F472736

General Info

Members Datasets Scaffolds Average Seq Length
653 313 1306 129

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10793027|Ga0070658_107930272
Length 154
Sequence MPTVRTRASASREEADPVQEFYSIGEVCSLTDLRPHVLRYWESQFRILNPAKNRSGNRVYARREVELVLLVKHLLYTEKYTIEGARQKLDAHRRGGELRTAARAALVAETIEHFERELRDVGEMLAGRAAPRLRGTTEADEEPLDSRPPDVPAT

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
66 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
95 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
158 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
159 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
160 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
161 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
162 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
163 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
164 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
165 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
166 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
167 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
168 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
169 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
170 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
171 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
172 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
173 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
174 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
175 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
176 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
177 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
178 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
179 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
180 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
181 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
182 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
183 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
184 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
185 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
186 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
187 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
188 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
189 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
190 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
191 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
192 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
193 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
194 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
195 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
196 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
197 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
198 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
199 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
200 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
201 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
202 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
203 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
204 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
205 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
206 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
207 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
208 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
209 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
210 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
211 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
212 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
213 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
214 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
215 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
216 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
217 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
218 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
219 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
220 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
221 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
222 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
223 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
224 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
225 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
226 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
227 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
228 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
229 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
230 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
231 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
232 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
233 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
234 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
235 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
236 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
237 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
238 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
239 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
240 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
241 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
242 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
243 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
244 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
245 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
246 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
247 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
248 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
249 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
250 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
251 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
252 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
253 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
260 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
261 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
262 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
263 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
264 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
265 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
266 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
267 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
268 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
269 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
270 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
271 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
272 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
273 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
274 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
275 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
276 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
277 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
278 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
279 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
280 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
281 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
282 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
283 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
284 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
285 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
286 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
287 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
288 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
289 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
290 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
291 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
292 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
293 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
294 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
295 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
296 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
297 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
298 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
299 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
300 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
301 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
302 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
303 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
304 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
305 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
306 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
307 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
308 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
309 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
310 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
311 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
312 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
313 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.76
Rhizosphere 97.09
Stem 0
Stem Tuber 0
Unclassified 5.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10793027 3300005327 Bacteria 823
2 JGI25406J46586_10145756 3300003203 Bacteria 691
3 rootL2_10163687 3300003322 Bacteria 1843
4 Ga0065715_10604432 3300005293 Bacteria 705
5 Ga0065707_10324499 3300005295 Bacteria 960
6 Ga0070658_10200521 3300005327 Bacteria 1683
7 Ga0070676_10001926 3300005328 Bacteria 10538
8 Ga0070690_100760644 3300005330 Unclassified 749
9 Ga0070670_100752016 3300005331 Bacteria 878
10 Ga0070677_10514782 3300005333 Bacteria 650
11 Ga0068869_100050894 3300005334 Bacteria 3004
12 Ga0070682_100095513 3300005337 Bacteria 1952
13 Ga0070682_100362971 3300005337 Unclassified 1084
14 Ga0070660_100288934 3300005339 Bacteria 1343
15 Ga0070660_101211320 3300005339 Bacteria 640
16 Ga0070687_100265328 3300005343 Unclassified 1074
17 Ga0070661_100453931 3300005344 Bacteria 1020
18 Ga0070661_101864374 3300005344 Bacteria 511
19 Ga0070668_100010255 3300005347 Bacteria 6953
20 Ga0070668_100567065 3300005347 Bacteria 990
21 Ga0070669_100262483 3300005353 Bacteria 1379
22 Ga0070669_100405137 3300005353 Bacteria 1117
23 Ga0070669_101494500 3300005353 Bacteria 587
24 Ga0070675_100112925 3300005354 Bacteria 2301
25 Ga0070675_101391199 3300005354 Bacteria 647
26 Ga0070671_100584872 3300005355 Bacteria 964
27 Ga0070674_100000378 3300005356 Bacteria 22336
28 Ga0070674_100502628 3300005356 Bacteria 1010
29 Ga0070673_100033447 3300005364 Bacteria 3883
30 Ga0070659_100486299 3300005366 Bacteria 1051
31 Ga0070667_101918162 3300005367 Archaea 558
32 Ga0070703_10002195 3300005406 Bacteria 5681
33 Ga0070703_10007122 3300005406 Bacteria 3139
34 Ga0070703_10037010 3300005406 Bacteria 1502
35 Ga0070703_10314565 3300005406 Bacteria 657
36 Ga0070709_10001217 3300005434 Bacteria 14132
37 Ga0070709_10018925 3300005434 Bacteria 3973
38 Ga0070709_10393620 3300005434 Bacteria 1033
39 Ga0070709_11355469 3300005434 Unclassified 575
40 Ga0070714_100389060 3300005435 Bacteria 1316
41 Ga0070713_100113358 3300005436 Bacteria 2367
42 Ga0070713_100534831 3300005436 Bacteria 1109
43 Ga0070710_10175789 3300005437 Bacteria 1337
44 Ga0070710_10874543 3300005437 Bacteria 647
45 Ga0070701_10516595 3300005438 Bacteria 778
46 Ga0070701_10979715 3300005438 Bacteria 588
47 Ga0070711_100000239 3300005439 Bacteria 28182
48 Ga0070711_100007712 3300005439 Bacteria 6554
49 Ga0070705_100002647 3300005440 Bacteria 8956
50 Ga0070705_100028862 3300005440 Bacteria 3044
51 Ga0070705_100225392 3300005440 Bacteria 1300
52 Ga0070700_100056332 3300005441 Bacteria 2464
53 Ga0070700_100279504 3300005441 Bacteria 1210
54 Ga0070694_100021499 3300005444 Bacteria 4124
55 Ga0070694_100065552 3300005444 Bacteria 2488
56 Ga0070694_100090828 3300005444 Bacteria 2142
57 Ga0070694_100101863 3300005444 Bacteria 2032
58 Ga0070694_101820730 3300005444 Bacteria 519
59 Ga0070708_100016285 3300005445 Bacteria 6164
60 Ga0070708_100066036 3300005445 Bacteria 3246
61 Ga0070708_100156312 3300005445 Bacteria 2123
62 Ga0070708_100171127 3300005445 Bacteria 2028
63 Ga0070708_100394684 3300005445 Bacteria 1305
64 Ga0070708_101360018 3300005445 Bacteria 663
65 Ga0070663_100117091 3300005455 Bacteria 2009
66 Ga0070663_100753113 3300005455 Bacteria 832
67 Ga0070678_100010489 3300005456 Bacteria 5666
68 Ga0070662_100051092 3300005457 Bacteria 2984
69 Ga0070662_100332962 3300005457 Bacteria 1240
70 Ga0070681_10104296 3300005458 Bacteria 2778
71 Ga0070681_10140437 3300005458 Bacteria 2346
72 Ga0070681_11117616 3300005458 Bacteria 709
73 Ga0070681_11900379 3300005458 Unclassified 523
74 Ga0068867_100001672 3300005459 Bacteria 15445
75 Ga0068867_100319521 3300005459 Bacteria 1286
76 Ga0070706_100100212 3300005467 Bacteria 2691
77 Ga0070706_100105980 3300005467 Bacteria 2615
78 Ga0070706_100147250 3300005467 Bacteria 2199
79 Ga0070706_100241260 3300005467 Bacteria 1688
80 Ga0070706_100829050 3300005467 Bacteria 856
81 Ga0070706_100971083 3300005467 Bacteria 784
82 Ga0070706_101589949 3300005467 Unclassified 596
83 Ga0070707_100018022 3300005468 Bacteria 6642
84 Ga0070707_100023066 3300005468 Bacteria 5888
85 Ga0070707_100023968 3300005468 Bacteria 5774
86 Ga0070707_100048346 3300005468 Bacteria 4075
87 Ga0070707_100051348 3300005468 Bacteria 3954
88 Ga0070707_100071620 3300005468 Bacteria 3339
89 Ga0070707_100109021 3300005468 Bacteria 2685
90 Ga0070707_101853330 3300005468 Bacteria 570
91 Ga0070698_100000037 3300005471 Bacteria 92307
92 Ga0070698_100088251 3300005471 Bacteria 3086
93 Ga0070698_100093544 3300005471 Bacteria 2986
94 Ga0070698_100355098 3300005471 Bacteria 1397
95 Ga0070698_100742262 3300005471 Bacteria 925
96 Ga0070699_100019554 3300005518 Bacteria 5834
97 Ga0070699_100052119 3300005518 Bacteria 3542
98 Ga0070699_100175890 3300005518 Bacteria 1898
99 Ga0070699_100290171 3300005518 Bacteria 1467
100 Ga0070699_100314188 3300005518 Bacteria 1407
101 Ga0070699_100568310 3300005518 Bacteria 1033
102 Ga0070699_100929130 3300005518 Bacteria 797
103 Ga0070684_100859682 3300005535 Bacteria 849
104 Ga0070684_100948302 3300005535 Bacteria 807
105 Ga0070684_101027185 3300005535 Bacteria 774
106 Ga0070697_100013672 3300005536 Bacteria 6369
107 Ga0070697_100015734 3300005536 Bacteria 5940
108 Ga0070697_100051645 3300005536 Bacteria 3340
109 Ga0070697_100125275 3300005536 Bacteria 2152
110 Ga0070697_100259515 3300005536 Bacteria 1487
111 Ga0070697_100632342 3300005536 Bacteria 942
112 Ga0070697_101187855 3300005536 Bacteria 680
113 Ga0070697_101386299 3300005536 Bacteria 628
114 Ga0070672_100227569 3300005543 Bacteria 1566
115 Ga0070686_100377075 3300005544 Bacteria 1073
116 Ga0070695_100002535 3300005545 Bacteria 10547
117 Ga0070695_100033544 3300005545 Bacteria 3213
118 Ga0070695_100041833 3300005545 Bacteria 2906
119 Ga0070695_100053123 3300005545 Bacteria 2605
120 Ga0070696_100012183 3300005546 Bacteria 5762
121 Ga0070696_100101292 3300005546 Bacteria 2064
122 Ga0070696_100114902 3300005546 Bacteria 1942
123 Ga0070696_100163225 3300005546 Bacteria 1643
124 Ga0070696_101004742 3300005546 Unclassified 697
125 Ga0070693_100064398 3300005547 Bacteria 2140
126 Ga0070665_101827498 3300005548 Bacteria 614
127 Ga0070704_100005461 3300005549 Bacteria 7405
128 Ga0070704_100049304 3300005549 Bacteria 2953
129 Ga0070704_100061295 3300005549 Bacteria 2692
130 Ga0070704_100160502 3300005549 Bacteria 1777
131 Ga0070704_100179537 3300005549 Bacteria 1692
132 Ga0068855_100688458 3300005563 Bacteria 1095
133 Ga0070664_100893872 3300005564 Unclassified 833
134 Ga0070664_100919080 3300005564 Bacteria 821
135 Ga0068857_100009128 3300005577 Bacteria 8605
136 Ga0068854_100008522 3300005578 Bacteria 6597
137 Ga0068854_100776712 3300005578 Bacteria 833
138 Ga0068854_101931471 3300005578 Bacteria 543
139 Ga0070702_100001397 3300005615 Bacteria 9867
140 Ga0070702_100751413 3300005615 Unclassified 749
141 Ga0068852_100763766 3300005616 Bacteria 979
142 Ga0068864_100000396 3300005618 Bacteria 37849
143 Ga0068866_10000401 3300005718 Bacteria 20182
144 Ga0068866_10206322 3300005718 Unclassified 1177
145 Ga0068866_10379430 3300005718 Bacteria 906
146 Ga0068861_100035865 3300005719 Bacteria 3677
147 Ga0068861_100782930 3300005719 Bacteria 894
148 Ga0068861_100801166 3300005719 Bacteria 884
149 Ga0068870_10393123 3300005840 Bacteria 900
150 Ga0068863_100168747 3300005841 Bacteria 2099
151 Ga0068858_100014878 3300005842 Bacteria 7319
152 Ga0068860_100553206 3300005843 Bacteria 1153
153 Ga0068860_101159554 3300005843 Bacteria 793
154 Ga0081455_10940938 3300005937 Unclassified 536
155 Ga0081539_10072556 3300005985 Bacteria 1839
156 Ga0070717_10140053 3300006028 Bacteria 2086
157 Ga0070717_10444356 3300006028 Bacteria 1168
158 Ga0070717_10445187 3300006028 Bacteria 1167
159 Ga0070715_10684052 3300006163 Bacteria 611
160 Ga0070716_100004394 3300006173 Bacteria 6738
161 Ga0070716_100142125 3300006173 Bacteria 1532
162 Ga0070716_100719062 3300006173 Bacteria 765
163 Ga0070712_100145615 3300006175 Bacteria 1813
164 Ga0070712_100257173 3300006175 Bacteria 1398
165 Ga0070712_101215198 3300006175 Bacteria 656
166 Ga0097621_100083421 3300006237 Bacteria 2663
167 Ga0097621_101715348 3300006237 Bacteria 598
168 Ga0068871_100056495 3300006358 Bacteria 3191
169 Ga0075428_100016140 3300006844 Bacteria 8255
170 Ga0075428_100297114 3300006844 Bacteria 1737
171 Ga0075428_100339399 3300006844 Bacteria 1613
172 Ga0075428_100692084 3300006844 Bacteria 1086
173 Ga0075430_100249135 3300006846 Bacteria 1472
174 Ga0075430_100449111 3300006846 Bacteria 1064
175 Ga0075431_100019714 3300006847 Bacteria 6883
176 Ga0075431_100044571 3300006847 Bacteria 4575
177 Ga0075431_100210089 3300006847 Bacteria 1988
178 Ga0075431_100216448 3300006847 Bacteria 1955
179 Ga0075431_100242215 3300006847 Bacteria 1834
180 Ga0075431_100850544 3300006847 Bacteria 883
181 Ga0075433_10021691 3300006852 Bacteria 5387
182 Ga0075433_10209853 3300006852 Bacteria 1731
183 Ga0075433_10288202 3300006852 Bacteria 1454
184 Ga0075433_10429476 3300006852 Bacteria 1165
185 Ga0075434_100002527 3300006871 Bacteria 16141
186 Ga0075434_100003715 3300006871 Bacteria 13630
187 Ga0075434_100018158 3300006871 Bacteria 6789
188 Ga0075434_100055478 3300006871 Bacteria 3937
189 Ga0075434_100269706 3300006871 Bacteria 1721
190 Ga0075429_100041578 3300006880 Bacteria 4003
191 Ga0068865_100011523 3300006881 Bacteria 5540
192 Ga0075436_100005906 3300006914 Bacteria 8410
193 Ga0075436_100031336 3300006914 Bacteria 3661
194 Ga0075436_100076036 3300006914 Unclassified 2325
195 Ga0075436_100110759 3300006914 Bacteria 1916
196 Ga0075436_100111996 3300006914 Bacteria 1905
197 Ga0075436_100246078 3300006914 Bacteria 1272
198 Ga0075435_100032513 3300007076 Bacteria 4120
199 Ga0075435_100550731 3300007076 Bacteria 999
200 Ga0099794_10211515 3300007265 Bacteria 995
201 Ga0099794_10321373 3300007265 Bacteria 803
202 Ga0099794_10356461 3300007265 Bacteria 761
203 Ga0105240_10134820 3300009093 Bacteria 2958
204 Ga0105240_10139041 3300009093 Bacteria 2905
205 Ga0111539_10092205 3300009094 Bacteria 3560
206 Ga0111539_10243912 3300009094 Bacteria 2092
207 Ga0105245_10045195 3300009098 Bacteria 3932
208 Ga0105245_10844759 3300009098 Unclassified 955
209 Ga0105245_11033997 3300009098 Bacteria 866
210 Ga0105245_11943589 3300009098 Bacteria 642
211 Ga0105245_12804450 3300009098 Bacteria 540
212 Ga0114129_10098954 3300009147 Bacteria 4037
213 Ga0114129_10109415 3300009147 Bacteria 3815
214 Ga0114129_10335660 3300009147 Bacteria 2006
215 Ga0114129_10722906 3300009147 Bacteria 1278
216 Ga0114129_10833866 3300009147 Bacteria 1173
217 Ga0114129_11694071 3300009147 Bacteria 772
218 Ga0114129_13492309 3300009147 Bacteria 503
219 Ga0105243_10002610 3300009148 Bacteria 15026
220 Ga0105242_10001397 3300009176 Bacteria 19028
221 Ga0105242_10235288 3300009176 Bacteria 1644
222 Ga0105248_10000658 3300009177 Bacteria 39283
223 Ga0105248_10045262 3300009177 Bacteria 4935
224 Ga0105248_10124698 3300009177 Bacteria 2905
225 Ga0105248_10302518 3300009177 Bacteria 1801
226 Ga0105238_11970412 3300009551 Unclassified 617
227 Ga0105249_10018112 3300009553 Bacteria 6260
228 Ga0105249_10045179 3300009553 Bacteria 4006
229 Ga0105249_10363726 3300009553 Bacteria 1469
230 Ga0105249_13261997 3300009553 Bacteria 522
231 Ga0105239_10004859 3300010375 Bacteria 15900
232 Ga0105239_11171465 3300010375 Bacteria 885
233 Ga0105239_11409516 3300010375 Bacteria 804
234 Ga0105246_10044479 3300011119 Bacteria 3018
235 Ga0157373_10011153 3300013100 Bacteria 6614
236 Ga0157373_10439135 3300013100 Bacteria 938
237 Ga0157371_10134444 3300013102 Bacteria 1761
238 Ga0157370_10097794 3300013104 Bacteria 2753
239 Ga0157378_10002774 3300013297 Bacteria 15611
240 Ga0163162_10010076 3300013306 Bacteria 9187
241 Ga0163162_12168377 3300013306 Unclassified 638
242 Ga0157372_10026323 3300013307 Bacteria 6329
243 Ga0157372_10313932 3300013307 Bacteria 1825
244 Ga0157372_12982941 3300013307 Unclassified 541
245 Ga0157372_13260754 3300013307 Bacteria 517
246 Ga0157372_13372266 3300013307 Unclassified 508
247 Ga0157375_10102888 3300013308 Bacteria 2942
248 Ga0157375_10141916 3300013308 Bacteria 2530
249 Ga0157375_10395543 3300013308 Bacteria 1549
250 Ga0157375_10503538 3300013308 Bacteria 1375
251 Ga0157375_11800852 3300013308 Bacteria 726
252 Ga0163163_10633560 3300014325 Bacteria 1133
253 Ga0157380_10017279 3300014326 Bacteria 5337
254 Ga0182008_10276769 3300014497 Bacteria 872
255 Ga0157379_10008817 3300014968 Bacteria 8796
256 Ga0157379_10994525 3300014968 Bacteria 799
257 Ga0157379_11529687 3300014968 Bacteria 650
258 Ga0157376_10154753 3300014969 Bacteria 2071
259 Ga0157376_10315650 3300014969 Bacteria 1484
260 Ga0157376_10513831 3300014969 Bacteria 1179
261 Ga0163161_10278734 3300017792 Bacteria 1311
262 Ga0207653_10010980 3300025885 Bacteria 2827
263 Ga0207653_10102367 3300025885 Bacteria 1014
264 Ga0207682_10133141 3300025893 Bacteria 1111
265 Ga0207682_10260162 3300025893 Bacteria 809
266 Ga0207692_10732872 3300025898 Unclassified 643
267 Ga0207642_10000600 3300025899 Bacteria 11072
268 Ga0207642_10084299 3300025899 Unclassified 1552
269 Ga0207642_11088962 3300025899 Bacteria 516
270 Ga0207645_10000145 3300025907 Bacteria 55543
271 Ga0207645_10312898 3300025907 Bacteria 1047
272 Ga0207643_10007892 3300025908 Bacteria 5710
273 Ga0207705_10880011 3300025909 Bacteria 694
274 Ga0207684_10000781 3300025910 Bacteria 36974
275 Ga0207684_10018361 3300025910 Bacteria 5987
276 Ga0207684_10128392 3300025910 Bacteria 2176
277 Ga0207684_10195617 3300025910 Bacteria 1744
278 Ga0207684_10813433 3300025910 Bacteria 789
279 Ga0207707_10236112 3300025912 Bacteria 1590
280 Ga0207695_10007320 3300025913 Bacteria 14094
281 Ga0207695_10246308 3300025913 Bacteria 1687
282 Ga0207693_10237158 3300025915 Bacteria 1432
283 Ga0207693_10360152 3300025915 Bacteria 1138
284 Ga0207663_10000256 3300025916 Bacteria 23155
285 Ga0207660_10164184 3300025917 Bacteria 1715
286 Ga0207657_10482811 3300025919 Unclassified 971
287 Ga0207657_11419341 3300025919 Bacteria 521
288 Ga0207652_10530348 3300025921 Bacteria 1059
289 Ga0207646_10001100 3300025922 Bacteria 34422
290 Ga0207646_10010434 3300025922 Bacteria 9082
291 Ga0207646_10060180 3300025922 Bacteria 3392
292 Ga0207646_10120623 3300025922 Bacteria 2355
293 Ga0207646_10182352 3300025922 Bacteria 1896
294 Ga0207646_11145723 3300025922 Bacteria 683
295 Ga0207681_10013785 3300025923 Bacteria 5007
296 Ga0207681_11421767 3300025923 Bacteria 582
297 Ga0207659_10121710 3300025926 Bacteria 2000
298 Ga0207687_10045351 3300025927 Bacteria 3038
299 Ga0207687_10464023 3300025927 Bacteria 1052
300 Ga0207700_10090497 3300025928 Bacteria 2415
301 Ga0207700_10112692 3300025928 Bacteria 2192
302 Ga0207644_10536877 3300025931 Bacteria 967
303 Ga0207644_10872406 3300025931 Bacteria 754
304 Ga0207690_10166335 3300025932 Bacteria 1648
305 Ga0207690_11410945 3300025932 Bacteria 582
306 Ga0207706_10000146 3300025933 Bacteria 76821
307 Ga0207706_10049239 3300025933 Bacteria 3725
308 Ga0207686_10002394 3300025934 Bacteria 10234
309 Ga0207709_10001445 3300025935 Bacteria 16588
310 Ga0207669_10001017 3300025937 Bacteria 11970
311 Ga0207669_10144725 3300025937 Bacteria 1656
312 Ga0207669_10497991 3300025937 Bacteria 974
313 Ga0207704_10009204 3300025938 Bacteria 4755
314 Ga0207704_10740032 3300025938 Bacteria 817
315 Ga0207665_10003606 3300025939 Bacteria 10340
316 Ga0207665_10615494 3300025939 Bacteria 849
317 Ga0207691_10098418 3300025940 Bacteria 2613
318 Ga0207711_10015225 3300025941 Bacteria 6385
319 Ga0207711_10109668 3300025941 Bacteria 2453
320 Ga0207711_10367069 3300025941 Bacteria 1334
321 Ga0207689_10091551 3300025942 Bacteria 2498
322 Ga0207661_10323620 3300025944 Bacteria 1387
323 Ga0207667_10866794 3300025949 Bacteria 896
324 Ga0207651_10046086 3300025960 Bacteria 2929
325 Ga0207712_10002961 3300025961 Bacteria 10839
326 Ga0207712_10018227 3300025961 Bacteria 4569
327 Ga0207712_10478335 3300025961 Bacteria 1061
328 Ga0207712_10881959 3300025961 Unclassified 790
329 Ga0207668_10018117 3300025972 Bacteria 4425
330 Ga0207668_10140298 3300025972 Bacteria 1857
331 Ga0207640_10016781 3300025981 Bacteria 4268
332 Ga0207640_11277918 3300025981 Bacteria 655
333 Ga0207658_10442960 3300025986 Bacteria 1149
334 Ga0207678_10140084 3300026067 Bacteria 2064
335 Ga0207708_10021560 3300026075 Bacteria 4859
336 Ga0207702_10368805 3300026078 Bacteria 1378
337 Ga0207648_10001390 3300026089 Bacteria 26643
338 Ga0207648_10195238 3300026089 Bacteria 1795
339 Ga0207676_10002613 3300026095 Bacteria 12841
340 Ga0207674_10024439 3300026116 Bacteria 6457
341 Ga0207675_100048912 3300026118 Bacteria 3947
342 Ga0207675_100342145 3300026118 Bacteria 1464
343 Ga0207675_100407878 3300026118 Bacteria 1340
344 Ga0207683_10005089 3300026121 Bacteria 11283
345 Ga0209588_1000481 3300027671 Bacteria 10236
346 Ga0209588_1082418 3300027671 Bacteria 1039
347 Ga0209974_10290135 3300027876 Bacteria 624
348 Ga0268265_10086766 3300028380 Bacteria 2488
349 Ga0268265_11369295 3300028380 Bacteria 709
350 Ga0268264_10657904 3300028381 Bacteria 1037
351 Ga0307408_100004762 3300031548 Bacteria 9148
352 Ga0307408_100011114 3300031548 Bacteria 5948
353 Ga0307408_100017983 3300031548 Bacteria 4741
354 Ga0307408_100029054 3300031548 Bacteria 3827
355 Ga0307408_100150000 3300031548 Bacteria 1839
356 Ga0307408_100449435 3300031548 Bacteria 1117
357 Ga0307408_101019495 3300031548 Bacteria 764
358 Ga0307405_10039351 3300031731 Bacteria 2857
359 Ga0307405_10054341 3300031731 Bacteria 2500
360 Ga0307405_10074660 3300031731 Bacteria 2193
361 Ga0307405_10122430 3300031731 Bacteria 1782
362 Ga0307405_10431693 3300031731 Bacteria 1039
363 Ga0307413_10002235 3300031824 Bacteria 7805
364 Ga0307413_10058357 3300031824 Bacteria 2365
365 Ga0307413_10066721 3300031824 Bacteria 2246
366 Ga0307413_10122940 3300031824 Unclassified 1761
367 Ga0307410_10002605 3300031852 Bacteria 8771
368 Ga0307410_10008516 3300031852 Bacteria 5692
369 Ga0307410_10010055 3300031852 Bacteria 5341
370 Ga0307410_10018355 3300031852 Bacteria 4227
371 Ga0307410_10023153 3300031852 Bacteria 3855
372 Ga0307410_10024422 3300031852 Bacteria 3775
373 Ga0307410_10032478 3300031852 Bacteria 3360
374 Ga0307410_10516044 3300031852 Bacteria 985
375 Ga0307406_10015327 3300031901 Bacteria 4433
376 Ga0307406_10021817 3300031901 Bacteria 3793
377 Ga0307406_10025363 3300031901 Bacteria 3549
378 Ga0307406_10039984 3300031901 Bacteria 2913
379 Ga0307406_10167252 3300031901 Bacteria 1587
380 Ga0307406_10232586 3300031901 Bacteria 1377
381 Ga0307407_10006601 3300031903 Bacteria 5178
382 Ga0307407_10016027 3300031903 Bacteria 3722
383 Ga0307407_10018926 3300031903 Bacteria 3496
384 Ga0307407_10068379 3300031903 Bacteria 2103
385 Ga0307407_10077467 3300031903 Bacteria 2000
386 Ga0307407_10462230 3300031903 Unclassified 923
387 Ga0307407_11074951 3300031903 Bacteria 624
388 Ga0307412_10038147 3300031911 Bacteria 3092
389 Ga0307412_10114740 3300031911 Bacteria 1929
390 Ga0307412_10221564 3300031911 Bacteria 1450
391 Ga0307412_10894446 3300031911 Bacteria 778
392 Ga0307409_100000308 3300031995 Bacteria 19988
393 Ga0307409_100002174 3300031995 Bacteria 10114
394 Ga0307409_100010633 3300031995 Bacteria 5739
395 Ga0307409_100039948 3300031995 Bacteria 3487
396 Ga0307409_100041252 3300031995 Bacteria 3445
397 Ga0307409_100097319 3300031995 Bacteria 2430
398 Ga0307409_100271574 3300031995 Bacteria 1562
399 Ga0307409_100437432 3300031995 Bacteria 1259
400 Ga0307409_101014129 3300031995 Bacteria 848
401 Ga0307416_100001186 3300032002 Bacteria 13997
402 Ga0307416_100002892 3300032002 Bacteria 10004
403 Ga0307416_100005003 3300032002 Bacteria 8081
404 Ga0307416_100012945 3300032002 Bacteria 5647
405 Ga0307416_100128498 3300032002 Bacteria 2275
406 Ga0307416_100218658 3300032002 Bacteria 1825
407 Ga0307416_100335110 3300032002 Bacteria 1522
408 Ga0307416_100370800 3300032002 Bacteria 1457
409 Ga0307416_100917937 3300032002 Bacteria 976
410 Ga0307416_101664233 3300032002 Unclassified 743
411 Ga0307414_10007376 3300032004 Bacteria 6179
412 Ga0307414_10018252 3300032004 Bacteria 4313
413 Ga0307414_10020050 3300032004 Bacteria 4157
414 Ga0307414_10029042 3300032004 Bacteria 3595
415 Ga0307414_10038035 3300032004 Bacteria 3227
416 Ga0307414_10068365 3300032004 Bacteria 2549
417 Ga0307414_10262942 3300032004 Bacteria 1441
418 Ga0307414_10544554 3300032004 Bacteria 1033
419 Ga0307411_10007316 3300032005 Bacteria 5609
420 Ga0307411_10021429 3300032005 Bacteria 3782
421 Ga0307411_10037531 3300032005 Bacteria 3047
422 Ga0307411_10043332 3300032005 Bacteria 2878
423 Ga0307411_10060118 3300032005 Bacteria 2522
424 Ga0307411_10073449 3300032005 Bacteria 2327
425 Ga0307411_10221136 3300032005 Bacteria 1469
426 Ga0307411_10540825 3300032005 Bacteria 992
427 Ga0307411_10540882 3300032005 Bacteria 992
428 Ga0307415_100000203 3300032126 Bacteria 26255
429 Ga0307415_100001513 3300032126 Bacteria 11158
430 Ga0307415_100002691 3300032126 Bacteria 8876
431 Ga0307415_100024157 3300032126 Bacteria 3789
432 Ga0307415_100113984 3300032126 Bacteria 2011
433 Ga0307415_100180126 3300032126 Bacteria 1657
434 Ga0307415_100331890 3300032126 Bacteria 1273
435 Ga0307415_100343075 3300032126 Bacteria 1254
436 Ga0373959_0194587 3300034820 Bacteria 533
437 Ga0373934_0000216 3300035086 Bacteria 21032
438 Ga0373923_0002487 3300035111 Bacteria 5689
439 Ga0373936_0038548 3300035113 Bacteria 1911
440 Ga0373954_0155934 3300035118 Bacteria 1116
441 Ga0373956_0000127 3300035119 Bacteria 26808
442 Ga0373957_0057748 3300035120 Bacteria 1497
443 Ga0373960_0133512 3300035121 Unclassified 835
444 Ga0373955_0000777 3300035172 Bacteria 13686
445 Ga0316574_0149959 3300035398 Bacteria 1503
446 Ga0373924_0017754 3300035410 Bacteria 2734
447 Ga0373931_0119880 3300035691 Bacteria 1503
448 Ga0373935_0734418 3300035692 Bacteria 727
449 Ga0373933_0005312 3300035724 Bacteria 7019
450 Ga0373937_0000195 3300036401 Bacteria 59262
451 Ga0373937_0847827 3300036401 Bacteria 862
452 Ga0395901_1198567 3300038443 Bacteria 725
453 Ga0395901_1882353 3300038443 Bacteria 546
454 Ga0242420_007720 3300038996 Bacteria 1732
455 Ga0439447_117110 3300041407 Bacteria 611
456 Ga0439457_051423 3300042014 Bacteria 925
457 Ga0450914_040608 3300042118 Bacteria 589
458 Ga0450923_037850 3300042125 Bacteria 1005
459 Ga0450894_023986 3300042131 Bacteria 831
460 Ga0450898_010361 3300042134 Bacteria 1507
461 Ga0439434_0167615 3300042435 Bacteria 732
462 Ga0439444_0010638 3300042437 Bacteria 1473
463 Ga0451577_0031234 3300042876 Bacteria 4808
464 Ga0451577_0733947 3300042876 Unclassified 894
465 Ga0453683_0040950 3300044673 Bacteria 2909
466 Ga0453683_0056185 3300044673 Bacteria 2463
467 Ga0453683_0075053 3300044673 Bacteria 2117
468 Ga0453683_0327185 3300044673 Bacteria 983
469 Ga0466963_0781117 3300044694 Bacteria 674
470 Ga0466964_0091732 3300044706 Bacteria 1323
471 Ga0466957_0663714 3300044842 Bacteria 734
472 Ga0466959_0406472 3300045049 Unclassified 925
473 Ga0451576_0025189 3300045051 Bacteria 6413
474 Ga0451576_0135615 3300045051 Bacteria 2566
475 Ga0451576_0794135 3300045051 Bacteria 994
476 Ga0451576_1746582 3300045051 Bacteria 644
477 Ga0495592_0001514 3300046454 Bacteria 16195
478 Ga0495603_0074871 3300046455 Bacteria 1988
479 Ga0495629_0016005 3300046459 Bacteria 5391
480 Ga0495651_0000050 3300046462 Bacteria 87816
481 Ga0495653_0000134 3300046463 Bacteria 61770
482 Ga0495582_0794280 3300046473 Unclassified 548
483 Ga0495639_0111938 3300046475 Bacteria 1296
484 Ga0495594_0020281 3300046499 Bacteria 3540
485 Ga0495608_0000381 3300046511 Bacteria 30883
486 Ga0495618_0103033 3300046514 Bacteria 1827
487 Ga0495628_0001309 3300046516 Bacteria 22847
488 Ga0495630_0005719 3300046517 Bacteria 8789
489 Ga0495663_0062529 3300046525 Bacteria 1173
490 Ga0495666_0389443 3300046526 Bacteria 627
491 Ga0495652_0000931 3300046529 Bacteria 33631
492 Ga0495665_0246976 3300046531 Bacteria 919
493 Ga0495586_0527257 3300046535 Bacteria 682
494 Ga0495586_0533446 3300046535 Bacteria 677
495 Ga0495587_0000114 3300046536 Bacteria 61671
496 Ga0495598_0331430 3300046537 Bacteria 582
497 Ga0495645_0000065 3300046543 Bacteria 73256
498 Ga0495645_0309920 3300046543 Bacteria 1028
499 Ga0495622_0188763 3300046557 Bacteria 922
500 Ga0495667_0000316 3300046559 Bacteria 30681
501 Ga0495634_0184587 3300046642 Bacteria 1304
502 Ga0495611_0251082 3300046648 Bacteria 820
503 Ga0495635_0000103 3300046663 Bacteria 50496
504 Ga0495657_0000606 3300046675 Bacteria 32796
505 Ga0495599_0000189 3300046678 Bacteria 40669
506 Ga0495623_0000086 3300046679 Bacteria 55086
507 Ga0495646_0000522 3300046680 Bacteria 20560
508 Ga0495613_0045542 3300046689 Unclassified 3244
509 Ga0495613_0605398 3300046689 Unclassified 729
510 Ga0495600_0000145 3300046809 Bacteria 40582
511 Ga0495604_0001195 3300047317 Bacteria 21435
512 Ga0495636_0016755 3300047318 Bacteria 2930
513 Ga0495674_0000339 3300047319 Bacteria 41326
514 Ga0495674_0434626 3300047319 Bacteria 1056
515 Ga0495675_0003609 3300047444 Bacteria 9329
516 Ga0495684_0000141 3300047471 Bacteria 53032
517 Ga0495593_0208553 3300047673 Bacteria 981
518 Ga0495602_0003470 3300048088 Bacteria 16312
519 Ga0496100_0461076 3300048903 Bacteria 975
520 Ga0496101_0679261 3300048904 Unclassified 813
521 Ga0496102_0012149 3300048905 Bacteria 7443
522 Ga0496102_0139858 3300048905 Bacteria 2270
523 Ga0496106_0094860 3300048909 Bacteria 2307
524 Ga0496106_0892106 3300048909 Unclassified 702
525 Ga0496106_1230861 3300048909 Unclassified 583
526 Ga0496107_0806595 3300048910 Bacteria 687
527 Ga0496108_0014418 3300048911 Bacteria 6454
528 Ga0496108_0191676 3300048911 Bacteria 1772
529 Ga0496109_0043387 3300048912 Bacteria 4076
530 Ga0496109_0253010 3300048912 Bacteria 1659
531 Ga0496109_0483733 3300048912 Bacteria 1169
532 Ga0496110_1136465 3300048913 Unclassified 689
533 Ga0496111_0005733 3300048914 Bacteria 8009
534 Ga0496112_0024531 3300048915 Bacteria 5776
535 Ga0496113_0114414 3300048916 Bacteria 2103
536 Ga0496114_0100688 3300048917 Bacteria 2466
537 Ga0501292_017167 3300049515 Bacteria 1143
538 Ga0501298_001135 3300049521 Bacteria 3847
539 Ga0501036_0306114 3300049572 Bacteria 1329
540 Ga0501039_0327426 3300049575 Bacteria 1204
541 Ga0501040_0039277 3300049576 Bacteria 3219
542 Ga0501040_0202547 3300049576 Bacteria 1409
543 Ga0501040_0210907 3300049576 Bacteria 1381
544 Ga0501040_1394112 3300049576 Bacteria 509
545 Ga0501041_0211245 3300049577 Bacteria 1217
546 Ga0501041_0225175 3300049577 Bacteria 1177
547 Ga0501042_0039868 3300049578 Bacteria 3339
548 Ga0501048_0401870 3300049582 Bacteria 979
549 Ga0501067_0142408 3300049583 Bacteria 1335
550 Ga0501067_0432539 3300049583 Bacteria 735
551 Ga0501068_0483215 3300049584 Unclassified 803
552 Ga0501069_0081213 3300049585 Bacteria 1826
553 Ga0501069_0144646 3300049585 Bacteria 1365
554 Ga0501069_0328912 3300049585 Bacteria 899
555 Ga0501074_0148874 3300049590 Bacteria 1674
556 Ga0501075_0012654 3300049591 Bacteria 6001
557 Ga0501075_0423500 3300049591 Bacteria 1015
558 Ga0501076_0006362 3300049592 Bacteria 8563
559 Ga0501076_0054307 3300049592 Bacteria 3175
560 Ga0501076_0100900 3300049592 Bacteria 2326
561 Ga0501076_0542646 3300049592 Bacteria 959
562 Ga0501076_1181383 3300049592 Bacteria 630
563 Ga0501077_0049965 3300049593 Bacteria 2658
564 Ga0501077_0068151 3300049593 Bacteria 2256
565 Ga0501202_044021 3300049652 Bacteria 972
566 Ga0501209_104200 3300049656 Bacteria 834
567 Ga0501211_012261 3300049658 Bacteria 847
568 Ga0501217_016584 3300049661 Bacteria 1690
569 Ga0501239_001326 3300049672 Bacteria 2105
570 Ga0501247_002620 3300049677 Bacteria 1881
571 Ga0501249_004401 3300049679 Bacteria 2863
572 Ga0501251_003724 3300049681 Bacteria 1537
573 Ga0501252_015053 3300049682 Bacteria 963
574 Ga0501253_002688 3300049683 Bacteria 2034
575 Ga0501257_029004 3300049686 Bacteria 1329
576 Ga0501259_028777 3300049688 Bacteria 1036
577 Ga0501221_109014 3300049704 Unclassified 696
578 Ga0501225_0038105 3300049705 Bacteria 1325
579 Ga0501229_018661 3300049706 Bacteria 910
580 Ga0501079_0066150 3300049741 Bacteria 2789
581 Ga0501079_0114219 3300049741 Bacteria 2099
582 Ga0501079_0115497 3300049741 Bacteria 2086
583 Ga0501079_0157933 3300049741 Bacteria 1768
584 Ga0501081_0086647 3300049743 Bacteria 2199
585 Ga0501081_0116664 3300049743 Bacteria 1898
586 Ga0501081_0433970 3300049743 Bacteria 975
587 Ga0501083_0070119 3300049744 Bacteria 2332
588 Ga0501083_0253680 3300049744 Bacteria 1145
589 Ga0501262_013832 3300049759 Bacteria 1044
590 Ga0501267_014316 3300049764 Bacteria 831
591 Ga0501268_004221 3300049765 Bacteria 2015
592 Ga0501270_004607 3300049767 Bacteria 1557
593 Ga0501270_009331 3300049767 Bacteria 1265
594 Ga0501271_013510 3300049768 Unclassified 895
595 Ga0501272_000650 3300049769 Bacteria 3108
596 Ga0501272_060896 3300049769 Bacteria 539
597 Ga0501273_000667 3300049770 Bacteria 2888
598 Ga0501275_007220 3300049772 Bacteria 1113
599 Ga0501276_005632 3300049773 Bacteria 968
600 Ga0501283_032985 3300049779 Bacteria 875
601 Ga0501045_0033094 3300049824 Bacteria 3748
602 Ga0501045_0164304 3300049824 Bacteria 1653
603 Ga0501045_0227905 3300049824 Bacteria 1387
604 Ga0501204_013191 3300049850 Bacteria 1001
605 Ga0501212_012418 3300049851 Bacteria 1239
606 nmdc:mga05p37_1090530_c1 3300050507 Bacteria 837
607 nmdc:mga05p37_141682_c1 3300050507 Bacteria 2945
608 nmdc:mga05p37_14934_c1 3300050507 Bacteria 9323
609 nmdc:mga05p37_257030_c1 3300050507 Bacteria 2093
610 nmdc:mga05p37_287594_c1 3300050507 Bacteria 1958
611 nmdc:mga09592_118044_c1 3300050508 Bacteria 2277
612 nmdc:mga09592_28843_c1 3300050508 Bacteria 4614
613 nmdc:mga0qj67_351855_c1 3300050509 Bacteria 1191
614 nmdc:mga0qj67_66558_c1 3300050509 Bacteria 2869
615 nmdc:mga0qj67_724602_c1 3300050509 Bacteria 790
616 nmdc:mga06r32_3480_c1 3300050510 Bacteria 14060
617 nmdc:mga06r32_69410_c1 3300050510 Bacteria 3406
618 nmdc:mga06r32_720935_c1 3300050510 Bacteria 962
619 nmdc:mga08y16_1888723_c1 3300050511 Bacteria 548
620 nmdc:mga08y16_1964688_c1 3300050511 Bacteria 535
621 nmdc:mga08y16_240601_c1 3300050511 Bacteria 1871
622 nmdc:mga0n895_1038875_c1 3300050512 Bacteria 799
623 nmdc:mga0n895_118347_c1 3300050512 Bacteria 2669
624 nmdc:mga0n895_1825373_c1 3300050512 Bacteria 568
625 nmdc:mga0n895_383_c1 3300050512 Bacteria 29938
626 nmdc:mga0n895_43514_c1 3300050512 Bacteria 4376
627 nmdc:mga0n895_616_c1 3300050512 Bacteria 24731
628 nmdc:mga0n895_9577_c1 3300050512 Bacteria 8484
629 nmdc:mga0rr50_492534_c1 3300050513 Bacteria 1042
630 nmdc:mga08x19_1089800_c1 3300050514 Bacteria 567
631 nmdc:mga08x19_1141813_c1 3300050514 Bacteria 553
632 nmdc:mga08x19_22359_c1 3300050514 Bacteria 3916
633 nmdc:mga08x19_51459_c1 3300050514 Bacteria 2646
634 nmdc:mga08x19_59612_c1 3300050514 Unclassified 2471
635 nmdc:mga08x19_66088_c1 3300050514 Bacteria 2350
636 nmdc:mga08x19_7632_c1 3300050514 Bacteria 6426
637 nmdc:mga0a205_227538_c1 3300050515 Bacteria 1749
638 nmdc:mga0a205_400033_c1 3300050515 Bacteria 1237
639 nmdc:mga0a205_44464_c1 3300050515 Bacteria 4281
640 nmdc:mga0a205_659_c1 3300050515 Bacteria 27518
641 Ga0495601_0001299 3300053077 Bacteria 13725
642 Ga0495612_0004440 3300053078 Bacteria 5820
643 Ga0495595_0004129 3300053084 Bacteria 5828
644 Ga0495619_0001149 3300053085 Bacteria 17383
645 Ga0501084_0032489 3300054114 Bacteria 4365
646 Ga0590071_003383 3300059421 Bacteria 3924
647 Ga0501082_0021339 3300060353 Bacteria 5587
648 Ga0501082_0042056 3300060353 Bacteria 3940
649 Ga0501082_0089354 3300060353 Bacteria 2660
650 Ga0530510_0373583 3300061734 Bacteria 1073
651 Ga0530510_0482500 3300061734 Bacteria 939
652 Ga0530510_0536910 3300061734 Bacteria 888
653 Ga0530510_1032550 3300061734 Bacteria 629
654 Ga0070658_10793027
655 JGI25406J46586_10145756
656 rootL2_10163687
657 Ga0065715_10604432
658 Ga0065707_10324499
659 Ga0070658_10200521
660 Ga0070676_10001926
661 Ga0070690_100760644
662 Ga0070670_100752016
663 Ga0070677_10514782
664 Ga0068869_100050894
665 Ga0070682_100095513
666 Ga0070682_100362971
667 Ga0070660_100288934
668 Ga0070660_101211320
669 Ga0070687_100265328
670 Ga0070661_100453931
671 Ga0070661_101864374
672 Ga0070668_100010255
673 Ga0070668_100567065
674 Ga0070669_100262483
675 Ga0070669_100405137
676 Ga0070669_101494500
677 Ga0070675_100112925
678 Ga0070675_101391199
679 Ga0070671_100584872
680 Ga0070674_100000378
681 Ga0070674_100502628
682 Ga0070673_100033447
683 Ga0070659_100486299
684 Ga0070667_101918162
685 Ga0070703_10002195
686 Ga0070703_10007122
687 Ga0070703_10037010
688 Ga0070703_10314565
689 Ga0070709_10001217
690 Ga0070709_10018925
691 Ga0070709_10393620
692 Ga0070709_11355469
693 Ga0070714_100389060
694 Ga0070713_100113358
695 Ga0070713_100534831
696 Ga0070710_10175789
697 Ga0070710_10874543
698 Ga0070701_10516595
699 Ga0070701_10979715
700 Ga0070711_100000239
701 Ga0070711_100007712
702 Ga0070705_100002647
703 Ga0070705_100028862
704 Ga0070705_100225392
705 Ga0070700_100056332
706 Ga0070700_100279504
707 Ga0070694_100021499
708 Ga0070694_100065552
709 Ga0070694_100090828
710 Ga0070694_100101863
711 Ga0070694_101820730
712 Ga0070708_100016285
713 Ga0070708_100066036
714 Ga0070708_100156312
715 Ga0070708_100171127
716 Ga0070708_100394684
717 Ga0070708_101360018
718 Ga0070663_100117091
719 Ga0070663_100753113
720 Ga0070678_100010489
721 Ga0070662_100051092
722 Ga0070662_100332962
723 Ga0070681_10104296
724 Ga0070681_10140437
725 Ga0070681_11117616
726 Ga0070681_11900379
727 Ga0068867_100001672
728 Ga0068867_100319521
729 Ga0070706_100100212
730 Ga0070706_100105980
731 Ga0070706_100147250
732 Ga0070706_100241260
733 Ga0070706_100829050
734 Ga0070706_100971083
735 Ga0070706_101589949
736 Ga0070707_100018022
737 Ga0070707_100023066
738 Ga0070707_100023968
739 Ga0070707_100048346
740 Ga0070707_100051348
741 Ga0070707_100071620
742 Ga0070707_100109021
743 Ga0070707_101853330
744 Ga0070698_100000037
745 Ga0070698_100088251
746 Ga0070698_100093544
747 Ga0070698_100355098
748 Ga0070698_100742262
749 Ga0070699_100019554
750 Ga0070699_100052119
751 Ga0070699_100175890
752 Ga0070699_100290171
753 Ga0070699_100314188
754 Ga0070699_100568310
755 Ga0070699_100929130
756 Ga0070684_100859682
757 Ga0070684_100948302
758 Ga0070684_101027185
759 Ga0070697_100013672
760 Ga0070697_100015734
761 Ga0070697_100051645
762 Ga0070697_100125275
763 Ga0070697_100259515
764 Ga0070697_100632342
765 Ga0070697_101187855
766 Ga0070697_101386299
767 Ga0070672_100227569
768 Ga0070686_100377075
769 Ga0070695_100002535
770 Ga0070695_100033544
771 Ga0070695_100041833
772 Ga0070695_100053123
773 Ga0070696_100012183
774 Ga0070696_100101292
775 Ga0070696_100114902
776 Ga0070696_100163225
777 Ga0070696_101004742
778 Ga0070693_100064398
779 Ga0070665_101827498
780 Ga0070704_100005461
781 Ga0070704_100049304
782 Ga0070704_100061295
783 Ga0070704_100160502
784 Ga0070704_100179537
785 Ga0068855_100688458
786 Ga0070664_100893872
787 Ga0070664_100919080
788 Ga0068857_100009128
789 Ga0068854_100008522
790 Ga0068854_100776712
791 Ga0068854_101931471
792 Ga0070702_100001397
793 Ga0070702_100751413
794 Ga0068852_100763766
795 Ga0068864_100000396
796 Ga0068866_10000401
797 Ga0068866_10206322
798 Ga0068866_10379430
799 Ga0068861_100035865
800 Ga0068861_100782930
801 Ga0068861_100801166
802 Ga0068870_10393123
803 Ga0068863_100168747
804 Ga0068858_100014878
805 Ga0068860_100553206
806 Ga0068860_101159554
807 Ga0081455_10940938
808 Ga0081539_10072556
809 Ga0070717_10140053
810 Ga0070717_10444356
811 Ga0070717_10445187
812 Ga0070715_10684052
813 Ga0070716_100004394
814 Ga0070716_100142125
815 Ga0070716_100719062
816 Ga0070712_100145615
817 Ga0070712_100257173
818 Ga0070712_101215198
819 Ga0097621_100083421
820 Ga0097621_101715348
821 Ga0068871_100056495
822 Ga0075428_100016140
823 Ga0075428_100297114
824 Ga0075428_100339399
825 Ga0075428_100692084
826 Ga0075430_100249135
827 Ga0075430_100449111
828 Ga0075431_100019714
829 Ga0075431_100044571
830 Ga0075431_100210089
831 Ga0075431_100216448
832 Ga0075431_100242215
833 Ga0075431_100850544
834 Ga0075433_10021691
835 Ga0075433_10209853
836 Ga0075433_10288202
837 Ga0075433_10429476
838 Ga0075434_100002527
839 Ga0075434_100003715
840 Ga0075434_100018158
841 Ga0075434_100055478
842 Ga0075434_100269706
843 Ga0075429_100041578
844 Ga0068865_100011523
845 Ga0075436_100005906
846 Ga0075436_100031336
847 Ga0075436_100076036
848 Ga0075436_100110759
849 Ga0075436_100111996
850 Ga0075436_100246078
851 Ga0075435_100032513
852 Ga0075435_100550731
853 Ga0099794_10211515
854 Ga0099794_10321373
855 Ga0099794_10356461
856 Ga0105240_10134820
857 Ga0105240_10139041
858 Ga0111539_10092205
859 Ga0111539_10243912
860 Ga0105245_10045195
861 Ga0105245_10844759
862 Ga0105245_11033997
863 Ga0105245_11943589
864 Ga0105245_12804450
865 Ga0114129_10098954
866 Ga0114129_10109415
867 Ga0114129_10335660
868 Ga0114129_10722906
869 Ga0114129_10833866
870 Ga0114129_11694071
871 Ga0114129_13492309
872 Ga0105243_10002610
873 Ga0105242_10001397
874 Ga0105242_10235288
875 Ga0105248_10000658
876 Ga0105248_10045262
877 Ga0105248_10124698
878 Ga0105248_10302518
879 Ga0105238_11970412
880 Ga0105249_10018112
881 Ga0105249_10045179
882 Ga0105249_10363726
883 Ga0105249_13261997
884 Ga0105239_10004859
885 Ga0105239_11171465
886 Ga0105239_11409516
887 Ga0105246_10044479
888 Ga0157373_10011153
889 Ga0157373_10439135
890 Ga0157371_10134444
891 Ga0157370_10097794
892 Ga0157378_10002774
893 Ga0163162_10010076
894 Ga0163162_12168377
895 Ga0157372_10026323
896 Ga0157372_10313932
897 Ga0157372_12982941
898 Ga0157372_13260754
899 Ga0157372_13372266
900 Ga0157375_10102888
901 Ga0157375_10141916
902 Ga0157375_10395543
903 Ga0157375_10503538
904 Ga0157375_11800852
905 Ga0163163_10633560
906 Ga0157380_10017279
907 Ga0182008_10276769
908 Ga0157379_10008817
909 Ga0157379_10994525
910 Ga0157379_11529687
911 Ga0157376_10154753
912 Ga0157376_10315650
913 Ga0157376_10513831
914 Ga0163161_10278734
915 Ga0207653_10010980
916 Ga0207653_10102367
917 Ga0207682_10133141
918 Ga0207682_10260162
919 Ga0207692_10732872
920 Ga0207642_10000600
921 Ga0207642_10084299
922 Ga0207642_11088962
923 Ga0207645_10000145
924 Ga0207645_10312898
925 Ga0207643_10007892
926 Ga0207705_10880011
927 Ga0207684_10000781
928 Ga0207684_10018361
929 Ga0207684_10128392
930 Ga0207684_10195617
931 Ga0207684_10813433
932 Ga0207707_10236112
933 Ga0207695_10007320
934 Ga0207695_10246308
935 Ga0207693_10237158
936 Ga0207693_10360152
937 Ga0207663_10000256
938 Ga0207660_10164184
939 Ga0207657_10482811
940 Ga0207657_11419341
941 Ga0207652_10530348
942 Ga0207646_10001100
943 Ga0207646_10010434
944 Ga0207646_10060180
945 Ga0207646_10120623
946 Ga0207646_10182352
947 Ga0207646_11145723
948 Ga0207681_10013785
949 Ga0207681_11421767
950 Ga0207659_10121710
951 Ga0207687_10045351
952 Ga0207687_10464023
953 Ga0207700_10090497
954 Ga0207700_10112692
955 Ga0207644_10536877
956 Ga0207644_10872406
957 Ga0207690_10166335
958 Ga0207690_11410945
959 Ga0207706_10000146
960 Ga0207706_10049239
961 Ga0207686_10002394
962 Ga0207709_10001445
963 Ga0207669_10001017
964 Ga0207669_10144725
965 Ga0207669_10497991
966 Ga0207704_10009204
967 Ga0207704_10740032
968 Ga0207665_10003606
969 Ga0207665_10615494
970 Ga0207691_10098418
971 Ga0207711_10015225
972 Ga0207711_10109668
973 Ga0207711_10367069
974 Ga0207689_10091551
975 Ga0207661_10323620
976 Ga0207667_10866794
977 Ga0207651_10046086
978 Ga0207712_10002961
979 Ga0207712_10018227
980 Ga0207712_10478335
981 Ga0207712_10881959
982 Ga0207668_10018117
983 Ga0207668_10140298
984 Ga0207640_10016781
985 Ga0207640_11277918
986 Ga0207658_10442960
987 Ga0207678_10140084
988 Ga0207708_10021560
989 Ga0207702_10368805
990 Ga0207648_10001390
991 Ga0207648_10195238
992 Ga0207676_10002613
993 Ga0207674_10024439
994 Ga0207675_100048912
995 Ga0207675_100342145
996 Ga0207675_100407878
997 Ga0207683_10005089
998 Ga0209588_1000481
999 Ga0209588_1082418
1000 Ga0209974_10290135
1001 Ga0268265_10086766
1002 Ga0268265_11369295
1003 Ga0268264_10657904
1004 Ga0307408_100004762
1005 Ga0307408_100011114
1006 Ga0307408_100017983
1007 Ga0307408_100029054
1008 Ga0307408_100150000
1009 Ga0307408_100449435
1010 Ga0307408_101019495
1011 Ga0307405_10039351
1012 Ga0307405_10054341
1013 Ga0307405_10074660
1014 Ga0307405_10122430
1015 Ga0307405_10431693
1016 Ga0307413_10002235
1017 Ga0307413_10058357
1018 Ga0307413_10066721
1019 Ga0307413_10122940
1020 Ga0307410_10002605
1021 Ga0307410_10008516
1022 Ga0307410_10010055
1023 Ga0307410_10018355
1024 Ga0307410_10023153
1025 Ga0307410_10024422
1026 Ga0307410_10032478
1027 Ga0307410_10516044
1028 Ga0307406_10015327
1029 Ga0307406_10021817
1030 Ga0307406_10025363
1031 Ga0307406_10039984
1032 Ga0307406_10167252
1033 Ga0307406_10232586
1034 Ga0307407_10006601
1035 Ga0307407_10016027
1036 Ga0307407_10018926
1037 Ga0307407_10068379
1038 Ga0307407_10077467
1039 Ga0307407_10462230
1040 Ga0307407_11074951
1041 Ga0307412_10038147
1042 Ga0307412_10114740
1043 Ga0307412_10221564
1044 Ga0307412_10894446
1045 Ga0307409_100000308
1046 Ga0307409_100002174
1047 Ga0307409_100010633
1048 Ga0307409_100039948
1049 Ga0307409_100041252
1050 Ga0307409_100097319
1051 Ga0307409_100271574
1052 Ga0307409_100437432
1053 Ga0307409_101014129
1054 Ga0307416_100001186
1055 Ga0307416_100002892
1056 Ga0307416_100005003
1057 Ga0307416_100012945
1058 Ga0307416_100128498
1059 Ga0307416_100218658
1060 Ga0307416_100335110
1061 Ga0307416_100370800
1062 Ga0307416_100917937
1063 Ga0307416_101664233
1064 Ga0307414_10007376
1065 Ga0307414_10018252
1066 Ga0307414_10020050
1067 Ga0307414_10029042
1068 Ga0307414_10038035
1069 Ga0307414_10068365
1070 Ga0307414_10262942
1071 Ga0307414_10544554
1072 Ga0307411_10007316
1073 Ga0307411_10021429
1074 Ga0307411_10037531
1075 Ga0307411_10043332
1076 Ga0307411_10060118
1077 Ga0307411_10073449
1078 Ga0307411_10221136
1079 Ga0307411_10540825
1080 Ga0307411_10540882
1081 Ga0307415_100000203
1082 Ga0307415_100001513
1083 Ga0307415_100002691
1084 Ga0307415_100024157
1085 Ga0307415_100113984
1086 Ga0307415_100180126
1087 Ga0307415_100331890
1088 Ga0307415_100343075
1089 Ga0373959_0194587
1090 Ga0373934_0000216
1091 Ga0373923_0002487
1092 Ga0373936_0038548
1093 Ga0373954_0155934
1094 Ga0373956_0000127
1095 Ga0373957_0057748
1096 Ga0373960_0133512
1097 Ga0373955_0000777
1098 Ga0316574_0149959
1099 Ga0373924_0017754
1100 Ga0373931_0119880
1101 Ga0373935_0734418
1102 Ga0373933_0005312
1103 Ga0373937_0000195
1104 Ga0373937_0847827
1105 Ga0395901_1198567
1106 Ga0395901_1882353
1107 Ga0242420_007720
1108 Ga0439447_117110
1109 Ga0439457_051423
1110 Ga0450914_040608
1111 Ga0450923_037850
1112 Ga0450894_023986
1113 Ga0450898_010361
1114 Ga0439434_0167615
1115 Ga0439444_0010638
1116 Ga0451577_0031234
1117 Ga0451577_0733947
1118 Ga0453683_0040950
1119 Ga0453683_0056185
1120 Ga0453683_0075053
1121 Ga0453683_0327185
1122 Ga0466963_0781117
1123 Ga0466964_0091732
1124 Ga0466957_0663714
1125 Ga0466959_0406472
1126 Ga0451576_0025189
1127 Ga0451576_0135615
1128 Ga0451576_0794135
1129 Ga0451576_1746582
1130 Ga0495592_0001514
1131 Ga0495603_0074871
1132 Ga0495629_0016005
1133 Ga0495651_0000050
1134 Ga0495653_0000134
1135 Ga0495582_0794280
1136 Ga0495639_0111938
1137 Ga0495594_0020281
1138 Ga0495608_0000381
1139 Ga0495618_0103033
1140 Ga0495628_0001309
1141 Ga0495630_0005719
1142 Ga0495663_0062529
1143 Ga0495666_0389443
1144 Ga0495652_0000931
1145 Ga0495665_0246976
1146 Ga0495586_0527257
1147 Ga0495586_0533446
1148 Ga0495587_0000114
1149 Ga0495598_0331430
1150 Ga0495645_0000065
1151 Ga0495645_0309920
1152 Ga0495622_0188763
1153 Ga0495667_0000316
1154 Ga0495634_0184587
1155 Ga0495611_0251082
1156 Ga0495635_0000103
1157 Ga0495657_0000606
1158 Ga0495599_0000189
1159 Ga0495623_0000086
1160 Ga0495646_0000522
1161 Ga0495613_0045542
1162 Ga0495613_0605398
1163 Ga0495600_0000145
1164 Ga0495604_0001195
1165 Ga0495636_0016755
1166 Ga0495674_0000339
1167 Ga0495674_0434626
1168 Ga0495675_0003609
1169 Ga0495684_0000141
1170 Ga0495593_0208553
1171 Ga0495602_0003470
1172 Ga0496100_0461076
1173 Ga0496101_0679261
1174 Ga0496102_0012149
1175 Ga0496102_0139858
1176 Ga0496106_0094860
1177 Ga0496106_0892106
1178 Ga0496106_1230861
1179 Ga0496107_0806595
1180 Ga0496108_0014418
1181 Ga0496108_0191676
1182 Ga0496109_0043387
1183 Ga0496109_0253010
1184 Ga0496109_0483733
1185 Ga0496110_1136465
1186 Ga0496111_0005733
1187 Ga0496112_0024531
1188 Ga0496113_0114414
1189 Ga0496114_0100688
1190 Ga0501292_017167
1191 Ga0501298_001135
1192 Ga0501036_0306114
1193 Ga0501039_0327426
1194 Ga0501040_0039277
1195 Ga0501040_0202547
1196 Ga0501040_0210907
1197 Ga0501040_1394112
1198 Ga0501041_0211245
1199 Ga0501041_0225175
1200 Ga0501042_0039868
1201 Ga0501048_0401870
1202 Ga0501067_0142408
1203 Ga0501067_0432539
1204 Ga0501068_0483215
1205 Ga0501069_0081213
1206 Ga0501069_0144646
1207 Ga0501069_0328912
1208 Ga0501074_0148874
1209 Ga0501075_0012654
1210 Ga0501075_0423500
1211 Ga0501076_0006362
1212 Ga0501076_0054307
1213 Ga0501076_0100900
1214 Ga0501076_0542646
1215 Ga0501076_1181383
1216 Ga0501077_0049965
1217 Ga0501077_0068151
1218 Ga0501202_044021
1219 Ga0501209_104200
1220 Ga0501211_012261
1221 Ga0501217_016584
1222 Ga0501239_001326
1223 Ga0501247_002620
1224 Ga0501249_004401
1225 Ga0501251_003724
1226 Ga0501252_015053
1227 Ga0501253_002688
1228 Ga0501257_029004
1229 Ga0501259_028777
1230 Ga0501221_109014
1231 Ga0501225_0038105
1232 Ga0501229_018661
1233 Ga0501079_0066150
1234 Ga0501079_0114219
1235 Ga0501079_0115497
1236 Ga0501079_0157933
1237 Ga0501081_0086647
1238 Ga0501081_0116664
1239 Ga0501081_0433970
1240 Ga0501083_0070119
1241 Ga0501083_0253680
1242 Ga0501262_013832
1243 Ga0501267_014316
1244 Ga0501268_004221
1245 Ga0501270_004607
1246 Ga0501270_009331
1247 Ga0501271_013510
1248 Ga0501272_000650
1249 Ga0501272_060896
1250 Ga0501273_000667
1251 Ga0501275_007220
1252 Ga0501276_005632
1253 Ga0501283_032985
1254 Ga0501045_0033094
1255 Ga0501045_0164304
1256 Ga0501045_0227905
1257 Ga0501204_013191
1258 Ga0501212_012418
1259 nmdc:mga05p37_1090530_c1
1260 nmdc:mga05p37_141682_c1
1261 nmdc:mga05p37_14934_c1
1262 nmdc:mga05p37_257030_c1
1263 nmdc:mga05p37_287594_c1
1264 nmdc:mga09592_118044_c1
1265 nmdc:mga09592_28843_c1
1266 nmdc:mga0qj67_351855_c1
1267 nmdc:mga0qj67_66558_c1
1268 nmdc:mga0qj67_724602_c1
1269 nmdc:mga06r32_3480_c1
1270 nmdc:mga06r32_69410_c1
1271 nmdc:mga06r32_720935_c1
1272 nmdc:mga08y16_1888723_c1
1273 nmdc:mga08y16_1964688_c1
1274 nmdc:mga08y16_240601_c1
1275 nmdc:mga0n895_1038875_c1
1276 nmdc:mga0n895_118347_c1
1277 nmdc:mga0n895_1825373_c1
1278 nmdc:mga0n895_383_c1
1279 nmdc:mga0n895_43514_c1
1280 nmdc:mga0n895_616_c1
1281 nmdc:mga0n895_9577_c1
1282 nmdc:mga0rr50_492534_c1
1283 nmdc:mga08x19_1089800_c1
1284 nmdc:mga08x19_1141813_c1
1285 nmdc:mga08x19_22359_c1
1286 nmdc:mga08x19_51459_c1
1287 nmdc:mga08x19_59612_c1
1288 nmdc:mga08x19_66088_c1
1289 nmdc:mga08x19_7632_c1
1290 nmdc:mga0a205_227538_c1
1291 nmdc:mga0a205_400033_c1
1292 nmdc:mga0a205_44464_c1
1293 nmdc:mga0a205_659_c1
1294 Ga0495601_0001299
1295 Ga0495612_0004440
1296 Ga0495595_0004129
1297 Ga0495619_0001149
1298 Ga0501084_0032489
1299 Ga0590071_003383
1300 Ga0501082_0021339
1301 Ga0501082_0042056
1302 Ga0501082_0089354
1303 Ga0530510_0373583
1304 Ga0530510_0482500
1305 Ga0530510_0536910
1306 Ga0530510_1032550

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13411

MerR_1

MerR HTH family regulatory protein

22

92

0.97

PF00376

MerR

MerR family regulatory protein

23

60

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4r4e-assembly1.cif.gz_B structure of glnr-dna complex 0.901 8 82
5i44-assembly4.cif.gz_E structure of raca-dna complex; p21 form 0.8988 8 74
7tea-assembly2.cif.gz_C crystal structure of s. aureus glnr-dna complex 0.8959 8 78
5i44-assembly4.cif.gz_F-2 structure of raca-dna complex; p21 form 0.887 8 73
4r4e-assembly1.cif.gz_A structure of glnr-dna complex 0.8815 8 83
ID Description Score Start End Superfamily
5i44J00 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.9151 8 72 1.10.1660.10
af_O06302_4_79_1.10.1660.10 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.8982 8 78 1.10.1660.10
af_P33358_1_73_1.10.1660.10 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.8898 8 80 1.10.1660.10
af_P9WME7_10_96_1.10.1660.10 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.8822 11 79 1.10.1660.10
4r4eA00 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.8815 8 83 1.10.1660.10
ID Description Score Start End GO Terms
AF-A0A3N0ZHV7-F1-model_v4 MerR family transcriptional regulator 0.9859 6 80 GO:0003677
GO:0003700
AF-A0A1M7SBL4-F1-model_v4 MerR HTH family regulatory protein 0.9831 9 85 GO:0003677
GO:0003700
AF-A0A7X7DLD9-F1-model_v4 MerR family transcriptional regulator 0.9692 6 83 GO:0003677
GO:0003700
AF-A0A2H0PEP8-F1-model_v4 MerR family transcriptional regulator 0.9692 6 80 GO:0003677
GO:0003700
AF-A0A2M8FZ47-F1-model_v4 HTH merR-type domain-containing protein 0.9687 6 84 GO:0003677
GO:0003700

Map