493 Ga0496108_0343565 3300048911 Bacteria 1302
494 Ga0496109_0000034 3300048912 Bacteria 160397
495 Ga0496109_0000036 3300048912 Bacteria 153972
496 Ga0496109_0000062 3300048912 Bacteria 112843
497 Ga0496109_0000550 3300048912 Bacteria 31748
498 Ga0496109_0350753 3300048912 Bacteria 1394
499 Ga0496109_0359702 3300048912 Bacteria 1375
500 Ga0496109_0366013 3300048912 Bacteria 1362
501 Ga0496110_0000325 3300048913 Bacteria 31707
502 Ga0496110_0077462 3300048913 Bacteria 2958
503 Ga0496110_0139814 3300048913 Bacteria 2189
504 Ga0496110_0150938 3300048913 Bacteria 2104
505 Ga0496110_0528878 3300048913 Bacteria 1072
506 Ga0496110_0577391 3300048913 Bacteria 1021
507 Ga0496110_0866528 3300048913 Bacteria 809
508 Ga0496111_0000171 3300048914 Bacteria 29367
509 Ga0496111_0010712 3300048914 Bacteria 6167
510 Ga0496111_0036271 3300048914 Bacteria 3525
511 Ga0496111_0049910 3300048914 Bacteria 3017
512 Ga0496111_0052355 3300048914 Bacteria 2947
513 Ga0496111_0102252 3300048914 Bacteria 2106
514 Ga0496111_0123300 3300048914 Bacteria 1915
515 Ga0496111_0150604 3300048914 Bacteria 1725
516 Ga0496111_0419569 3300048914 Bacteria 988
517 Ga0496111_0436824 3300048914 Bacteria 966
518 Ga0496112_0000002 3300048915 Bacteria 782039
519 Ga0496112_0017988 3300048915 Bacteria 6650
520 Ga0496112_0032041 3300048915 Bacteria 5102
521 Ga0496112_0034473 3300048915 Bacteria 4926
522 Ga0496112_0034566 3300048915 Bacteria 4919
523 Ga0496112_0174886 3300048915 Bacteria 2112
524 Ga0496113_0000002 3300048916 Bacteria 220193
525 Ga0496113_0009761 3300048916 Bacteria 6310
526 Ga0496113_0087777 3300048916 Bacteria 2392
527 Ga0496113_0202829 3300048916 Bacteria 1576
528 Ga0496114_0137030 3300048917 Bacteria 2117
529 Ga0496114_0151098 3300048917 Bacteria 2015
530 Ga0496114_0171783 3300048917 Bacteria 1889
531 Ga0496114_0533770 3300048917 Bacteria 1037
532 Ga0496119_0014960 3300048922 Bacteria 6023
533 Ga0496119_0041652 3300048922 Bacteria 2922
534 Ga0496120_0104518 3300048923 Bacteria 1490
535 Ga0496121_0010570 3300048924 Bacteria 10377
536 Ga0496125_0066986 3300048928 Bacteria 2833
537 Ga0496126_0016119 3300048929 Bacteria 7488
538 Ga0501031_0026581 3300049568 Bacteria 3773
539 Ga0501031_0026834 3300049568 Bacteria 3755
540 Ga0501032_0001419 3300049569 Bacteria 19025
541 Ga0501033_0022982 3300049570 Bacteria 4700
542 Ga0501033_0222241 3300049570 Bacteria 1344
543 Ga0501034_0004487 3300049571 Bacteria 15515
544 Ga0501034_0382839 3300049571 Bacteria 1331
545 Ga0501034_0708529 3300049571 Bacteria 905
546 Ga0501036_0056081 3300049572 Bacteria 3337
547 Ga0501036_0368307 3300049572 Bacteria 1199
548 Ga0501037_0105955 3300049573 Bacteria 2026
549 Ga0501038_0007184 3300049574 Bacteria 10295
550 Ga0501038_0171028 3300049574 Unclassified 1759
551 Ga0501039_0022063 3300049575 Bacteria 4886
552 Ga0501039_0111261 3300049575 Bacteria 2141
553 Ga0501039_0311554 3300049575 Bacteria 1237
554 Ga0501040_0049974 3300049576 Bacteria 2859
555 Ga0501040_0221476 3300049576 Bacteria 1346
556 Ga0501041_0177052 3300049577 Bacteria 1335
557 Ga0501042_0001923 3300049578 Bacteria 12499
558 Ga0501042_0095787 3300049578 Bacteria 2132
559 Ga0501042_0117250 3300049578 Bacteria 1917
560 Ga0501043_0110501 3300049579 Bacteria 2158
561 Ga0501046_0008154 3300049580 Bacteria 9150
562 Ga0501046_0226711 3300049580 Bacteria 1382
563 Ga0501047_0060675 3300049581 Bacteria 3649
564 Ga0501047_0188097 3300049581 Bacteria 1929
565 Ga0501048_0002360 3300049582 Bacteria 14414
566 Ga0501048_0096926 3300049582 Bacteria 2080
567 Ga0501068_0127195 3300049584 Bacteria 1592
568 Ga0501068_0146113 3300049584 Bacteria 1484
569 Ga0501068_0360953 3300049584 Bacteria 934
570 Ga0501069_0001568 3300049585 Bacteria 11306
571 Ga0501069_0022074 3300049585 Bacteria 3459
572 Ga0501069_0323128 3300049585 Bacteria 907
573 Ga0501070_0064865 3300049586 Bacteria 3024
574 Ga0501070_0112009 3300049586 Bacteria 2255
575 Ga0501070_0249330 3300049586 Bacteria 1452
576 Ga0501070_0330536 3300049586 Bacteria 1239
577 Ga0501070_0429254 3300049586 Bacteria 1067
578 Ga0501070_0518801 3300049586 Unclassified 956
579 Ga0501070_0603957 3300049586 Bacteria 874
580 Ga0501071_0161256 3300049587 Bacteria 1676
581 Ga0501071_0212892 3300049587 Bacteria 1453
582 Ga0501071_0308413 3300049587 Bacteria 1201
583 Ga0501072_0279384 3300049588 Bacteria 1328
584 Ga0501072_0290036 3300049588 Bacteria 1301
585 Ga0501073_0005329 3300049589 Bacteria 9645
586 Ga0501074_0025643 3300049590 Bacteria 4278
587 Ga0501074_0030502 3300049590 Bacteria 3908
588 Ga0501074_0105602 3300049590 Bacteria 2016
589 Ga0501075_0000876 3300049591 Bacteria 19068
590 Ga0501075_0041409 3300049591 Bacteria 3452
591 Ga0501075_0044341 3300049591 Bacteria 3337
592 Ga0501076_0077091 3300049592 Bacteria 2674
593 Ga0501076_0096251 3300049592 Bacteria 2384
594 Ga0501076_0163483 3300049592 Unclassified 1814
595 Ga0501076_0192907 3300049592 Bacteria 1663
596 Ga0501077_0319061 3300049593 Bacteria 990
597 Ga0501077_0337524 3300049593 Bacteria 961
598 Ga0501077_0394061 3300049593 Bacteria 885
599 Ga0501079_0122656 3300049741 Bacteria 2021
600 Ga0501079_0161416 3300049741 Bacteria 1748
601 Ga0501079_0176103 3300049741 Bacteria 1668
602 Ga0501079_0380657 3300049741 Bacteria 1106
603 Ga0501080_0116077 3300049742 Bacteria 2482
604 Ga0501080_0388009 3300049742 Bacteria 1257
605 Ga0501083_0043410 3300049744 Bacteria 3046
606 Ga0501083_0188392 3300049744 Bacteria 1346
607 Ga0501035_0685903 3300049822 Bacteria 827
608 Ga0501044_0045201 3300049823 Bacteria 4564
609 Ga0501044_0217646 3300049823 Bacteria 1861
610 Ga0501044_0376820 3300049823 Bacteria 1335
611 Ga0501045_0094375 3300049824 Bacteria 2213
612 Ga0501045_0095262 3300049824 Bacteria 2202
613 Ga0501045_0109271 3300049824 Bacteria 2050
614 Ga0501045_0514831 3300049824 Bacteria 888
615 nmdc:mga05p37_366036_c1 3300050507 Bacteria 1693
616 nmdc:mga09592_61724_c1 3300050508 Bacteria 3170
617 nmdc:mga0qj67_52476_c1 3300050509 Bacteria 3227
618 nmdc:mga06r32_45944_c1 3300050510 Bacteria 4165
619 nmdc:mga08y16_32980_c1 3300050511 Bacteria 5442
620 nmdc:mga0rr50_564992_c1 3300050513 Bacteria 969
621 nmdc:mga0a205_15_c2 3300050515 Bacteria 75060
622 nmdc:mga0a205_6812_c1 3300050515 Bacteria 10339
623 Ga0495601_0000698 3300053077 Bacteria 18035
624 Ga0495601_0003864 3300053077 Bacteria 8624
625 Ga0495612_0000820 3300053078 Bacteria 12636
626 Ga0495612_0001451 3300053078 Bacteria 9769
627 Ga0495612_0029568 3300053078 Bacteria 2207
628 Ga0495612_0106594 3300053078 Bacteria 1197
629 Ga0495655_0000120 3300053083 Bacteria 14477
630 Ga0495595_0000005 3300053084 Bacteria 258660
631 Ga0495595_0082519 3300053084 Bacteria 1533
632 Ga0495619_0000036 3300053085 Bacteria 125188
633 Ga0495619_0000069 3300053085 Bacteria 82755
634 Ga0495619_0000489 3300053085 Bacteria 26595
635 Ga0495619_0001663 3300053085 Bacteria 14686
636 Ga0495619_0005994 3300053085 Bacteria 7695
637 Ga0495619_0045797 3300053085 Bacteria 2874
638 Ga0500566_0013929 3300053094 Bacteria 4727
639 Ga0500614_001602 3300053123 Bacteria 5337
640 Ga0500568_0059994 3300053139 Bacteria 1474
641 Ga0500568_0086558 3300053139 Bacteria 1185
642 Ga0500616_0006627 3300053153 Bacteria 7544
643 Ga0500616_0041688 3300053153 Bacteria 2462
644 Ga0501084_0050011 3300054114 Bacteria 3499
645 Ga0501084_0201975 3300054114 Bacteria 1677
646 Ga0501084_0215435 3300054114 Bacteria 1620
647 Ga0501082_0141078 3300060353 Bacteria 2091
648 Ga0501082_0578542 3300060353 Bacteria 982
649 Ga0466962_0020444 3300061719 Bacteria 3181
650 Ga0466962_0068897 3300061719 Bacteria 1689
651 Ga0530510_0075269 3300061734 Bacteria 2452
652 Ga0530510_0088632 3300061734 Bacteria 2255
653 Ga0530510_0354185 3300061734 Bacteria 1103

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044712 Ga0453684_0080379 Ga0453684_0080379_2684_3343 218
2 3300047673 Ga0495593_0238833 Ga0495593_0238833_18_680 220
3 3300044901 Ga0466960_0199484 Ga0466960_0199484_12_692 226
4 3300041505 Ga0451849_0498249 Ga0451849_0498249_189_872 227
5 3300041512 Ga0451853_3433959 Ga0451853_3433959_13_696 227
6 3300048914 Ga0496111_0436824 Ga0496111_0436824_257_943 227
7 3300053085 Ga0495619_0001663 Ga0495619_0001663_12_695 227
8 3300045836 Ga0466958_0323430 Ga0466958_0323430_277_981 228
9 3300049570 Ga0501033_0222241 Ga0501033_0222241_15_719 228
10 3300037418 Ga0395900_0463763 Ga0395900_0463763_511_1209 229
11 3300047472 Ga0495686_0244644 Ga0495686_0244644_11_700 229
12 3300005937 Ga0081455_10303292 Ga0081455_103032922 239
13 3300006847 Ga0075431_100303078 Ga0075431_1003030782 239
14 3300025972 Ga0207668_10296374 Ga0207668_102963743 239
15 3300044901 Ga0466960_0362066 Ga0466960_0362066_26_763 239
16 3300048906 Ga0496103_0489109 Ga0496103_0489109_11_733 239
17 3300049574 Ga0501038_0171028 Ga0501038_0171028_287_1006 239
18 3300049577 Ga0501041_0177052 Ga0501041_0177052_588_1325 239
19 3300049586 Ga0501070_0518801 Ga0501070_0518801_23_742 239
20 3300005338 Ga0068868_100008360 Ga0068868_10000836013 240
21 3300005543 Ga0070672_100000104 Ga0070672_10000010416 240
22 3300005564 Ga0070664_100271437 Ga0070664_1002714372 240
23 3300025940 Ga0207691_10000430 Ga0207691_1000043016 240
24 3300025944 Ga0207661_10083827 Ga0207661_100838274 240
25 3300026023 Ga0207677_10001476 Ga0207677_100014763 240
26 3300028577 Ga0265318_10090314 Ga0265318_100903141 240
27 3300031251 Ga0265327_10002567 Ga0265327_1000256721 240
28 3300045976 Ga0466967_0030567 Ga0466967_0030567_2222_2998 240
29 3300048912 Ga0496109_0359702 Ga0496109_0359702_195_968 240
30 3300048913 Ga0496110_0866528 Ga0496110_0866528_52_774 240
31 3300048914 Ga0496111_0049910 Ga0496111_0049910_842_1615 240
32 3300049586 Ga0501070_0603957 Ga0501070_0603957_21_743 240
33 3300053139 Ga0500568_0059994 Ga0500568_0059994_366_1145 244
34 3300053153 Ga0500616_0041688 Ga0500616_0041688_1093_1872 244
35 3300026142 Ga0207698_10694028 Ga0207698_106940282 245
36 3300003203 JGI25406J46586_10043175 JGI25406J46586_100431752 250
37 3300005985 Ga0081539_10002195 Ga0081539_1000219534 250
38 3300013105 Ga0157369_10685281 Ga0157369_106852812 250
39 3300046660 Ga0495625_0000109 Ga0495625_0000109_77108_77869 250
40 3300047472 Ga0495686_0227749 Ga0495686_0227749_210_962 250
41 3300003203 JGI25406J46586_10005551 JGI25406J46586_100055517 251
42 3300005327 Ga0070658_10129346 Ga0070658_101293462 251
43 3300005329 Ga0070683_100082704 Ga0070683_1000827042 251
44 3300005338 Ga0068868_100143213 Ga0068868_1001432132 251
45 3300005338 Ga0068868_100265670 Ga0068868_1002656702 251
46 3300005341 Ga0070691_10065164 Ga0070691_100651642 251
47 3300005341 Ga0070691_10162945 Ga0070691_101629452 251
48 3300005347 Ga0070668_100618852 Ga0070668_1006188521 251
49 3300005438 Ga0070701_10035945 Ga0070701_100359454 251
50 3300005438 Ga0070701_10234072 Ga0070701_102340722 251
51 3300005439 Ga0070711_100261378 Ga0070711_1002613782 251
52 3300005441 Ga0070700_100040018 Ga0070700_1000400183 251
53 3300005456 Ga0070678_100433769 Ga0070678_1004337692 251
54 3300005457 Ga0070662_100075278 Ga0070662_1000752782 251
55 3300005457 Ga0070662_100353189 Ga0070662_1003531892 251
56 3300005466 Ga0070685_10049807 Ga0070685_100498072 251
57 3300005466 Ga0070685_10397569 Ga0070685_103975691 251
58 3300005530 Ga0070679_100245596 Ga0070679_1002455963 251
59 3300005535 Ga0070684_100113330 Ga0070684_1001133304 251
60 3300005535 Ga0070684_100197095 Ga0070684_1001970952 251
61 3300005535 Ga0070684_100367329 Ga0070684_1003673292 251
62 3300005544 Ga0070686_100079879 Ga0070686_1000798792 251
63 3300005544 Ga0070686_100107663 Ga0070686_1001076632 251
64 3300005547 Ga0070693_100277605 Ga0070693_1002776052 251
65 3300005548 Ga0070665_100188803 Ga0070665_1001888033 251
66 3300005564 Ga0070664_100094140 Ga0070664_1000941403 251
67 3300005578 Ga0068854_100110371 Ga0068854_1001103712 251
68 3300005615 Ga0070702_100020483 Ga0070702_1000204833 251
69 3300005616 Ga0068852_100574244 Ga0068852_1005742442 251
70 3300005617 Ga0068859_100179316 Ga0068859_1001793162 251
71 3300005617 Ga0068859_100304584 Ga0068859_1003045842 251
72 3300005618 Ga0068864_100196647 Ga0068864_1001966472 251
73 3300005718 Ga0068866_10117488 Ga0068866_101174882 251
74 3300005719 Ga0068861_100095518 Ga0068861_1000955183 251
75 3300005719 Ga0068861_100175447 Ga0068861_1001754471 251
76 3300005937 Ga0081455_10020035 Ga0081455_100200356 251
77 3300005937 Ga0081455_10027552 Ga0081455_100275525 251
78 3300005937 Ga0081455_10054050 Ga0081455_100540502 251
79 3300005981 Ga0081538_10027694 Ga0081538_100276943 251
80 3300005981 Ga0081538_10073847 Ga0081538_100738471 251
81 3300005983 Ga0081540_1049619 Ga0081540_10496193 251
82 3300005985 Ga0081539_10001787 Ga0081539_1000178736 251
83 3300005985 Ga0081539_10069802 Ga0081539_100698022 251
84 3300005985 Ga0081539_10151069 Ga0081539_101510692 251
85 3300006048 Ga0075363_100270149 Ga0075363_1002701492 251
86 3300006051 Ga0075364_10121829 Ga0075364_101218293 251
87 3300006175 Ga0070712_100073343 Ga0070712_1000733435 251
88 3300006237 Ga0097621_100660377 Ga0097621_1006603771 251
89 3300006844 Ga0075428_100032589 Ga0075428_1000325892 251
90 3300006844 Ga0075428_100074767 Ga0075428_1000747674 251
91 3300006846 Ga0075430_100017410 Ga0075430_1000174104 251
92 3300006847 Ga0075431_100017217 Ga0075431_1000172174 251
93 3300006881 Ga0068865_100044260 Ga0068865_1000442602 251
94 3300006931 Ga0097620_100179314 Ga0097620_1001793142 251
95 3300006931 Ga0097620_100304584 Ga0097620_1003045842 251
96 3300009094 Ga0111539_10476644 Ga0111539_104766441 251
97 3300009094 Ga0111539_10815498 Ga0111539_108154982 251
98 3300009098 Ga0105245_10219643 Ga0105245_102196431 251
99 3300009098 Ga0105245_10946771 Ga0105245_109467711 251
100 3300009148 Ga0105243_10165271 Ga0105243_101652712 251
101 3300009148 Ga0105243_10185937 Ga0105243_101859373 251
102 3300009148 Ga0105243_10293287 Ga0105243_102932872 251
103 3300009177 Ga0105248_10150674 Ga0105248_101506743 251
104 3300009177 Ga0105248_10506754 Ga0105248_105067542 251
105 3300009553 Ga0105249_10962192 Ga0105249_109621922 251
106 3300010375 Ga0105239_10034512 Ga0105239_100345123 251
107 3300011119 Ga0105246_10139084 Ga0105246_101390841 251
108 3300013306 Ga0163162_10501097 Ga0163162_105010972 251
109 3300013307 Ga0157372_10444173 Ga0157372_104441732 251
110 3300013307 Ga0157372_10914320 Ga0157372_109143202 251
111 3300013308 Ga0157375_10013539 Ga0157375_100135399 251
112 3300013308 Ga0157375_10235762 Ga0157375_102357623 251
113 3300013308 Ga0157375_10483148 Ga0157375_104831482 251
114 3300014326 Ga0157380_10272336 Ga0157380_102723362 251
115 3300014326 Ga0157380_10290888 Ga0157380_102908882 251
116 3300014969 Ga0157376_10069866 Ga0157376_100698662 251
117 3300014969 Ga0157376_10130173 Ga0157376_101301733 251
118 3300025901 Ga0207688_10065624 Ga0207688_100656242 251
119 3300025901 Ga0207688_10265565 Ga0207688_102655651 251
120 3300025909 Ga0207705_10115914 Ga0207705_101159142 251
121 3300025912 Ga0207707_10282976 Ga0207707_102829762 251
122 3300025915 Ga0207693_10004260 Ga0207693_100042602 251
123 3300025917 Ga0207660_10209714 Ga0207660_102097142 251
124 3300025919 Ga0207657_10226927 Ga0207657_102269272 251
125 3300025921 Ga0207652_10160708 Ga0207652_101607084 251
126 3300025926 Ga0207659_10211133 Ga0207659_102111331 251
127 3300025927 Ga0207687_10186820 Ga0207687_101868202 251
128 3300025932 Ga0207690_10189662 Ga0207690_101896622 251
129 3300025933 Ga0207706_10099120 Ga0207706_100991202 251
130 3300025935 Ga0207709_10056127 Ga0207709_100561272 251
131 3300025937 Ga0207669_10178502 Ga0207669_101785022 251
132 3300025938 Ga0207704_10089325 Ga0207704_100893251 251
133 3300025938 Ga0207704_10106714 Ga0207704_101067143 251
134 3300025938 Ga0207704_10205407 Ga0207704_102054072 251
135 3300025940 Ga0207691_10170670 Ga0207691_101706702 251
136 3300025940 Ga0207691_10674546 Ga0207691_106745461 251
137 3300025944 Ga0207661_10035272 Ga0207661_100352722 251
138 3300025944 Ga0207661_10541758 Ga0207661_105417581 251
139 3300025945 Ga0207679_10321841 Ga0207679_103218412 251
140 3300025945 Ga0207679_10652407 Ga0207679_106524072 251
141 3300025981 Ga0207640_10364690 Ga0207640_103646901 251
142 3300026023 Ga0207677_10103388 Ga0207677_101033883 251
143 3300026067 Ga0207678_10028326 Ga0207678_100283264 251
144 3300026067 Ga0207678_10233411 Ga0207678_102334111 251
145 3300026067 Ga0207678_10397596 Ga0207678_103975962 251
146 3300026067 Ga0207678_10734607 Ga0207678_107346071 251
147 3300026075 Ga0207708_10022090 Ga0207708_100220903 251
148 3300026116 Ga0207674_10190001 Ga0207674_101900011 251
149 3300026116 Ga0207674_10313116 Ga0207674_103131162 251
150 3300026116 Ga0207674_10396319 Ga0207674_103963192 251
151 3300026118 Ga0207675_100121616 Ga0207675_1001216162 251
152 3300026118 Ga0207675_100625522 Ga0207675_1006255221 251
153 3300028380 Ga0268265_10348199 Ga0268265_103481992 251
154 3300028381 Ga0268264_10067600 Ga0268264_100676002 251
155 3300031731 Ga0307405_10152409 Ga0307405_101524092 251
156 3300031824 Ga0307413_10438786 Ga0307413_104387861 251
157 3300031901 Ga0307406_10437629 Ga0307406_104376292 251
158 3300031903 Ga0307407_10012271 Ga0307407_100122716 251
159 3300031903 Ga0307407_10192379 Ga0307407_101923792 251
160 3300031903 Ga0307407_10349805 Ga0307407_103498051 251
161 3300031911 Ga0307412_10469627 Ga0307412_104696271 251
162 3300031995 Ga0307409_100008475 Ga0307409_1000084753 251
163 3300031995 Ga0307409_100019697 Ga0307409_1000196972 251
164 3300031995 Ga0307409_100287696 Ga0307409_1002876961 251
165 3300031995 Ga0307409_100412180 Ga0307409_1004121802 251
166 3300031995 Ga0307409_100667724 Ga0307409_1006677241 251
167 3300032002 Ga0307416_100035326 Ga0307416_1000353261 251
168 3300032002 Ga0307416_100077786 Ga0307416_1000777862 251
169 3300032002 Ga0307416_100342458 Ga0307416_1003424582 251
170 3300032002 Ga0307416_100726444 Ga0307416_1007264442 251
171 3300032004 Ga0307414_10017391 Ga0307414_100173911 251
172 3300032005 Ga0307411_10098326 Ga0307411_100983261 251
173 3300032126 Ga0307415_100010091 Ga0307415_1000100913 251
174 3300032126 Ga0307415_100013172 Ga0307415_1000131723 251
175 3300032126 Ga0307415_100025248 Ga0307415_1000252483 251
176 3300032126 Ga0307415_100044685 Ga0307415_1000446854 251
177 3300035207 Ga0373942_0079747 Ga0373942_0079747_177_950 251
178 3300037312 Ga0395899_0134176 Ga0395899_0134176_144_902 251
179 3300037418 Ga0395900_0072801 Ga0395900_0072801_2428_3183 251
180 3300037466 Ga0395898_0009239 Ga0395898_0009239_11_766 251
181 3300037466 Ga0395898_0040875 Ga0395898_0040875_1433_2191 251
182 3300037466 Ga0395898_0321994 Ga0395898_0321994_67_840 251
183 3300037466 Ga0395898_0910505 Ga0395898_0910505_11_766 251
184 3300038443 Ga0395901_0024727 Ga0395901_0024727_1607_2365 251
185 3300038443 Ga0395901_0025795 Ga0395901_0025795_3692_4459 251
186 3300038443 Ga0395901_0082956 Ga0395901_0082956_2385_3158 251
187 3300038443 Ga0395901_0468617 Ga0395901_0468617_320_1078 251
188 3300041509 Ga0451843_0198215 Ga0451843_0198215_64_819 251
189 3300041509 Ga0451843_1563928 Ga0451843_1563928_252_1028 251
190 3300041512 Ga0451853_3641588 Ga0451853_3641588_1429_2196 251
191 3300042011 Ga0439454_010784 Ga0439454_010784_106_879 251
192 3300042013 Ga0439456_044060 Ga0439456_044060_31_804 251
193 3300044683 Ga0466965_0076411 Ga0466965_0076411_770_1543 251
194 3300044683 Ga0466965_0159844 Ga0466965_0159844_66_839 251
195 3300044694 Ga0466963_0055527 Ga0466963_0055527_939_1712 251
196 3300044694 Ga0466963_0126235 Ga0466963_0126235_599_1372 251
197 3300044694 Ga0466963_0130524 Ga0466963_0130524_862_1635 251
198 3300044706 Ga0466964_0150548 Ga0466964_0150548_39_812 251
199 3300044842 Ga0466957_0203871 Ga0466957_0203871_492_1265 251
200 3300044901 Ga0466960_0144359 Ga0466960_0144359_470_1243 251
201 3300045836 Ga0466958_0135071 Ga0466958_0135071_37_810 251
202 3300045976 Ga0466967_0002408 Ga0466967_0002408_4543_5316 251
203 3300045976 Ga0466967_0008949 Ga0466967_0008949_1468_2232 251
204 3300045976 Ga0466967_0029422 Ga0466967_0029422_3754_4512 251
205 3300045976 Ga0466967_0103409 Ga0466967_0103409_1130_1906 251
206 3300045976 Ga0466967_0109548 Ga0466967_0109548_17_790 251
207 3300045976 Ga0466967_0109663 Ga0466967_0109663_334_1107 251
208 3300045976 Ga0466967_0123584 Ga0466967_0123584_27_800 251
209 3300045976 Ga0466967_0136654 Ga0466967_0136654_728_1501 251
210 3300045976 Ga0466967_0183824 Ga0466967_0183824_1032_1805 251
211 3300045976 Ga0466967_0403017 Ga0466967_0403017_439_1221 251
212 3300045976 Ga0466967_0427548 Ga0466967_0427548_212_967 251
213 3300045976 Ga0466967_0653762 Ga0466967_0653762_126_899 251
214 3300046455 Ga0495603_0158301 Ga0495603_0158301_334_1089 251
215 3300046461 Ga0495641_0019407 Ga0495641_0019407_777_1532 251
216 3300046461 Ga0495641_0127454 Ga0495641_0127454_331_1086 251
217 3300046473 Ga0495582_0000006 Ga0495582_0000006_43191_43949 251
218 3300046536 Ga0495587_0071897 Ga0495587_0071897_1040_1798 251
219 3300046615 Ga0495656_0071008 Ga0495656_0071008_412_1185 251
220 3300046683 Ga0495658_0000094 Ga0495658_0000094_2789_3547 251
221 3300047315 Ga0495581_0258316 Ga0495581_0258316_198_953 251
222 3300047321 Ga0495676_0048203 Ga0495676_0048203_1995_2750 251
223 3300048904 Ga0496101_0011807 Ga0496101_0011807_3669_4424 251
224 3300048904 Ga0496101_0111249 Ga0496101_0111249_171_929 251
225 3300048904 Ga0496101_0274789 Ga0496101_0274789_406_1161 251
226 3300048905 Ga0496102_0187168 Ga0496102_0187168_1055_1810 251
227 3300048905 Ga0496102_0341715 Ga0496102_0341715_564_1337 251
228 3300048906 Ga0496103_0015888 Ga0496103_0015888_3442_4197 251
229 3300048907 Ga0496104_0110347 Ga0496104_0110347_1495_2253 251
230 3300048909 Ga0496106_0001451 Ga0496106_0001451_221_976 251
231 3300048909 Ga0496106_0106511 Ga0496106_0106511_650_1423 251
232 3300048909 Ga0496106_0424051 Ga0496106_0424051_121_876 251
233 3300048910 Ga0496107_0007562 Ga0496107_0007562_5115_5870 251
234 3300048910 Ga0496107_0048186 Ga0496107_0048186_996_1754 251
235 3300048910 Ga0496107_0180549 Ga0496107_0180549_22_777 251
236 3300048911 Ga0496108_0057211 Ga0496108_0057211_1322_2077 251
237 3300048911 Ga0496108_0343565 Ga0496108_0343565_454_1212 251
238 3300048912 Ga0496109_0366013 Ga0496109_0366013_243_1019 251
239 3300048913 Ga0496110_0577391 Ga0496110_0577391_68_844 251
240 3300048914 Ga0496111_0052355 Ga0496111_0052355_733_1491 251
241 3300048914 Ga0496111_0102252 Ga0496111_0102252_1027_1782 251
242 3300048914 Ga0496111_0123300 Ga0496111_0123300_129_905 251
243 3300048915 Ga0496112_0034566 Ga0496112_0034566_3675_4430 251
244 3300048915 Ga0496112_0174886 Ga0496112_0174886_526_1305 251
245 3300048916 Ga0496113_0202829 Ga0496113_0202829_394_1149 251
246 3300048917 Ga0496114_0171783 Ga0496114_0171783_694_1449 251
247 3300048917 Ga0496114_0533770 Ga0496114_0533770_86_847 251
248 3300049568 Ga0501031_0026581 Ga0501031_0026581_690_1463 251
249 3300049568 Ga0501031_0026834 Ga0501031_0026834_1198_1974 251
250 3300049569 Ga0501032_0001419 Ga0501032_0001419_13456_14229 251
251 3300049570 Ga0501033_0022982 Ga0501033_0022982_1448_2221 251
252 3300049571 Ga0501034_0382839 Ga0501034_0382839_503_1276 251
253 3300049571 Ga0501034_0708529 Ga0501034_0708529_39_818 251
254 3300049572 Ga0501036_0056081 Ga0501036_0056081_74_847 251
255 3300049572 Ga0501036_0368307 Ga0501036_0368307_352_1125 251
256 3300049573 Ga0501037_0105955 Ga0501037_0105955_150_923 251
257 3300049574 Ga0501038_0007184 Ga0501038_0007184_1025_1798 251
258 3300049575 Ga0501039_0022063 Ga0501039_0022063_1840_2613 251
259 3300049575 Ga0501039_0111261 Ga0501039_0111261_409_1185 251
260 3300049575 Ga0501039_0311554 Ga0501039_0311554_412_1185 251
261 3300049576 Ga0501040_0049974 Ga0501040_0049974_1197_1970 251
262 3300049576 Ga0501040_0221476 Ga0501040_0221476_249_1022 251
263 3300049578 Ga0501042_0001923 Ga0501042_0001923_3084_3857 251
264 3300049578 Ga0501042_0095787 Ga0501042_0095787_1290_2063 251
265 3300049578 Ga0501042_0117250 Ga0501042_0117250_479_1234 251
266 3300049579 Ga0501043_0110501 Ga0501043_0110501_503_1276 251
267 3300049580 Ga0501046_0008154 Ga0501046_0008154_7812_8585 251
268 3300049580 Ga0501046_0226711 Ga0501046_0226711_25_798 251
269 3300049582 Ga0501048_0002360 Ga0501048_0002360_5057_5830 251
270 3300049582 Ga0501048_0096926 Ga0501048_0096926_1292_2065 251
271 3300049584 Ga0501068_0146113 Ga0501068_0146113_546_1319 251
272 3300049585 Ga0501069_0022074 Ga0501069_0022074_1749_2522 251
273 3300049585 Ga0501069_0323128 Ga0501069_0323128_37_810 251
274 3300049586 Ga0501070_0112009 Ga0501070_0112009_86_859 251
275 3300049586 Ga0501070_0330536 Ga0501070_0330536_40_819 251
276 3300049586 Ga0501070_0429254 Ga0501070_0429254_58_831 251
277 3300049587 Ga0501071_0161256 Ga0501071_0161256_763_1536 251
278 3300049587 Ga0501071_0308413 Ga0501071_0308413_372_1139 251
279 3300049588 Ga0501072_0279384 Ga0501072_0279384_354_1127 251
280 3300049588 Ga0501072_0290036 Ga0501072_0290036_20_796 251
281 3300049589 Ga0501073_0005329 Ga0501073_0005329_8076_8849 251
282 3300049590 Ga0501074_0030502 Ga0501074_0030502_1668_2444 251
283 3300049590 Ga0501074_0105602 Ga0501074_0105602_516_1289 251
284 3300049591 Ga0501075_0041409 Ga0501075_0041409_1520_2293 251
285 3300049591 Ga0501075_0044341 Ga0501075_0044341_1966_2721 251
286 3300049592 Ga0501076_0077091 Ga0501076_0077091_860_1633 251
287 3300049592 Ga0501076_0096251 Ga0501076_0096251_1339_2112 251
288 3300049592 Ga0501076_0163483 Ga0501076_0163483_1006_1761 251
289 3300049592 Ga0501076_0192907 Ga0501076_0192907_77_844 251
290 3300049593 Ga0501077_0319061 Ga0501077_0319061_205_978 251
291 3300049593 Ga0501077_0337524 Ga0501077_0337524_51_824 251
292 3300049741 Ga0501079_0122656 Ga0501079_0122656_784_1560 251
293 3300049741 Ga0501079_0161416 Ga0501079_0161416_936_1691 251
294 3300049741 Ga0501079_0176103 Ga0501079_0176103_519_1292 251
295 3300049742 Ga0501080_0116077 Ga0501080_0116077_748_1521 251
296 3300049742 Ga0501080_0388009 Ga0501080_0388009_460_1236 251
297 3300049744 Ga0501083_0188392 Ga0501083_0188392_183_956 251
298 3300049822 Ga0501035_0685903 Ga0501035_0685903_19_792 251
299 3300049823 Ga0501044_0217646 Ga0501044_0217646_526_1299 251
300 3300049823 Ga0501044_0376820 Ga0501044_0376820_123_896 251
301 3300049824 Ga0501045_0094375 Ga0501045_0094375_1336_2091 251
302 3300049824 Ga0501045_0095262 Ga0501045_0095262_1380_2153 251
303 3300049824 Ga0501045_0109271 Ga0501045_0109271_775_1551 251
304 3300049824 Ga0501045_0514831 Ga0501045_0514831_100_873 251
305 3300050508 nmdc:mga09592_61724_c1 nmdc:mga09592_61724_c1_1527_2294 251
306 3300050509 nmdc:mga0qj67_52476_c1 nmdc:mga0qj67_52476_c1_15_782 251
307 3300050510 nmdc:mga06r32_45944_c1 nmdc:mga06r32_45944_c1_900_1667 251
308 3300050511 nmdc:mga08y16_32980_c1 nmdc:mga08y16_32980_c1_1891_2667 251
309 3300050513 nmdc:mga0rr50_564992_c1 nmdc:mga0rr50_564992_c1_28_783 251
310 3300054114 Ga0501084_0050011 Ga0501084_0050011_2167_2940 251
311 3300054114 Ga0501084_0201975 Ga0501084_0201975_840_1613 251
312 3300060353 Ga0501082_0141078 Ga0501082_0141078_386_1159 251
313 3300060353 Ga0501082_0578542 Ga0501082_0578542_107_880 251
314 3300061719 Ga0466962_0068897 Ga0466962_0068897_860_1633 251
315 3300061734 Ga0530510_0075269 Ga0530510_0075269_708_1463 251
316 3300061734 Ga0530510_0088632 Ga0530510_0088632_1353_2126 251
317 3300061734 Ga0530510_0354185 Ga0530510_0354185_135_902 251
318 3300001977 JGI24746J21847_1000007 JGI24746J21847_100000727 252
319 3300002074 JGI24748J21848_1000247 JGI24748J21848_10002472 252
320 3300002239 JGI24034J26672_10000068 JGI24034J26672_100000685 252
321 3300005329 Ga0070683_100003330 Ga0070683_1000033302 252
322 3300005329 Ga0070683_100011264 Ga0070683_1000112642 252
323 3300005329 Ga0070683_100103396 Ga0070683_1001033963 252
324 3300005331 Ga0070670_100042140 Ga0070670_1000421401 252
325 3300005333 Ga0070677_10001062 Ga0070677_1000106213 252
326 3300005337 Ga0070682_100000009 Ga0070682_100000009276 252
327 3300005337 Ga0070682_100000032 Ga0070682_100000032152 252
328 3300005338 Ga0068868_100000306 Ga0068868_10000030633 252
329 3300005341 Ga0070691_10113937 Ga0070691_101139372 252
330 3300005344 Ga0070661_100000236 Ga0070661_10000023618 252
331 3300005354 Ga0070675_100003153 Ga0070675_10000315311 252
332 3300005356 Ga0070674_100000047 Ga0070674_10000004733 252
333 3300005364 Ga0070673_100003060 Ga0070673_1000030601 252
334 3300005365 Ga0070688_100000562 Ga0070688_1000005626 252
335 3300005435 Ga0070714_100018243 Ga0070714_1000182433 252
336 3300005435 Ga0070714_100036840 Ga0070714_1000368404 252
337 3300005436 Ga0070713_100000171 Ga0070713_10000017135 252
338 3300005436 Ga0070713_100102600 Ga0070713_1001026002 252
339 3300005455 Ga0070663_100177069 Ga0070663_1001770691 252
340 3300005456 Ga0070678_100023357 Ga0070678_1000233572 252
341 3300005457 Ga0070662_100000007 Ga0070662_10000000748 252
342 3300005459 Ga0068867_100006857 Ga0068867_1000068572 252
343 3300005466 Ga0070685_10001063 Ga0070685_100010636 252
344 3300005466 Ga0070685_10131056 Ga0070685_101310562 252
345 3300005535 Ga0070684_100067227 Ga0070684_1000672273 252
346 3300005547 Ga0070693_100003220 Ga0070693_1000032208 252
347 3300005548 Ga0070665_100000022 Ga0070665_100000022384 252
348 3300005548 Ga0070665_100051471 Ga0070665_1000514713 252
349 3300005548 Ga0070665_100065177 Ga0070665_1000651772 252
350 3300005548 Ga0070665_100093761 Ga0070665_1000937614 252
351 3300005577 Ga0068857_100120727 Ga0068857_1001207272 252
352 3300005578 Ga0068854_100000939 Ga0068854_10000093914 252
353 3300005578 Ga0068854_100048974 Ga0068854_1000489741 252
354 3300005614 Ga0068856_100007857 Ga0068856_1000078577 252
355 3300005616 Ga0068852_100000024 Ga0068852_1000000246 252
356 3300005616 Ga0068852_100058793 Ga0068852_1000587932 252
357 3300005618 Ga0068864_100000023 Ga0068864_100000023235 252
358 3300005718 Ga0068866_10000274 Ga0068866_100002747 252
359 3300005834 Ga0068851_10018801 Ga0068851_100188013 252
360 3300005842 Ga0068858_100000150 Ga0068858_10000015033 252
361 3300005842 Ga0068858_100000287 Ga0068858_10000028733 252
362 3300005843 Ga0068860_100033741 Ga0068860_1000337412 252
363 3300005937 Ga0081455_10165181 Ga0081455_101651812 252
364 3300006163 Ga0070715_10000003 Ga0070715_10000003261 252
365 3300006175 Ga0070712_100271821 Ga0070712_1002718212 252
366 3300006178 Ga0075367_10156081 Ga0075367_101560812 252
367 3300006852 Ga0075433_10004429 Ga0075433_1000442915 252
368 3300006852 Ga0075433_10036483 Ga0075433_100364833 252
369 3300006881 Ga0068865_100000024 Ga0068865_10000002494 252
370 3300009098 Ga0105245_10000022 Ga0105245_10000022167 252
371 3300009098 Ga0105245_10000528 Ga0105245_1000052824 252
372 3300009098 Ga0105245_10019614 Ga0105245_100196146 252
373 3300009101 Ga0105247_10000064 Ga0105247_10000064109 252
374 3300009147 Ga0114129_10593115 Ga0114129_105931152 252
375 3300009148 Ga0105243_10006175 Ga0105243_100061758 252
376 3300009176 Ga0105242_10000123 Ga0105242_1000012325 252
377 3300009176 Ga0105242_10083889 Ga0105242_100838893 252
378 3300009177 Ga0105248_10001735 Ga0105248_100017354 252
379 3300009177 Ga0105248_10328110 Ga0105248_103281102 252
380 3300009551 Ga0105238_10814416 Ga0105238_108144161 252
381 3300009553 Ga0105249_10000181 Ga0105249_1000018173 252
382 3300009553 Ga0105249_10231867 Ga0105249_102318672 252
383 3300009993 Ga0105028_106004 Ga0105028_1060041 252
384 3300013100 Ga0157373_10406142 Ga0157373_104061421 252
385 3300013102 Ga0157371_10000818 Ga0157371_1000081831 252
386 3300013104 Ga0157370_10457680 Ga0157370_104576802 252
387 3300013105 Ga0157369_10000068 Ga0157369_10000068132 252
388 3300013297 Ga0157378_10104189 Ga0157378_101041892 252
389 3300013307 Ga0157372_10000809 Ga0157372_1000080925 252
390 3300013308 Ga0157375_10000126 Ga0157375_1000012626 252
391 3300013308 Ga0157375_10016258 Ga0157375_100162586 252
392 3300014326 Ga0157380_10000326 Ga0157380_100003266 252
393 3300014326 Ga0157380_10006736 Ga0157380_100067362 252
394 3300014969 Ga0157376_10060903 Ga0157376_100609034 252
395 3300020082 Ga0206353_11043234 Ga0206353_110432341 252
396 3300022467 Ga0224712_10004702 Ga0224712_100047023 252
397 3300025321 Ga0207656_10000374 Ga0207656_1000037415 252
398 3300025893 Ga0207682_10000008 Ga0207682_100000084 252
399 3300025899 Ga0207642_10000290 Ga0207642_1000029023 252
400 3300025900 Ga0207710_10000220 Ga0207710_1000022051 252
401 3300025905 Ga0207685_10000003 Ga0207685_10000003258 252
402 3300025915 Ga0207693_10020224 Ga0207693_100202244 252
403 3300025920 Ga0207649_10000166 Ga0207649_1000016611 252
404 3300025924 Ga0207694_10000008 Ga0207694_1000000847 252
405 3300025926 Ga0207659_10000138 Ga0207659_1000013832 252
406 3300025927 Ga0207687_10000025 Ga0207687_1000002532 252
407 3300025927 Ga0207687_10000039 Ga0207687_1000003967 252
408 3300025927 Ga0207687_10000132 Ga0207687_1000013231 252
409 3300025927 Ga0207687_10002690 Ga0207687_1000269019 252
410 3300025928 Ga0207700_10000019 Ga0207700_10000019174 252
411 3300025929 Ga0207664_10013567 Ga0207664_100135677 252
412 3300025929 Ga0207664_10272253 Ga0207664_102722532 252
413 3300025929 Ga0207664_10590885 Ga0207664_105908851 252
414 3300025932 Ga0207690_10003914 Ga0207690_100039148 252
415 3300025933 Ga0207706_10000018 Ga0207706_10000018137 252
416 3300025934 Ga0207686_10000066 Ga0207686_1000006681 252
417 3300025935 Ga0207709_10002223 Ga0207709_100022238 252
418 3300025937 Ga0207669_10000002 Ga0207669_10000002377 252
419 3300025938 Ga0207704_10000308 Ga0207704_1000030813 252
420 3300025941 Ga0207711_10000011 Ga0207711_1000001145 252
421 3300025941 Ga0207711_10139056 Ga0207711_101390562 252
422 3300025944 Ga0207661_10000518 Ga0207661_1000051817 252
423 3300025944 Ga0207661_10000616 Ga0207661_1000061616 252
424 3300025944 Ga0207661_10001510 Ga0207661_1000151017 252
425 3300025944 Ga0207661_10009756 Ga0207661_100097563 252
426 3300025944 Ga0207661_10307093 Ga0207661_103070932 252
427 3300025945 Ga0207679_10006381 Ga0207679_100063812 252
428 3300025960 Ga0207651_10000746 Ga0207651_1000074623 252
429 3300025961 Ga0207712_10000067 Ga0207712_1000006773 252
430 3300025981 Ga0207640_10000821 Ga0207640_1000082113 252
431 3300025981 Ga0207640_10002941 Ga0207640_100029418 252
432 3300026023 Ga0207677_10000046 Ga0207677_1000004681 252
433 3300026035 Ga0207703_10000122 Ga0207703_1000012278 252
434 3300026041 Ga0207639_10017220 Ga0207639_100172201 252
435 3300026041 Ga0207639_10124457 Ga0207639_101244573 252
436 3300026067 Ga0207678_10134526 Ga0207678_101345263 252
437 3300026078 Ga0207702_10002042 Ga0207702_1000204211 252
438 3300026078 Ga0207702_10017871 Ga0207702_100178711 252
439 3300026078 Ga0207702_10164250 Ga0207702_101642502 252
440 3300026088 Ga0207641_10000065 Ga0207641_10000065106 252
441 3300026089 Ga0207648_10004057 Ga0207648_1000405711 252
442 3300026095 Ga0207676_10000025 Ga0207676_1000002546 252
443 3300026118 Ga0207675_100082600 Ga0207675_1000826003 252
444 3300026118 Ga0207675_100961112 Ga0207675_1009611121 252
445 3300026121 Ga0207683_10038808 Ga0207683_100388083 252
446 3300026142 Ga0207698_10000014 Ga0207698_1000001463 252
447 3300026142 Ga0207698_10032167 Ga0207698_100321672 252
448 3300028379 Ga0268266_10000029 Ga0268266_1000002971 252
449 3300028379 Ga0268266_10018264 Ga0268266_100182645 252
450 3300028379 Ga0268266_10055970 Ga0268266_100559704 252
451 3300028379 Ga0268266_10080327 Ga0268266_100803273 252
452 3300028381 Ga0268264_10039342 Ga0268264_100393422 252
453 3300028563 Ga0265319_1000030 Ga0265319_100003056 252
454 3300028800 Ga0265338_10000156 Ga0265338_1000015656 252
455 3300031241 Ga0265325_10010101 Ga0265325_100101017 252
456 3300031250 Ga0265331_10105172 Ga0265331_101051722 252
457 3300031995 Ga0307409_100767858 Ga0307409_1007678581 252
458 3300032126 Ga0307415_100002491 Ga0307415_1000024912 252
459 3300036401 Ga0373937_0038132 Ga0373937_0038132_2718_3476 252
460 3300037466 Ga0395898_0283873 Ga0395898_0283873_235_1002 252
461 3300037466 Ga0395898_0312125 Ga0395898_0312125_716_1486 252
462 3300038443 Ga0395901_0190287 Ga0395901_0190287_384_1154 252
463 3300038443 Ga0395901_0241075 Ga0395901_0241075_1046_1813 252
464 3300038443 Ga0395901_0483435 Ga0395901_0483435_119_886 252
465 3300041501 Ga0451845_0823628 Ga0451845_0823628_114_872 252
466 3300041512 Ga0451853_2591154 Ga0451853_2591154_2263_3021 252
467 3300044684 Ga0466966_0058483 Ga0466966_0058483_752_1531 252
468 3300044693 Ga0466961_0148442 Ga0466961_0148442_384_1193 252
469 3300044694 Ga0466963_0012957 Ga0466963_0012957_3863_4621 252
470 3300044694 Ga0466963_0023486 Ga0466963_0023486_445_1254 252
471 3300044694 Ga0466963_0193776 Ga0466963_0193776_501_1280 252
472 3300044694 Ga0466963_0202256 Ga0466963_0202256_579_1337 252
473 3300044719 Ga0466971_0033430 Ga0466971_0033430_220_999 252
474 3300044842 Ga0466957_0004792 Ga0466957_0004792_649_1407 252
475 3300044842 Ga0466957_0043709 Ga0466957_0043709_1620_2378 252
476 3300044842 Ga0466957_0150974 Ga0466957_0150974_703_1464 252
477 3300044842 Ga0466957_0328556 Ga0466957_0328556_240_1016 252
478 3300044901 Ga0466960_0000460 Ga0466960_0000460_10308_11075 252
479 3300044901 Ga0466960_0027690 Ga0466960_0027690_1292_2059 252
480 3300045049 Ga0466959_0009134 Ga0466959_0009134_3984_4793 252
481 3300045049 Ga0466959_0217491 Ga0466959_0217491_73_852 252
482 3300045836 Ga0466958_0076506 Ga0466958_0076506_28_804 252
483 3300045976 Ga0466967_0000003 Ga0466967_0000003_34482_35240 252
484 3300045976 Ga0466967_0034352 Ga0466967_0034352_279_1037 252
485 3300045976 Ga0466967_0339224 Ga0466967_0339224_213_986 252
486 3300045976 Ga0466967_0732095 Ga0466967_0732095_149_925 252
487 3300046454 Ga0495592_0001496 Ga0495592_0001496_2813_3571 252
488 3300046454 Ga0495592_0079775 Ga0495592_0079775_388_1146 252
489 3300046454 Ga0495592_0087018 Ga0495592_0087018_257_1015 252
490 3300046454 Ga0495592_0281832 Ga0495592_0281832_26_784 252
491 3300046455 Ga0495603_0000323 Ga0495603_0000323_4355_5113 252
492 3300046455 Ga0495603_0000484 Ga0495603_0000484_19684_20442 252
493 3300046459 Ga0495629_0000543 Ga0495629_0000543_17775_18533 252
494 3300046459 Ga0495629_0006510 Ga0495629_0006510_328_1086 252
495 3300046461 Ga0495641_0000400 Ga0495641_0000400_251_1009 252
496 3300046461 Ga0495641_0023186 Ga0495641_0023186_1319_2077 252
497 3300046461 Ga0495641_0057959 Ga0495641_0057959_876_1634 252
498 3300046462 Ga0495651_0050048 Ga0495651_0050048_1102_1863 252
499 3300046462 Ga0495651_0120977 Ga0495651_0120977_895_1653 252
500 3300046463 Ga0495653_0030114 Ga0495653_0030114_1870_2628 252
501 3300046463 Ga0495653_0120417 Ga0495653_0120417_694_1452 252
502 3300046471 Ga0495650_0000121 Ga0495650_0000121_96726_97493 252
503 3300046476 Ga0495662_0000236 Ga0495662_0000236_2803_3561 252
504 3300046476 Ga0495662_0004441 Ga0495662_0004441_3443_4201 252
505 3300046477 Ga0495664_0142988 Ga0495664_0142988_296_1057 252
506 3300046477 Ga0495664_0299108 Ga0495664_0299108_198_956 252
507 3300046499 Ga0495594_0000001 Ga0495594_0000001_37622_38380 252
508 3300046507 Ga0495606_0000283 Ga0495606_0000283_54028_54786 252
509 3300046511 Ga0495608_0000010 Ga0495608_0000010_247450_248208 252
510 3300046511 Ga0495608_0001727 Ga0495608_0001727_2752_3510 252
511 3300046511 Ga0495608_0043662 Ga0495608_0043662_427_1185 252
512 3300046515 Ga0495620_0000668 Ga0495620_0000668_50_811 252
513 3300046515 Ga0495620_0103173 Ga0495620_0103173_331_1089 252
514 3300046516 Ga0495628_0000864 Ga0495628_0000864_23539_24297 252
515 3300046516 Ga0495628_0076311 Ga0495628_0076311_1799_2557 252
516 3300046517 Ga0495630_0000148 Ga0495630_0000148_40519_41277 252
517 3300046523 Ga0495644_0003645 Ga0495644_0003645_351_1109 252
518 3300046529 Ga0495652_0198398 Ga0495652_0198398_628_1386 252
519 3300046533 Ga0495640_0009674 Ga0495640_0009674_6663_7421 252
520 3300046533 Ga0495640_0046086 Ga0495640_0046086_2117_2875 252
521 3300046537 Ga0495598_0049838 Ga0495598_0049838_423_1181 252
522 3300046543 Ga0495645_0004698 Ga0495645_0004698_2928_3695 252
523 3300046557 Ga0495622_0000069 Ga0495622_0000069_42101_42859 252
524 3300046558 Ga0495633_0080939 Ga0495633_0080939_153_911 252
525 3300046559 Ga0495667_0000067 Ga0495667_0000067_41376_42134 252
526 3300046559 Ga0495667_0010689 Ga0495667_0010689_1932_2690 252
527 3300046559 Ga0495667_0130209 Ga0495667_0130209_347_1105 252
528 3300046615 Ga0495656_0002090 Ga0495656_0002090_2817_3575 252
529 3300046642 Ga0495634_0000021 Ga0495634_0000021_94784_95542 252
530 3300046642 Ga0495634_0000993 Ga0495634_0000993_5105_5875 252
531 3300046663 Ga0495635_0100778 Ga0495635_0100778_23_781 252
532 3300046674 Ga0495588_0000175 Ga0495588_0000175_45771_46529 252
533 3300046675 Ga0495657_0000005 Ga0495657_0000005_6653_7411 252
534 3300046675 Ga0495657_0001760 Ga0495657_0001760_2823_3581 252
535 3300046678 Ga0495599_0013297 Ga0495599_0013297_1572_2339 252
536 3300046681 Ga0495647_0000114 Ga0495647_0000114_6823_7581 252
537 3300046681 Ga0495647_0006403 Ga0495647_0006403_2690_3448 252
538 3300046681 Ga0495647_0195749 Ga0495647_0195749_96_866 252
539 3300046683 Ga0495658_0006678 Ga0495658_0006678_3629_4387 252
540 3300046684 Ga0495669_0000189 Ga0495669_0000189_12252_13010 252
541 3300046689 Ga0495613_0000087 Ga0495613_0000087_83802_84560 252
542 3300046689 Ga0495613_0036945 Ga0495613_0036945_2771_3529 252
543 3300046690 Ga0495624_0000429 Ga0495624_0000429_12979_13737 252
544 3300046690 Ga0495624_0000767 Ga0495624_0000767_21729_22487 252
545 3300046691 Ga0495670_0009083 Ga0495670_0009083_1404_2162 252
546 3300046694 Ga0495649_0004973 Ga0495649_0004973_7711_8469 252
547 3300046809 Ga0495600_0019425 Ga0495600_0019425_2824_3585 252
548 3300046809 Ga0495600_0053148 Ga0495600_0053148_1681_2439 252
549 3300047315 Ga0495581_0119853 Ga0495581_0119853_337_1095 252
550 3300047317 Ga0495604_0000294 Ga0495604_0000294_10233_11003 252
551 3300047317 Ga0495604_0000322 Ga0495604_0000322_15871_16629 252
552 3300047317 Ga0495604_0128702 Ga0495604_0128702_580_1341 252
553 3300047319 Ga0495674_0000141 Ga0495674_0000141_18479_19237 252
554 3300047321 Ga0495676_0001315 Ga0495676_0001315_67_825 252
555 3300047321 Ga0495676_0249983 Ga0495676_0249983_402_1160 252
556 3300047322 Ga0495680_0001951 Ga0495680_0001951_57_815 252
557 3300047322 Ga0495680_0002419 Ga0495680_0002419_484_1242 252
558 3300047322 Ga0495680_0075724 Ga0495680_0075724_1397_2155 252
559 3300047322 Ga0495680_0227865 Ga0495680_0227865_290_1048 252
560 3300047444 Ga0495675_0000398 Ga0495675_0000398_2831_3589 252
561 3300047444 Ga0495675_0218491 Ga0495675_0218491_322_1080 252
562 3300047446 Ga0495679_066319 Ga0495679_066319_159_917 252
563 3300048088 Ga0495602_0000038 Ga0495602_0000038_25008_25769 252
564 3300048088 Ga0495602_0003702 Ga0495602_0003702_11522_12280 252
565 3300048088 Ga0495602_0037972 Ga0495602_0037972_806_1564 252
566 3300048088 Ga0495602_0053710 Ga0495602_0053710_2170_2928 252
567 3300048903 Ga0496100_0000004 Ga0496100_0000004_317437_318198 252
568 3300048904 Ga0496101_0000007 Ga0496101_0000007_317437_318198 252
569 3300048904 Ga0496101_0385239 Ga0496101_0385239_149_916 252
570 3300048905 Ga0496102_0000021 Ga0496102_0000021_169561_170319 252
571 3300048906 Ga0496103_0000001 Ga0496103_0000001_425588_426346 252
572 3300048907 Ga0496104_0000008 Ga0496104_0000008_479807_480565 252
573 3300048907 Ga0496104_0004081 Ga0496104_0004081_4350_5108 252
574 3300048907 Ga0496104_0037414 Ga0496104_0037414_2869_3627 252
575 3300048908 Ga0496105_0000002 Ga0496105_0000002_182389_183165 252
576 3300048908 Ga0496105_0000003 Ga0496105_0000003_479807_480565 252
577 3300048908 Ga0496105_0000070 Ga0496105_0000070_66280_67038 252
578 3300048908 Ga0496105_0071324 Ga0496105_0071324_1020_1781 252
579 3300048909 Ga0496106_0000004 Ga0496106_0000004_278851_279612 252
580 3300048910 Ga0496107_0000001 Ga0496107_0000001_317437_318198 252
581 3300048911 Ga0496108_0000004 Ga0496108_0000004_77232_77993 252
582 3300048911 Ga0496108_0000042 Ga0496108_0000042_114888_115646 252
583 3300048911 Ga0496108_0000339 Ga0496108_0000339_12237_12995 252
584 3300048911 Ga0496108_0002451 Ga0496108_0002451_6316_7074 252
585 3300048911 Ga0496108_0079573 Ga0496108_0079573_271_1029 252
586 3300048912 Ga0496109_0000034 Ga0496109_0000034_147527_148285 252
587 3300048912 Ga0496109_0000036 Ga0496109_0000036_75980_76741 252
588 3300048912 Ga0496109_0000062 Ga0496109_0000062_8881_9639 252
589 3300048912 Ga0496109_0000550 Ga0496109_0000550_21788_22546 252
590 3300048912 Ga0496109_0350753 Ga0496109_0350753_216_974 252
591 3300048913 Ga0496110_0000325 Ga0496110_0000325_15195_15953 252
592 3300048913 Ga0496110_0077462 Ga0496110_0077462_1472_2230 252
593 3300048913 Ga0496110_0139814 Ga0496110_0139814_52_810 252
594 3300048913 Ga0496110_0150938 Ga0496110_0150938_833_1591 252
595 3300048913 Ga0496110_0528878 Ga0496110_0528878_266_1024 252
596 3300048914 Ga0496111_0000171 Ga0496111_0000171_13654_14412 252
597 3300048914 Ga0496111_0010712 Ga0496111_0010712_2006_2764 252
598 3300048914 Ga0496111_0036271 Ga0496111_0036271_1064_1822 252
599 3300048914 Ga0496111_0150604 Ga0496111_0150604_889_1647 252
600 3300048914 Ga0496111_0419569 Ga0496111_0419569_127_885 252
601 3300048915 Ga0496112_0000002 Ga0496112_0000002_222314_223072 252
602 3300048915 Ga0496112_0017988 Ga0496112_0017988_4342_5103 252
603 3300048915 Ga0496112_0032041 Ga0496112_0032041_4047_4814 252
604 3300048915 Ga0496112_0034473 Ga0496112_0034473_934_1710 252
605 3300048916 Ga0496113_0000002 Ga0496113_0000002_23825_24586 252
606 3300048916 Ga0496113_0009761 Ga0496113_0009761_2369_3127 252
607 3300048916 Ga0496113_0087777 Ga0496113_0087777_148_906 252
608 3300048917 Ga0496114_0137030 Ga0496114_0137030_152_910 252
609 3300048917 Ga0496114_0151098 Ga0496114_0151098_379_1137 252
610 3300048922 Ga0496119_0014960 Ga0496119_0014960_620_1396 252
611 3300048922 Ga0496119_0041652 Ga0496119_0041652_566_1342 252
612 3300048923 Ga0496120_0104518 Ga0496120_0104518_274_1050 252
613 3300048924 Ga0496121_0010570 Ga0496121_0010570_4760_5527 252
614 3300048928 Ga0496125_0066986 Ga0496125_0066986_1993_2754 252
615 3300048929 Ga0496126_0016119 Ga0496126_0016119_2323_3081 252
616 3300049571 Ga0501034_0004487 Ga0501034_0004487_5792_6559 252
617 3300049581 Ga0501047_0060675 Ga0501047_0060675_1492_2274 252
618 3300049581 Ga0501047_0188097 Ga0501047_0188097_791_1549 252
619 3300049584 Ga0501068_0127195 Ga0501068_0127195_607_1365 252
620 3300049584 Ga0501068_0360953 Ga0501068_0360953_97_855 252
621 3300049585 Ga0501069_0001568 Ga0501069_0001568_482_1240 252
622 3300049586 Ga0501070_0064865 Ga0501070_0064865_879_1637 252
623 3300049586 Ga0501070_0249330 Ga0501070_0249330_382_1140 252
624 3300049587 Ga0501071_0212892 Ga0501071_0212892_102_860 252
625 3300049590 Ga0501074_0025643 Ga0501074_0025643_844_1602 252
626 3300049591 Ga0501075_0000876 Ga0501075_0000876_15503_16261 252
627 3300049593 Ga0501077_0394061 Ga0501077_0394061_65_823 252
628 3300049741 Ga0501079_0380657 Ga0501079_0380657_97_855 252
629 3300049744 Ga0501083_0043410 Ga0501083_0043410_1408_2166 252
630 3300049823 Ga0501044_0045201 Ga0501044_0045201_828_1586 252
631 3300050507 nmdc:mga05p37_366036_c1 nmdc:mga05p37_366036_c1_763_1521 252
632 3300050515 nmdc:mga0a205_15_c2 nmdc:mga0a205_15_c2_16317_17087 252
633 3300050515 nmdc:mga0a205_6812_c1 nmdc:mga0a205_6812_c1_1616_2374 252
634 3300053077 Ga0495601_0000698 Ga0495601_0000698_14448_15206 252
635 3300053077 Ga0495601_0003864 Ga0495601_0003864_58_816 252
636 3300053078 Ga0495612_0000820 Ga0495612_0000820_9910_10668 252
637 3300053078 Ga0495612_0001451 Ga0495612_0001451_6316_7074 252
638 3300053078 Ga0495612_0029568 Ga0495612_0029568_78_836 252
639 3300053078 Ga0495612_0106594 Ga0495612_0106594_67_825 252
640 3300053083 Ga0495655_0000120 Ga0495655_0000120_3640_4401 252
641 3300053084 Ga0495595_0000005 Ga0495595_0000005_10453_11211 252
642 3300053084 Ga0495595_0082519 Ga0495595_0082519_284_1042 252
643 3300053085 Ga0495619_0000036 Ga0495619_0000036_92899_93657 252
644 3300053085 Ga0495619_0000069 Ga0495619_0000069_61052_61810 252
645 3300053085 Ga0495619_0000489 Ga0495619_0000489_23009_23767 252
646 3300053085 Ga0495619_0005994 Ga0495619_0005994_167_925 252
647 3300053085 Ga0495619_0045797 Ga0495619_0045797_1200_1958 252
648 3300053094 Ga0500566_0013929 Ga0500566_0013929_766_1524 252
649 3300053123 Ga0500614_001602 Ga0500614_001602_239_997 252
650 3300053139 Ga0500568_0086558 Ga0500568_0086558_117_884 252
651 3300053153 Ga0500616_0006627 Ga0500616_0006627_6706_7473 252
652 3300054114 Ga0501084_0215435 Ga0501084_0215435_65_823 252
653 3300061719 Ga0466962_0020444 Ga0466962_0020444_2122_2901 252

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00557

Peptidase_M24

Metallopeptidase family M24

11

227

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3mr1-assembly2.cif.gz_B crystal structure of methionine aminopeptidase from rickettsia prowazekii 0.9864 1 246
1o0x-assembly1.cif.gz_A crystal structure of methionine aminopeptidase (tm1478) from thermotoga maritima at 1.90 a resolution 0.9851 1 246
3tav-assembly1.cif.gz_A crystal structure of a methionine aminopeptidase from mycobacterium abscessus 0.9834 2 246
4juq-assembly1.cif.gz_A pseudomonas aeruginosa metap t2n mutant, in mn form 0.9816 1 252
3tb5-assembly2.cif.gz_B crystal structure of the enterococcus faecalis methionine aminopeptidase apo form 0.9799 1 251
ID Description Score Start End Superfamily
af_Q6Z3V9_1_121_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9909 13 124 3.90.230.10
4juqD00 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9889 1 246 3.90.230.10
af_P9WK21_10_265_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9871 1 246 3.90.230.10
1o0xA00 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9851 1 246 3.90.230.10
af_Q9VKV9_33_317_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9803 1 246 3.90.230.10
ID Description Score Start End GO Terms
AF-A0A835FHY3-F1-model_v4 Peptidase M24 domain-containing protein 0.9983 32 110 GO:0009507
GO:0070006
AF-A0A7X7PQL7-F1-model_v4 Methionine aminopeptidase (MAP) (MetAP) (EC 3.4.11.18) (Peptidase M) 0.9977 1 246 GO:0004239
GO:0005829
GO:0006508
GO:0046872
GO:0070006
AF-A0A7C7DIY6-F1-model_v4 Methionine aminopeptidase (MAP) (MetAP) (EC 3.4.11.18) (Peptidase M) 0.9964 1 246 GO:0004239
GO:0005829
GO:0006508
GO:0046872
GO:0070006
AF-A0A7C3XA93-F1-model_v4 Methionine aminopeptidase (EC 3.4.11.18) 0.9953 1 195 GO:0004239
GO:0005829
GO:0006508
GO:0046872
GO:0070006
AF-H9GMZ4-F1-model_v4 Methionyl aminopeptidase type 1D, mitochondrial 0.9949 35 150

Feature Viewer

pLDDT pTM Quality
97.61 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map