F472714

General Info

Members Datasets Scaffolds Average Seq Length
652 281 642 270

Family's Representative Sequence

Representative Sequence 3300049570|Ga0501033_0023956|Ga0501033_0023956_24_977
Length 317
Sequence MKLFGPMYNRHFHSIVGGKRVKVTKFPLKPLPLQTNFLSSSQAILIIMVTKKRILFIANEMSPYLELTEFSEIVNRLAIKANEGGFEVRCIMPRFGIINERRHRLHEVVRLSGINVSIDNDDYPLQIKVASLPNARLQVYFLDNEDLFKRKYIFHDENEKWFDDNGLRTAFFCKGALETVKKFGWPPDIIHCSGWMTGLIPLYLKTYYKKEPVFAHSKVVFSIGSTSFKEKLGPDFLKIININGALKEKDLEPFKEASNIAMMRGGATYADAITFGADHIDKKLTEEFGKVRGKKVLHFNAESDLTDYLQLYADLAK

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2818991444 Filimonas endophytica 3197 Isolate Unclassified
3 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
4 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
5 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
6 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
7 2914759650 Rhizosphaericola mali Isolate Rhizosphere
8 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
9 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
10 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
11 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
12 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
13 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
14 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
15 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
16 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
17 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
18 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
19 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
20 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
21 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
22 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
23 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
24 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
25 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
26 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
27 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
28 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
29 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
30 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
31 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
32 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
33 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
34 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
35 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
36 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
37 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
38 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
39 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
40 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
41 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
42 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
43 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
44 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
45 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
46 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
47 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
48 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
49 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
50 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
51 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
52 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
53 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
54 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
55 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
56 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
57 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
58 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
59 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
60 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
61 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
62 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
63 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
64 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
65 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
66 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
67 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
68 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
69 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
70 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
71 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
72 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
73 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
74 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
75 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
76 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
77 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
78 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
79 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
80 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
81 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
82 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
85 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
101 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
114 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
116 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
117 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
118 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
119 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
120 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
121 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
123 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
178 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
179 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
180 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
181 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
182 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
183 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
184 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
185 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
186 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
187 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
188 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
189 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
190 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
191 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
192 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
193 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
194 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
195 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
196 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
197 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
198 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
199 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
200 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
201 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
202 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
203 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
204 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
205 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
206 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
207 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
208 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
209 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
210 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
211 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
212 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
213 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
214 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
215 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
216 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
217 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
218 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
219 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
220 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
221 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
222 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
223 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
224 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
225 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
226 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
227 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
228 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
229 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
230 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
231 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
232 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
233 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
234 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
235 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
236 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
238 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
246 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
247 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
248 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
249 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
250 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
251 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
252 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
253 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
255 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
256 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
257 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
258 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
259 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
260 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
261 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
262 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
263 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
264 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
265 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
266 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
267 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
268 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
269 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
270 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
271 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
272 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
273 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
274 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
275 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
276 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
277 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
278 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
279 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
280 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
281 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.09
Metatranscriptomes 1.23
Isolates 1.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.06
Nodule 0
Rhizoplane 1.23
Rhizosphere 86.81
Stem 0
Stem Tuber 0
Unclassified 4.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1790489 2162886007 Bacteria 77625
2 JGI24744J21845_10007225 3300002077 Bacteria 2296
3 JGI24751J29686_10003268 3300002459 Bacteria 3264
4 JGI25154J39366_1000202 3300002738 Bacteria 42933
5 JGI25153J46596_10011781 3300003215 Bacteria 3837
6 JGI25153J46596_10045913 3300003215 Bacteria 1299
7 rootH1_10037638 3300003316 Bacteria 4707
8 rootH1_10060262 3300003316 Bacteria 1270
9 rootH2_10023887 3300003320 Bacteria 21951
10 rootH2_10036959 3300003320 Bacteria 16537
11 rootH2_10039737 3300003320 Bacteria 27034
12 rootL2_10121090 3300003322 Bacteria 2173
13 rootL2_10291472 3300003322 Bacteria 1676
14 rootH1_10017161 3300003316 Bacteria 5089
15 rootH1_10017161 3300003323 Bacteria 8139
16 rootH1_10049407 3300003323 Bacteria 1698
17 JGI25160J50197_1001302 3300003354 Bacteria 12602
18 JGI25160J50197_1003117 3300003354 Bacteria 7544
19 JGI25160J50197_1004565 3300003354 Bacteria 5965
20 Ga0055528_1000123 3300003790 Bacteria 61846
21 Ga0055530_10000315 3300003791 Bacteria 43745
22 Ga0055531_10049917 3300003794 Bacteria 1113
23 Ga0065165_1000720 3300005262 Bacteria 46532
24 Ga0065714_10158407 3300005288 Bacteria 1065
25 Ga0065712_10005826 3300005290 Bacteria 3946
26 Ga0065707_10133515 3300005295 Bacteria 1880
27 Ga0070658_10103899 3300005327 Bacteria 2350
28 Ga0070658_10139188 3300005327 Bacteria 2027
29 Ga0070658_10288388 3300005327 Bacteria 1398
30 Ga0070658_10313126 3300005327 Bacteria 1339
31 Ga0070676_10229488 3300005328 Bacteria 1230
32 Ga0070683_100007365 3300005329 Bacteria 9297
33 Ga0070683_100103100 3300005329 Bacteria 2688
34 Ga0070690_100012462 3300005330 Bacteria 5002
35 Ga0070690_100027906 3300005330 Bacteria 3493
36 Ga0070690_100180710 3300005330 Bacteria 1457
37 Ga0070670_100012715 3300005331 Bacteria 7203
38 Ga0070670_100281942 3300005331 Bacteria 1451
39 Ga0070670_100378014 3300005331 Unclassified 1248
40 Ga0068869_100035983 3300005334 Bacteria 3513
41 Ga0068869_100063855 3300005334 Bacteria 2707
42 Ga0070666_10000405 3300005335 Bacteria 27033
43 Ga0070666_10010658 3300005335 Bacteria 5753
44 Ga0070666_10033238 3300005335 Bacteria 3412
45 Ga0070666_10083236 3300005335 Bacteria 2189
46 Ga0070666_10245363 3300005335 Bacteria 1267
47 Ga0070680_100030596 3300005336 Bacteria 4325
48 Ga0070680_100058177 3300005336 Bacteria 3161
49 Ga0068868_100001043 3300005338 Bacteria 18940
50 Ga0068868_100029305 3300005338 Bacteria 4214
51 Ga0068868_100029643 3300005338 Bacteria 4192
52 Ga0068868_100065320 3300005338 Bacteria 2890
53 Ga0068868_100263750 3300005338 Bacteria 1453
54 Ga0070660_100057247 3300005339 Bacteria 3019
55 Ga0070660_100082570 3300005339 Bacteria 2523
56 Ga0070660_100176587 3300005339 Bacteria 1727
57 Ga0070689_100004681 3300005340 Bacteria 9270
58 Ga0070689_100052935 3300005340 Bacteria 3141
59 Ga0070689_100477535 3300005340 Bacteria 1064
60 Ga0070661_100024249 3300005344 Bacteria 4351
61 Ga0070661_100053597 3300005344 Unclassified 2953
62 Ga0070692_10032937 3300005345 Bacteria 2609
63 Ga0070668_100045583 3300005347 Bacteria 3364
64 Ga0070669_100295363 3300005353 Bacteria 1302
65 Ga0070675_100014089 3300005354 Bacteria 6299
66 Ga0070671_100011489 3300005355 Bacteria 7120
67 Ga0070671_100025983 3300005355 Bacteria 4809
68 Ga0070671_100094148 3300005355 Bacteria 2510
69 Ga0070671_100194614 3300005355 Bacteria 1719
70 Ga0070671_100388927 3300005355 Bacteria 1192
71 Ga0070671_100522591 3300005355 Bacteria 1022
72 Ga0070674_100220644 3300005356 Bacteria 1475
73 Ga0070673_100033853 3300005364 Bacteria 3861
74 Ga0070673_100171632 3300005364 Bacteria 1851
75 Ga0070673_100381374 3300005364 Bacteria 1257
76 Ga0070688_100103808 3300005365 Bacteria 1879
77 Ga0070659_100004541 3300005366 Bacteria 9914
78 Ga0070659_100025849 3300005366 Bacteria 4516
79 Ga0070667_100007177 3300005367 Bacteria 9260
80 Ga0070667_100013268 3300005367 Bacteria 6806
81 Ga0070667_100023091 3300005367 Bacteria 5160
82 Ga0070667_100103143 3300005367 Bacteria 2465
83 Ga0070667_100229230 3300005367 Bacteria 1656
84 Ga0070667_100408172 3300005367 Bacteria 1237
85 Ga0070713_100193657 3300005436 Bacteria 1833
86 Ga0070663_100006033 3300005455 Bacteria 7255
87 Ga0070663_100111515 3300005455 Bacteria 2056
88 Ga0070663_100152503 3300005455 Bacteria 1773
89 Ga0070663_100246379 3300005455 Bacteria 1413
90 Ga0070678_100016086 3300005456 Bacteria 4773
91 Ga0070678_100088325 3300005456 Bacteria 2370
92 Ga0070678_100174740 3300005456 Bacteria 1753
93 Ga0070662_100036587 3300005457 Bacteria 3473
94 Ga0070662_100046457 3300005457 Bacteria 3120
95 Ga0070662_100085275 3300005457 Bacteria 2360
96 Ga0070662_100163292 3300005457 Bacteria 1744
97 Ga0070681_10026841 3300005458 Bacteria 5789
98 Ga0070681_10060634 3300005458 Bacteria 3759
99 Ga0068867_100012719 3300005459 Bacteria 5954
100 Ga0068867_100047513 3300005459 Bacteria 3155
101 Ga0068867_100165149 3300005459 Bacteria 1749
102 Ga0070685_10012051 3300005466 Bacteria 4534
103 Ga0070685_10034567 3300005466 Bacteria 2847
104 Ga0070685_10128041 3300005466 Bacteria 1584
105 Ga0070707_100659724 3300005468 Bacteria 1009
106 Ga0070698_100072057 3300005471 Bacteria 3463
107 Ga0070679_100138696 3300005530 Bacteria 2412
108 Ga0070684_100001060 3300005535 Bacteria 19661
109 Ga0070684_100022621 3300005535 Bacteria 5246
110 Ga0070684_100078284 3300005535 Bacteria 2921
111 Ga0070684_100089894 3300005535 Bacteria 2729
112 Ga0070684_100379922 3300005535 Bacteria 1301
113 Ga0068853_100048178 3300005539 Bacteria 3659
114 Ga0068853_100077297 3300005539 Bacteria 2908
115 Ga0068853_100134554 3300005539 Bacteria 2215
116 Ga0068853_100150047 3300005539 Bacteria 2098
117 Ga0068853_100170495 3300005539 Bacteria 1969
118 Ga0068853_100418174 3300005539 Bacteria 1257
119 Ga0070672_100038875 3300005543 Bacteria 3640
120 Ga0070672_100345598 3300005543 Bacteria 1267
121 Ga0070672_100410391 3300005543 Bacteria 1162
122 Ga0070686_100154546 3300005544 Bacteria 1610
123 Ga0070693_100077813 3300005547 Bacteria 1970
124 Ga0070665_100001186 3300005548 Bacteria 31830
125 Ga0070665_100141662 3300005548 Bacteria 2407
126 Ga0070665_100389507 3300005548 Bacteria 1401
127 Ga0068855_100000454 3300005563 Bacteria 50341
128 Ga0068855_100031788 3300005563 Bacteria 6301
129 Ga0068855_100138912 3300005563 Bacteria 2771
130 Ga0068855_100224891 3300005563 Unclassified 2103
131 Ga0068855_100448125 3300005563 Bacteria 1409
132 Ga0068855_100708557 3300005563 Bacteria 1076
133 Ga0070664_100018360 3300005564 Bacteria 5744
134 Ga0070664_100027583 3300005564 Bacteria 4720
135 Ga0070664_100059706 3300005564 Bacteria 3245
136 Ga0070664_100087009 3300005564 Bacteria 2701
137 Ga0070664_100554759 3300005564 Bacteria 1062
138 Ga0068857_100091881 3300005577 Bacteria 2717
139 Ga0068857_100102812 3300005577 Bacteria 2565
140 Ga0068857_100368370 3300005577 Bacteria 1333
141 Ga0068854_100019889 3300005578 Bacteria 4533
142 Ga0068854_100078438 3300005578 Bacteria 2433
143 Ga0068854_100329454 3300005578 Bacteria 1244
144 Ga0068856_100053444 3300005614 Bacteria 3982
145 Ga0068856_100515544 3300005614 Bacteria 1217
146 Ga0070702_100014040 3300005615 Bacteria 4057
147 Ga0070702_100121376 3300005615 Bacteria 1637
148 Ga0068852_100001575 3300005616 Bacteria 15498
149 Ga0068852_100011253 3300005616 Bacteria 6725
150 Ga0068852_100242365 3300005616 Bacteria 1724
151 Ga0068852_100298934 3300005616 Bacteria 1557
152 Ga0068859_100000066 3300005617 Bacteria 100640
153 Ga0068859_100001623 3300005617 Bacteria 22983
154 Ga0068859_100027738 3300005617 Bacteria 5680
155 Ga0068859_100063196 3300005617 Bacteria 3733
156 Ga0068864_100028412 3300005618 Bacteria 4727
157 Ga0068864_100111734 3300005618 Bacteria 2435
158 Ga0068864_100116222 3300005618 Bacteria 2387
159 Ga0068864_100156939 3300005618 Bacteria 2066
160 Ga0068861_100375319 3300005719 Bacteria 1255
161 Ga0068861_100875882 3300005719 Bacteria 848
162 Ga0068851_10173881 3300005834 Bacteria 1190
163 Ga0068870_10192658 3300005840 Bacteria 1231
164 Ga0068863_100002306 3300005841 Bacteria 18971
165 Ga0068863_100049329 3300005841 Bacteria 3992
166 Ga0068863_100082885 3300005841 Bacteria 3039
167 Ga0068863_100169110 3300005841 Unclassified 2096
168 Ga0068858_100038172 3300005842 Bacteria 4454
169 Ga0068858_100068991 3300005842 Bacteria 3277
170 Ga0068858_100257394 3300005842 Bacteria 1658
171 Ga0068860_100000110 3300005843 Bacteria 131175
172 Ga0068860_100013138 3300005843 Bacteria 8126
173 Ga0068860_100037206 3300005843 Bacteria 4659
174 Ga0081540_1003257 3300005983 Bacteria 12898
175 Ga0081539_10001634 3300005985 Bacteria 36532
176 Ga0081539_10039886 3300005985 Bacteria 2765
177 Ga0097621_100000138 3300006237 Bacteria 43428
178 Ga0097621_100003131 3300006237 Bacteria 11350
179 Ga0097621_100037073 3300006237 Bacteria 3903
180 Ga0075370_10067324 3300006353 Bacteria 2044
181 Ga0068871_100000427 3300006358 Bacteria 29046
182 Ga0068871_100033494 3300006358 Bacteria 4069
183 Ga0068871_100078588 3300006358 Bacteria 2728
184 Ga0068871_100084185 3300006358 Bacteria 2639
185 Ga0068871_100176821 3300006358 Bacteria 1832
186 Ga0068871_100226029 3300006358 Bacteria 1623
187 Ga0068871_100419007 3300006358 Bacteria 1195
188 Ga0068865_100071937 3300006881 Unclassified 2455
189 Ga0097620_100000066 3300006931 Bacteria 100640
190 Ga0097620_100001623 3300006931 Bacteria 22983
191 Ga0097620_100027737 3300006931 Bacteria 5680
192 Ga0097620_100063194 3300006931 Bacteria 3733
193 Ga0105240_10000047 3300009093 Bacteria 239067
194 Ga0105240_10005924 3300009093 Bacteria 18106
195 Ga0105240_10070611 3300009093 Bacteria 4320
196 Ga0105240_10091853 3300009093 Bacteria 3708
197 Ga0105240_10135039 3300009093 Bacteria 2955
198 Ga0105240_10148766 3300009093 Bacteria 2791
199 Ga0105240_10734729 3300009093 Bacteria 1074
200 Ga0111539_10090504 3300009094 Bacteria 3596
201 Ga0111539_10314816 3300009094 Bacteria 1821
202 Ga0111539_10505190 3300009094 Bacteria 1408
203 Ga0105247_10159994 3300009101 Bacteria 1490
204 Ga0114129_10149716 3300009147 Bacteria 3194
205 Ga0114129_10203136 3300009147 Bacteria 2683
206 Ga0105241_10001740 3300009174 Bacteria 16524
207 Ga0105241_10003183 3300009174 Bacteria 12216
208 Ga0105241_10198225 3300009174 Bacteria 1675
209 Ga0105241_10220468 3300009174 Bacteria 1594
210 Ga0105241_10618256 3300009174 Bacteria 980
211 Ga0105242_10027932 3300009176 Bacteria 4486
212 Ga0105242_10032178 3300009176 Bacteria 4193
213 Ga0105242_10115977 3300009176 Bacteria 2290
214 Ga0105242_10464911 3300009176 Bacteria 1195
215 Ga0105248_10064081 3300009177 Unclassified 4126
216 Ga0105248_10260181 3300009177 Bacteria 1953
217 Ga0105237_10000169 3300009545 Bacteria 92124
218 Ga0105237_10003163 3300009545 Bacteria 19782
219 Ga0105237_10008977 3300009545 Bacteria 10759
220 Ga0105237_10010869 3300009545 Bacteria 9658
221 Ga0105238_10102289 3300009551 Bacteria 2847
222 Ga0105238_10145101 3300009551 Bacteria 2350
223 Ga0105249_10003050 3300009553 Bacteria 14455
224 Ga0105249_10035946 3300009553 Bacteria 4493
225 Ga0105249_10926989 3300009553 Bacteria 938
226 Ga0105249_10928837 3300009553 Bacteria 937
227 Ga0105239_10000754 3300010375 Bacteria 45868
228 Ga0105239_10000916 3300010375 Bacteria 41814
229 Ga0105239_10002487 3300010375 Bacteria 23470
230 Ga0105239_10005357 3300010375 Bacteria 15059
231 Ga0105239_10008603 3300010375 Bacteria 11572
232 Ga0105239_10037412 3300010375 Bacteria 5320
233 Ga0105239_10089339 3300010375 Bacteria 3397
234 Ga0105239_10158780 3300010375 Bacteria 2526
235 Ga0105239_10221010 3300010375 Bacteria 2124
236 Ga0157373_10004634 3300013100 Bacteria 10348
237 Ga0157373_10005619 3300013100 Bacteria 9401
238 Ga0157373_10048858 3300013100 Bacteria 3016
239 Ga0157373_10053606 3300013100 Bacteria 2867
240 Ga0157373_10163411 3300013100 Bacteria 1567
241 Ga0157371_10026384 3300013102 Bacteria 4224
242 Ga0157371_10027851 3300013102 Bacteria 4095
243 Ga0157371_10045022 3300013102 Bacteria 3141
244 Ga0157371_10049953 3300013102 Bacteria 2971
245 Ga0157371_10058720 3300013102 Bacteria 2729
246 Ga0157371_10115068 3300013102 Bacteria 1910
247 Ga0157371_10409180 3300013102 Bacteria 993
248 Ga0157371_10423552 3300013102 Bacteria 976
249 Ga0157371_10517603 3300013102 Bacteria 882
250 Ga0157370_10000847 3300013104 Bacteria 38795
251 Ga0157370_10034962 3300013104 Bacteria 4889
252 Ga0157370_10197767 3300013104 Bacteria 1865
253 Ga0157370_10199633 3300013104 Bacteria 1855
254 Ga0157370_10200684 3300013104 Bacteria 1850
255 Ga0157370_10344141 3300013104 Bacteria 1374
256 Ga0157369_10015852 3300013105 Bacteria 8487
257 Ga0157369_10107545 3300013105 Bacteria 2967
258 Ga0157369_10113362 3300013105 Bacteria 2880
259 Ga0157369_10135489 3300013105 Bacteria 2608
260 Ga0157369_10312606 3300013105 Bacteria 1634
261 Ga0157374_10000003 3300013296 Bacteria 854471
262 Ga0157374_10008277 3300013296 Bacteria 8874
263 Ga0157374_10067635 3300013296 Bacteria 3359
264 Ga0157374_10095980 3300013296 Bacteria 2835
265 Ga0157374_10143139 3300013296 Bacteria 2322
266 Ga0157374_10175761 3300013296 Bacteria 2090
267 Ga0157374_10233842 3300013296 Bacteria 1806
268 Ga0157374_10374974 3300013296 Bacteria 1417
269 Ga0157378_10004660 3300013297 Bacteria 12026
270 Ga0157378_10008839 3300013297 Bacteria 8766
271 Ga0157378_10032884 3300013297 Bacteria 4584
272 Ga0157378_10122580 3300013297 Bacteria 2398
273 Ga0157378_10131040 3300013297 Bacteria 2321
274 Ga0157378_10155091 3300013297 Bacteria 2137
275 Ga0163162_10000531 3300013306 Bacteria 35292
276 Ga0163162_10001227 3300013306 Bacteria 23959
277 Ga0163162_10001762 3300013306 Bacteria 20284
278 Ga0163162_10002874 3300013306 Bacteria 16395
279 Ga0163162_10004040 3300013306 Bacteria 14077
280 Ga0163162_10213484 3300013306 Bacteria 2060
281 Ga0163162_10797564 3300013306 Bacteria 1062
282 Ga0157372_10003000 3300013307 Bacteria 18202
283 Ga0157372_10008075 3300013307 Bacteria 11195
284 Ga0157372_10011728 3300013307 Bacteria 9332
285 Ga0157372_10026095 3300013307 Bacteria 6357
286 Ga0157372_10032019 3300013307 Bacteria 5762
287 Ga0157372_10090924 3300013307 Bacteria 3471
288 Ga0157372_10106290 3300013307 Bacteria 3210
289 Ga0157372_10191432 3300013307 Bacteria 2369
290 Ga0157372_10254565 3300013307 Bacteria 2038
291 Ga0157372_10395154 3300013307 Bacteria 1611
292 Ga0157372_10963571 3300013307 Bacteria 989
293 Ga0157375_10000230 3300013308 Bacteria 52234
294 Ga0157375_10010831 3300013308 Bacteria 8034
295 Ga0157375_10061338 3300013308 Bacteria 3733
296 Ga0157375_10124671 3300013308 Bacteria 2689
297 Ga0157375_10127388 3300013308 Bacteria 2663
298 Ga0157375_10289848 3300013308 Bacteria 1800
299 Ga0157375_10369254 3300013308 Bacteria 1601
300 Ga0157375_10456092 3300013308 Bacteria 1444
301 Ga0163163_10000614 3300014325 Bacteria 30837
302 Ga0163163_10053372 3300014325 Bacteria 3989
303 Ga0163163_10369068 3300014325 Bacteria 1492
304 Ga0157380_10049045 3300014326 Bacteria 3328
305 Ga0157380_10052530 3300014326 Bacteria 3228
306 Ga0157380_10167251 3300014326 Bacteria 1917
307 Ga0157377_10037738 3300014745 Bacteria 2663
308 Ga0157377_10086373 3300014745 Bacteria 1844
309 Ga0157377_10103218 3300014745 Bacteria 1703
310 Ga0157379_10011164 3300014968 Bacteria 7829
311 Ga0157379_10068753 3300014968 Bacteria 3167
312 Ga0157379_10117764 3300014968 Bacteria 2389
313 Ga0157379_10195094 3300014968 Bacteria 1830
314 Ga0157379_10285357 3300014968 Bacteria 1503
315 Ga0157379_10394574 3300014968 Bacteria 1271
316 Ga0157376_10003452 3300014969 Bacteria 10889
317 Ga0157376_10004496 3300014969 Bacteria 9715
318 Ga0157376_10015110 3300014969 Bacteria 5819
319 Ga0157376_10057402 3300014969 Bacteria 3256
320 Ga0157376_10065140 3300014969 Bacteria 3076
321 Ga0157376_10460684 3300014969 Bacteria 1242
322 Ga0157376_10548763 3300014969 Bacteria 1143
323 Ga0157376_10592730 3300014969 Bacteria 1102
324 Ga0163161_10001650 3300017792 Bacteria 16385
325 Ga0163161_10006264 3300017792 Bacteria 8235
326 Ga0163161_10017780 3300017792 Bacteria 4982
327 Ga0163161_10156927 3300017792 Bacteria 1733
328 Ga0206352_11134895 3300020078 Bacteria 964
329 Ga0213876_10003392 3300021384 Bacteria 9120
330 Ga0209646_1000006 3300025246 Bacteria 694084
331 Ga0209646_1004259 3300025246 Bacteria 2632
332 Ga0209026_1000551 3300025250 Bacteria 25764
333 Ga0209129_1014905 3300025258 Bacteria 1629
334 Ga0209673_1000694 3300025273 Bacteria 47983
335 Ga0209758_1015411 3300025297 Bacteria 3960
336 Ga0209050_1000163 3300025298 Bacteria 154895
337 Ga0207426_1000023 3300025302 Bacteria 545465
338 Ga0207426_1000562 3300025302 Bacteria 50691
339 Ga0207426_1001480 3300025302 Bacteria 19308
340 Ga0209051_1041679 3300025303 Bacteria 1631
341 Ga0209257_1001886 3300025304 Bacteria 22664
342 Ga0207697_10016623 3300025315 Bacteria 3030
343 Ga0207697_10203441 3300025315 Bacteria 871
344 Ga0207682_10160581 3300025893 Bacteria 1018
345 Ga0207642_10021805 3300025899 Bacteria 2529
346 Ga0207642_10256318 3300025899 Bacteria 995
347 Ga0207680_10000143 3300025903 Bacteria 34125
348 Ga0207680_10067370 3300025903 Bacteria 2205
349 Ga0207680_10075353 3300025903 Bacteria 2104
350 Ga0207680_10096463 3300025903 Bacteria 1892
351 Ga0207680_10175033 3300025903 Bacteria 1448
352 Ga0207680_10186055 3300025903 Bacteria 1407
353 Ga0207680_10233067 3300025903 Bacteria 1266
354 Ga0207647_10001743 3300025904 Bacteria 16673
355 Ga0207647_10011936 3300025904 Bacteria 6067
356 Ga0207647_10024176 3300025904 Bacteria 4008
357 Ga0207647_10062127 3300025904 Bacteria 2276
358 Ga0207647_10081167 3300025904 Bacteria 1944
359 Ga0207645_10036386 3300025907 Bacteria 3161
360 Ga0207705_10058647 3300025909 Bacteria 2777
361 Ga0207705_10116141 3300025909 Bacteria 1981
362 Ga0207705_10118921 3300025909 Bacteria 1959
363 Ga0207654_10150599 3300025911 Bacteria 1493
364 Ga0207654_10199401 3300025911 Bacteria 1317
365 Ga0207707_10090968 3300025912 Bacteria 2667
366 Ga0207707_10226067 3300025912 Bacteria 1629
367 Ga0207695_10000010 3300025913 Bacteria 981919
368 Ga0207695_10000021 3300025913 Bacteria 679399
369 Ga0207695_10000039 3300025913 Bacteria 454801
370 Ga0207695_10000073 3300025913 Bacteria 312565
371 Ga0207695_10018494 3300025913 Bacteria 8054
372 Ga0207695_10026798 3300025913 Bacteria 6428
373 Ga0207695_10090834 3300025913 Bacteria 3069
374 Ga0207671_10000036 3300025914 Bacteria 236133
375 Ga0207671_10001328 3300025914 Bacteria 28918
376 Ga0207671_10001491 3300025914 Bacteria 27003
377 Ga0207671_10017094 3300025914 Bacteria 5607
378 Ga0207671_10028520 3300025914 Bacteria 4170
379 Ga0207660_10027588 3300025917 Bacteria 3877
380 Ga0207660_10164087 3300025917 Bacteria 1716
381 Ga0207662_10004354 3300025918 Bacteria 7436
382 Ga0207657_10180225 3300025919 Bacteria 1708
383 Ga0207649_10003293 3300025920 Bacteria 8838
384 Ga0207652_10000482 3300025921 Bacteria 40894
385 Ga0207652_10109714 3300025921 Bacteria 2447
386 Ga0207681_10477093 3300025923 Bacteria 1018
387 Ga0207650_10003184 3300025925 Bacteria 11309
388 Ga0207650_10036073 3300025925 Bacteria 3596
389 Ga0207650_10269656 3300025925 Bacteria 1383
390 Ga0207659_10023973 3300025926 Bacteria 4082
391 Ga0207659_10116451 3300025926 Bacteria 2040
392 Ga0207644_10006165 3300025931 Bacteria 7817
393 Ga0207644_10254019 3300025931 Bacteria 1403
394 Ga0207644_10618286 3300025931 Bacteria 900
395 Ga0207690_10051717 3300025932 Bacteria 2749
396 Ga0207690_10141394 3300025932 Bacteria 1774
397 Ga0207706_10005379 3300025933 Bacteria 11936
398 Ga0207706_10065416 3300025933 Bacteria 3202
399 Ga0207686_10037798 3300025934 Bacteria 2916
400 Ga0207686_10070044 3300025934 Bacteria 2252
401 Ga0207686_10217137 3300025934 Bacteria 1378
402 Ga0207670_10040394 3300025936 Bacteria 3062
403 Ga0207669_10027446 3300025937 Bacteria 3117
404 Ga0207669_10319850 3300025937 Bacteria 1187
405 Ga0207704_10085048 3300025938 Bacteria 2058
406 Ga0207704_10379295 3300025938 Bacteria 1109
407 Ga0207691_10017192 3300025940 Bacteria 6861
408 Ga0207691_10030028 3300025940 Bacteria 5083
409 Ga0207691_10311167 3300025940 Bacteria 1352
410 Ga0207691_10362788 3300025940 Bacteria 1238
411 Ga0207691_10664107 3300025940 Bacteria 880
412 Ga0207711_10109404 3300025941 Bacteria 2456
413 Ga0207689_10005086 3300025942 Bacteria 11836
414 Ga0207689_10038240 3300025942 Bacteria 3976
415 Ga0207689_10047713 3300025942 Bacteria 3534
416 Ga0207689_10165974 3300025942 Bacteria 1819
417 Ga0207689_10194816 3300025942 Bacteria 1672
418 Ga0207661_10003174 3300025944 Bacteria 11401
419 Ga0207661_10015292 3300025944 Bacteria 5643
420 Ga0207661_10036535 3300025944 Bacteria 3835
421 Ga0207679_10050891 3300025945 Bacteria 3030
422 Ga0207679_10510913 3300025945 Bacteria 1073
423 Ga0207667_10000863 3300025949 Bacteria 39055
424 Ga0207667_10014746 3300025949 Bacteria 8894
425 Ga0207667_10033976 3300025949 Bacteria 5478
426 Ga0207667_10041764 3300025949 Bacteria 4876
427 Ga0207667_10052940 3300025949 Bacteria 4273
428 Ga0207667_10451415 3300025949 Bacteria 1306
429 Ga0207667_10626661 3300025949 Bacteria 1083
430 Ga0207651_10031997 3300025960 Bacteria 3372
431 Ga0207651_10062416 3300025960 Bacteria 2597
432 Ga0207651_10070432 3300025960 Bacteria 2474
433 Ga0207651_10211190 3300025960 Bacteria 1562
434 Ga0207651_10219443 3300025960 Bacteria 1536
435 Ga0207712_10007340 3300025961 Bacteria 6958
436 Ga0207712_10025711 3300025961 Bacteria 3915
437 Ga0207668_10083812 3300025972 Bacteria 2321
438 Ga0207658_10013185 3300025986 Bacteria 5644
439 Ga0207658_10303863 3300025986 Bacteria 1375
440 Ga0207658_10376137 3300025986 Bacteria 1243
441 Ga0207658_10578393 3300025986 Bacteria 1007
442 Ga0207677_10007524 3300026023 Bacteria 6036
443 Ga0207677_10266859 3300026023 Bacteria 1398
444 Ga0207703_10002420 3300026035 Bacteria 16204
445 Ga0207703_10427421 3300026035 Bacteria 1234
446 Ga0207639_10018037 3300026041 Bacteria 5008
447 Ga0207639_10071444 3300026041 Bacteria 2715
448 Ga0207639_10078816 3300026041 Bacteria 2602
449 Ga0207639_10127926 3300026041 Bacteria 2098
450 Ga0207639_10207170 3300026041 Bacteria 1686
451 Ga0207639_10413901 3300026041 Bacteria 1217
452 Ga0207639_10442084 3300026041 Bacteria 1179
453 Ga0207678_10017421 3300026067 Bacteria 6309
454 Ga0207678_10181763 3300026067 Bacteria 1796
455 Ga0207708_10078142 3300026075 Bacteria 2541
456 Ga0207702_10514583 3300026078 Bacteria 1168
457 Ga0207641_10000828 3300026088 Bacteria 32919
458 Ga0207641_10024571 3300026088 Bacteria 4967
459 Ga0207641_10041119 3300026088 Bacteria 3874
460 Ga0207641_10144430 3300026088 Unclassified 2150
461 Ga0207648_10054260 3300026089 Bacteria 3501
462 Ga0207648_10142347 3300026089 Bacteria 2114
463 Ga0207648_10299165 3300026089 Bacteria 1443
464 Ga0207648_10419515 3300026089 Bacteria 1215
465 Ga0207648_10643837 3300026089 Bacteria 979
466 Ga0207676_10013730 3300026095 Bacteria 5816
467 Ga0207676_10015786 3300026095 Bacteria 5460
468 Ga0207676_10024481 3300026095 Bacteria 4467
469 Ga0207676_10092995 3300026095 Bacteria 2481
470 Ga0207676_10445851 3300026095 Bacteria 1219
471 Ga0207676_10686971 3300026095 Bacteria 990
472 Ga0207674_10044287 3300026116 Bacteria 4583
473 Ga0207674_10089366 3300026116 Bacteria 3073
474 Ga0207674_10103223 3300026116 Bacteria 2830
475 Ga0207674_10116688 3300026116 Bacteria 2640
476 Ga0207674_10188619 3300026116 Bacteria 2012
477 Ga0207675_100183167 3300026118 Bacteria 2006
478 Ga0207675_100284491 3300026118 Bacteria 1607
479 Ga0207675_100648726 3300026118 Bacteria 1062
480 Ga0207683_10340348 3300026121 Bacteria 1376
481 Ga0207683_10519333 3300026121 Bacteria 1100
482 Ga0207698_10001735 3300026142 Bacteria 12716
483 Ga0207698_10022132 3300026142 Bacteria 4410
484 Ga0207698_10100185 3300026142 Bacteria 2399
485 Ga0207698_10110495 3300026142 Unclassified 2303
486 Ga0207698_10145157 3300026142 Bacteria 2051
487 Ga0207698_10669981 3300026142 Bacteria 1029
488 Ga0268266_10001756 3300028379 Bacteria 24775
489 Ga0268266_10148108 3300028379 Bacteria 2113
490 Ga0268266_10190508 3300028379 Bacteria 1872
491 Ga0268265_10259590 3300028380 Unclassified 1544
492 Ga0268264_10000052 3300028381 Bacteria 321218
493 Ga0268264_10000866 3300028381 Bacteria 32068
494 Ga0268264_10001339 3300028381 Bacteria 23170
495 Ga0268264_10005535 3300028381 Bacteria 10709
496 Ga0268264_10027078 3300028381 Bacteria 4683
497 Ga0268264_10038092 3300028381 Bacteria 3967
498 Ga0268264_10307488 3300028381 Bacteria 1494
499 Ga0268264_10404140 3300028381 Bacteria 1313
500 Ga0265334_10125355 3300028573 Bacteria 916
501 Ga0307515_10000002 3300028794 Bacteria 1231751
502 Ga0307515_10000251 3300028794 Bacteria 132970
503 Ga0265338_10085936 3300028800 Bacteria 2620
504 Ga0307512_10153399 3300030522 Bacteria 1371
505 Ga0265340_10154448 3300031247 Bacteria 1045
506 Ga0265327_10000022 3300031251 Bacteria 402724
507 Ga0265327_10000284 3300031251 Bacteria 100178
508 Ga0265327_10001194 3300031251 Bacteria 35148
509 Ga0265327_10015061 3300031251 Bacteria 5020
510 Ga0307513_10214581 3300031456 Bacteria 1752
511 Ga0307509_10131699 3300031507 Bacteria 2455
512 Ga0307509_10188881 3300031507 Bacteria 1914
513 Ga0307509_10330883 3300031507 Bacteria 1255
514 Ga0307408_100260043 3300031548 Bacteria 1436
515 Ga0307508_10005225 3300031616 Bacteria 12417
516 Ga0307414_10045284 3300032004 Bacteria 3012
517 Ga0307414_10209239 3300032004 Bacteria 1593
518 Ga0373943_0234834 3300035170 Bacteria 1026
519 Ga0373946_0128162 3300035171 Bacteria 1165
520 Ga0395899_0037058 3300037312 Bacteria 3656
521 Ga0395900_0152030 3300037418 Bacteria 2364
522 Ga0395900_0198786 3300037418 Bacteria 2029
523 Ga0395900_0505618 3300037418 Bacteria 1158
524 Ga0395898_0039670 3300037466 Bacteria 4659
525 Ga0395898_0153424 3300037466 Bacteria 2203
526 Ga0395898_0202079 3300037466 Bacteria 1897
527 Ga0395905_0003301 3300037471 Bacteria 17319
528 Ga0395901_0660408 3300038443 Bacteria 1047
529 Ga0395901_0699579 3300038443 Bacteria 1011
530 Ga0436365_0581872 3300039437 Bacteria 1911
531 Ga0439436_0001312 3300041404 Bacteria 7125
532 Ga0439439_0003987 3300041406 Bacteria 3293
533 Ga0439439_0078483 3300041406 Bacteria 890
534 Ga0451791_0533578 3300041451 Bacteria 2311
535 Ga0451805_036005 3300041461 Bacteria 911
536 Ga0451847_0297619 3300041503 Bacteria 1035
537 Ga0451851_0414419 3300041507 Bacteria 1633
538 Ga0451843_1041452 3300041509 Bacteria 1591
539 Ga0439449_0001467 3300042007 Bacteria 9248
540 Ga0439457_040940 3300042014 Bacteria 1032
541 Ga0451577_0022176 3300042876 Bacteria 5799
542 Ga0451577_0023303 3300042876 Bacteria 5647
543 Ga0466972_0000083 3300044658 Bacteria 87204
544 Ga0453683_0139055 3300044673 Bacteria 1532
545 Ga0466965_0144883 3300044683 Bacteria 1239
546 Ga0466966_0000161 3300044684 Bacteria 43671
547 Ga0466961_0162672 3300044693 Bacteria 1391
548 Ga0453684_0000911 3300044712 Bacteria 98351
549 Ga0453684_0017043 3300044712 Bacteria 11282
550 Ga0453684_0036244 3300044712 Bacteria 6800
551 Ga0466971_0021968 3300044719 Bacteria 2840
552 Ga0466970_0013197 3300044765 Bacteria 4235
553 Ga0466970_0248528 3300044765 Bacteria 996
554 Ga0466957_0047767 3300044842 Bacteria 2601
555 Ga0466957_0094798 3300044842 Bacteria 1874
556 Ga0466959_0000005 3300045049 Bacteria 213958
557 Ga0466959_0000420 3300045049 Bacteria 24757
558 Ga0466959_0022647 3300045049 Bacteria 4645
559 Ga0495603_0182035 3300046455 Bacteria 1216
560 Ga0495638_0108006 3300046460 Bacteria 1656
561 Ga0495580_0137081 3300046472 Bacteria 1697
562 Ga0495606_0002264 3300046507 Bacteria 22818
563 Ga0495632_0179645 3300046519 Bacteria 970
564 Ga0495587_0086349 3300046536 Bacteria 1816
565 Ga0495668_0000677 3300046616 Bacteria 41080
566 Ga0495668_0001302 3300046616 Bacteria 24603
567 Ga0495668_0016891 3300046616 Bacteria 4238
568 Ga0495634_0249100 3300046642 Bacteria 1087
569 Ga0495611_0000176 3300046648 Bacteria 46302
570 Ga0495635_0164274 3300046663 Bacteria 1511
571 Ga0495649_0083988 3300046694 Bacteria 1701
572 Ga0495636_0000005 3300047318 Bacteria 108853
573 Ga0495672_0032051 3300047320 Bacteria 3274
574 Ga0495686_0000046 3300047472 Bacteria 281963
575 Ga0495686_0001990 3300047472 Bacteria 20285
576 Ga0496101_0132741 3300048904 Unclassified 1892
577 Ga0496106_0452880 3300048909 Bacteria 1031
578 Ga0496108_0040306 3300048911 Bacteria 3893
579 Ga0496110_0251303 3300048913 Bacteria 1609
580 Ga0496111_0388146 3300048914 Bacteria 1032
581 Ga0496114_0003713 3300048917 Bacteria 11753
582 Ga0501305_014700 3300049161 Bacteria 1098
583 Ga0501305_024342 3300049161 Bacteria 912
584 Ga0501324_004432 3300049540 Bacteria 1117
585 Ga0501033_0023956 3300049570 Bacteria 4605
586 Ga0501033_0072973 3300049570 Bacteria 2520
587 Ga0501033_0225095 3300049570 Bacteria 1334
588 Ga0501034_0000043 3300049571 Bacteria 229049
589 Ga0501034_0010730 3300049571 Bacteria 9514
590 Ga0501037_0002736 3300049573 Bacteria 12747
591 Ga0501038_0034775 3300049574 Bacteria 4428
592 Ga0501039_0367393 3300049575 Bacteria 1130
593 Ga0501043_0022380 3300049579 Bacteria 4958
594 Ga0501047_0016280 3300049581 Bacteria 7092
595 Ga0501070_0102442 3300049586 Bacteria 2368
596 Ga0501249_042812 3300049679 Bacteria 1030
597 Ga0501250_006975 3300049680 Bacteria 1209
598 Ga0501219_000824 3300049703 Bacteria 4012
599 Ga0501225_0002770 3300049705 Bacteria 5381
600 Ga0501245_010104 3300049708 Bacteria 1361
601 Ga0501241_004717 3300049758 Bacteria 2545
602 Ga0501268_002042 3300049765 Bacteria 2607
603 Ga0501035_0049487 3300049822 Bacteria 3766
604 Ga0501044_0008438 3300049823 Bacteria 11298
605 Ga0501044_0279307 3300049823 Bacteria 1604
606 Ga0501284_00116 3300050005 Bacteria 14911
607 nmdc:mga0k408_138065_c1 3300050493 Bacteria 1449
608 nmdc:mga0k408_14772_c1 3300050493 Bacteria 4308
609 nmdc:mga0k408_97694_c1 3300050493 Bacteria 1730
610 nmdc:mga05p37_122591_c1 3300050507 Bacteria 3193
611 nmdc:mga05p37_178216_c1 3300050507 Bacteria 2588
612 nmdc:mga08y16_80598_c1 3300050511 Bacteria 3394
613 nmdc:mga0rr50_564681_c1 3300050513 Bacteria 969
614 Ga0500578_0000066 3300053086 Bacteria 116854
615 Ga0500646_0003414 3300053090 Bacteria 4076
616 Ga0500646_0007293 3300053090 Bacteria 2824
617 Ga0500646_0012679 3300053090 Bacteria 2177
618 Ga0500583_0000002 3300053092 Bacteria 232826
619 Ga0500583_0090104 3300053092 Bacteria 1492
620 Ga0500583_0165604 3300053092 Bacteria 1101
621 Ga0500651_0293158 3300053093 Bacteria 935
622 Ga0500650_0111514 3300053098 Bacteria 1276
623 Ga0500556_0006964 3300053104 Bacteria 3223
624 Ga0500572_034009 3300053111 Bacteria 1441
625 Ga0500594_0027636 3300053118 Bacteria 1471
626 Ga0500594_0065086 3300053118 Bacteria 1060
627 Ga0500642_0010420 3300053130 Bacteria 3275
628 Ga0500652_056223 3300053131 Bacteria 1613
629 Ga0500652_088991 3300053131 Bacteria 1289
630 Ga0500589_090983 3300053147 Bacteria 1344
631 Ga0500616_0000717 3300053153 Bacteria 38423
632 Ga0500622_0044461 3300053156 Bacteria 2302
633 Ga0500627_0014027 3300053158 Unclassified 3059
634 Ga0500639_063419 3300053163 Bacteria 1900
635 Ga0500636_0053466 3300053177 Bacteria 2370
636 Ga0500637_0128012 3300053178 Bacteria 1473
637 Ga0500637_0156689 3300053178 Bacteria 1314
638 Ga0587090_008366 3300059510 Bacteria 1385
639 Ga0587069_016787 3300059642 Bacteria 1051
640 Ga0587079_022021 3300059647 Bacteria 1152
641 Ga0466962_0028556 3300061719 Bacteria 2672
642 Ga0466962_0099000 3300061719 Bacteria 1399

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025945 Ga0207679_10510913 Ga0207679_105109131 255
2 3300042876 Ga0451577_0023303 Ga0451577_0023303_4603_5373 255
3 3300044712 Ga0453684_0000911 Ga0453684_0000911_19434_20204 255
4 3300005841 Ga0068863_100169110 Ga0068863_1001691102 256
5 3300026088 Ga0207641_10144430 Ga0207641_101444302 256
6 3300002077 JGI24744J21845_10007225 JGI24744J21845_100072252 257
7 3300003316 rootH1_10037638 rootH1_100376382 257
8 3300003316 rootH1_10060262 rootH1_100602622 257
9 3300005459 Ga0068867_100047513 Ga0068867_1000475132 257
10 3300005578 Ga0068854_100019889 Ga0068854_1000198891 257
11 3300005843 Ga0068860_100000110 Ga0068860_10000011064 257
12 3300009176 Ga0105242_10027932 Ga0105242_100279323 257
13 3300025914 Ga0207671_10017094 Ga0207671_100170941 257
14 3300025934 Ga0207686_10070044 Ga0207686_100700443 257
15 3300025944 Ga0207661_10003174 Ga0207661_100031747 257
16 3300025949 Ga0207667_10000863 Ga0207667_1000086336 257
17 3300028380 Ga0268265_10259590 Ga0268265_102595901 257
18 3300028381 Ga0268264_10000052 Ga0268264_1000005266 257
19 3300005336 Ga0070680_100030596 Ga0070680_1000305962 258
20 3300005339 Ga0070660_100176587 Ga0070660_1001765872 258
21 3300005345 Ga0070692_10032937 Ga0070692_100329373 258
22 3300005455 Ga0070663_100006033 Ga0070663_1000060338 258
23 3300005458 Ga0070681_10026841 Ga0070681_100268416 258
24 3300005458 Ga0070681_10060634 Ga0070681_100606343 258
25 3300005578 Ga0068854_100329454 Ga0068854_1003294542 258
26 3300013102 Ga0157371_10027851 Ga0157371_100278514 258
27 3300013104 Ga0157370_10344141 Ga0157370_103441412 258
28 3300017792 Ga0163161_10001650 Ga0163161_1000165013 258
29 3300025917 Ga0207660_10027588 Ga0207660_100275882 258
30 3300025921 Ga0207652_10000482 Ga0207652_1000048232 258
31 3300025949 Ga0207667_10041764 Ga0207667_100417643 258
32 3300026067 Ga0207678_10017421 Ga0207678_100174211 258
33 3300031507 Ga0307509_10188881 Ga0307509_101888812 258
34 3300031616 Ga0307508_10005225 Ga0307508_100052257 258
35 3300035170 Ga0373943_0234834 Ga0373943_0234834_218_994 258
36 3300035171 Ga0373946_0128162 Ga0373946_0128162_213_989 258
37 3300037312 Ga0395899_0037058 Ga0395899_0037058_1076_1852 258
38 3300037418 Ga0395900_0152030 Ga0395900_0152030_370_1146 258
39 3300037466 Ga0395898_0039670 Ga0395898_0039670_2101_2877 258
40 3300038443 Ga0395901_0660408 Ga0395901_0660408_251_1027 258
41 3300038443 Ga0395901_0699579 Ga0395901_0699579_124_900 258
42 3300044712 Ga0453684_0017043 Ga0453684_0017043_10038_10814 258
43 3300003323 rootH1_10049407 rootH1_100494072 259
44 3300005331 Ga0070670_100378014 Ga0070670_1003780141 259
45 3300021384 Ga0213876_10003392 Ga0213876_100033924 259
46 3300049570 Ga0501033_0225095 Ga0501033_0225095_247_1026 259
47 iso_pu_bacteria 2881955468 2881955836 267
48 iso_pu_bacteria 2818991444 2819590619 268
49 iso_pu_bacteria 2818991460 2819678129 268
50 iso_pu_bacteria 2884791551 2884792976 268
51 iso_pu_bacteria 2896109856 2896110742 268
52 iso_pu_bacteria 2929177148 2929181162 268
53 iso_pu_bacteria 2929921140 2929925111 268
54 iso_pu_bacteria 2945977869 2945983564 268
55 iso_pu_bacteria 2946013367 2946017048 268
56 iso_pu_bacteria 8003151029 8003157308 268
57 3300013308 Ga0157375_10124671 Ga0157375_101246712 269
58 3300014325 Ga0163163_10369068 Ga0163163_103690682 269
59 3300014969 Ga0157376_10460684 Ga0157376_104606841 269
60 iso_pu_bacteria 2914759650 2914760537 269
61 3300002459 JGI24751J29686_10003268 JGI24751J29686_100032682 270
62 3300003320 rootH2_10023887 rootH2_1002388723 270
63 3300003320 rootH2_10036959 rootH2_100369594 270
64 3300003320 rootH2_10039737 rootH2_1003973729 270
65 3300003322 rootL2_10121090 rootL2_101210902 270
66 3300005288 Ga0065714_10158407 Ga0065714_101584071 270
67 3300005327 Ga0070658_10313126 Ga0070658_103131261 270
68 3300005329 Ga0070683_100007365 Ga0070683_1000073659 270
69 3300005330 Ga0070690_100012462 Ga0070690_1000124622 270
70 3300005331 Ga0070670_100012715 Ga0070670_1000127152 270
71 3300005331 Ga0070670_100281942 Ga0070670_1002819422 270
72 3300005334 Ga0068869_100063855 Ga0068869_1000638552 270
73 3300005335 Ga0070666_10000405 Ga0070666_100004059 270
74 3300005335 Ga0070666_10033238 Ga0070666_100332383 270
75 3300005335 Ga0070666_10245363 Ga0070666_102453632 270
76 3300005338 Ga0068868_100029305 Ga0068868_1000293052 270
77 3300005338 Ga0068868_100263750 Ga0068868_1002637502 270
78 3300005347 Ga0070668_100045583 Ga0070668_1000455832 270
79 3300005353 Ga0070669_100295363 Ga0070669_1002953632 270
80 3300005354 Ga0070675_100014089 Ga0070675_1000140894 270
81 3300005355 Ga0070671_100025983 Ga0070671_1000259836 270
82 3300005355 Ga0070671_100094148 Ga0070671_1000941482 270
83 3300005355 Ga0070671_100522591 Ga0070671_1005225911 270
84 3300005356 Ga0070674_100220644 Ga0070674_1002206442 270
85 3300005364 Ga0070673_100033853 Ga0070673_1000338535 270
86 3300005364 Ga0070673_100171632 Ga0070673_1001716322 270
87 3300005367 Ga0070667_100013268 Ga0070667_1000132683 270
88 3300005367 Ga0070667_100023091 Ga0070667_1000230912 270
89 3300005367 Ga0070667_100229230 Ga0070667_1002292302 270
90 3300005367 Ga0070667_100408172 Ga0070667_1004081722 270
91 3300005436 Ga0070713_100193657 Ga0070713_1001936572 270
92 3300005455 Ga0070663_100111515 Ga0070663_1001115152 270
93 3300005456 Ga0070678_100016086 Ga0070678_1000160864 270
94 3300005468 Ga0070707_100659724 Ga0070707_1006597241 270
95 3300005471 Ga0070698_100072057 Ga0070698_1000720575 270
96 3300005535 Ga0070684_100078284 Ga0070684_1000782842 270
97 3300005539 Ga0068853_100048178 Ga0068853_1000481781 270
98 3300005539 Ga0068853_100150047 Ga0068853_1001500472 270
99 3300005539 Ga0068853_100418174 Ga0068853_1004181742 270
100 3300005543 Ga0070672_100038875 Ga0070672_1000388754 270
101 3300005543 Ga0070672_100345598 Ga0070672_1003455982 270
102 3300005543 Ga0070672_100410391 Ga0070672_1004103912 270
103 3300005563 Ga0068855_100000454 Ga0068855_10000045435 270
104 3300005563 Ga0068855_100031788 Ga0068855_1000317888 270
105 3300005564 Ga0070664_100027583 Ga0070664_1000275835 270
106 3300005614 Ga0068856_100053444 Ga0068856_1000534444 270
107 3300005615 Ga0070702_100014040 Ga0070702_1000140403 270
108 3300005616 Ga0068852_100242365 Ga0068852_1002423652 270
109 3300005617 Ga0068859_100000066 Ga0068859_10000006644 270
110 3300005617 Ga0068859_100001623 Ga0068859_10000162316 270
111 3300005617 Ga0068859_100063196 Ga0068859_1000631962 270
112 3300005618 Ga0068864_100028412 Ga0068864_1000284123 270
113 3300005719 Ga0068861_100375319 Ga0068861_1003753192 270
114 3300005840 Ga0068870_10192658 Ga0068870_101926582 270
115 3300005841 Ga0068863_100002306 Ga0068863_10000230611 270
116 3300005842 Ga0068858_100038172 Ga0068858_1000381725 270
117 3300005843 Ga0068860_100013138 Ga0068860_1000131383 270
118 3300005983 Ga0081540_1003257 Ga0081540_100325710 270
119 3300006237 Ga0097621_100003131 Ga0097621_1000031313 270
120 3300006358 Ga0068871_100033494 Ga0068871_1000334942 270
121 3300006358 Ga0068871_100078588 Ga0068871_1000785882 270
122 3300006358 Ga0068871_100084185 Ga0068871_1000841852 270
123 3300006358 Ga0068871_100419007 Ga0068871_1004190071 270
124 3300006931 Ga0097620_100000066 Ga0097620_10000006644 270
125 3300006931 Ga0097620_100001623 Ga0097620_10000162316 270
126 3300006931 Ga0097620_100063194 Ga0097620_1000631944 270
127 3300009093 Ga0105240_10005924 Ga0105240_100059242 270
128 3300009093 Ga0105240_10091853 Ga0105240_100918534 270
129 3300009093 Ga0105240_10135039 Ga0105240_101350392 270
130 3300009093 Ga0105240_10734729 Ga0105240_107347291 270
131 3300009094 Ga0111539_10090504 Ga0111539_100905044 270
132 3300009094 Ga0111539_10314816 Ga0111539_103148161 270
133 3300009094 Ga0111539_10505190 Ga0111539_105051902 270
134 3300009147 Ga0114129_10149716 Ga0114129_101497162 270
135 3300009147 Ga0114129_10203136 Ga0114129_102031362 270
136 3300009174 Ga0105241_10001740 Ga0105241_100017406 270
137 3300009174 Ga0105241_10198225 Ga0105241_101982252 270
138 3300009176 Ga0105242_10464911 Ga0105242_104649112 270
139 3300009545 Ga0105237_10000169 Ga0105237_1000016938 270
140 3300009545 Ga0105237_10003163 Ga0105237_100031635 270
141 3300009545 Ga0105237_10010869 Ga0105237_100108698 270
142 3300009551 Ga0105238_10145101 Ga0105238_101451012 270
143 3300009553 Ga0105249_10003050 Ga0105249_100030505 270
144 3300010375 Ga0105239_10000754 Ga0105239_1000075417 270
145 3300010375 Ga0105239_10002487 Ga0105239_100024874 270
146 3300010375 Ga0105239_10005357 Ga0105239_100053579 270
147 3300010375 Ga0105239_10008603 Ga0105239_100086036 270
148 3300010375 Ga0105239_10158780 Ga0105239_101587802 270
149 3300013100 Ga0157373_10163411 Ga0157373_101634111 270
150 3300013104 Ga0157370_10034962 Ga0157370_100349626 270
151 3300013105 Ga0157369_10015852 Ga0157369_100158529 270
152 3300013296 Ga0157374_10000003 Ga0157374_10000003627 270
153 3300013296 Ga0157374_10067635 Ga0157374_100676354 270
154 3300013296 Ga0157374_10175761 Ga0157374_101757612 270
155 3300013296 Ga0157374_10374974 Ga0157374_103749741 270
156 3300013297 Ga0157378_10004660 Ga0157378_100046607 270
157 3300013297 Ga0157378_10032884 Ga0157378_100328844 270
158 3300013297 Ga0157378_10122580 Ga0157378_101225804 270
159 3300013297 Ga0157378_10155091 Ga0157378_101550912 270
160 3300013306 Ga0163162_10001227 Ga0163162_1000122719 270
161 3300013306 Ga0163162_10001762 Ga0163162_1000176211 270
162 3300013306 Ga0163162_10213484 Ga0163162_102134842 270
163 3300013306 Ga0163162_10797564 Ga0163162_107975641 270
164 3300013307 Ga0157372_10003000 Ga0157372_1000300016 270
165 3300013307 Ga0157372_10008075 Ga0157372_100080759 270
166 3300013308 Ga0157375_10127388 Ga0157375_101273882 270
167 3300013308 Ga0157375_10369254 Ga0157375_103692542 270
168 3300014326 Ga0157380_10049045 Ga0157380_100490451 270
169 3300014968 Ga0157379_10195094 Ga0157379_101950942 270
170 3300014968 Ga0157379_10285357 Ga0157379_102853571 270
171 3300014968 Ga0157379_10394574 Ga0157379_103945741 270
172 3300014969 Ga0157376_10003452 Ga0157376_100034524 270
173 3300014969 Ga0157376_10015110 Ga0157376_100151104 270
174 3300014969 Ga0157376_10548763 Ga0157376_105487632 270
175 3300017792 Ga0163161_10017780 Ga0163161_100177802 270
176 3300017792 Ga0163161_10156927 Ga0163161_101569272 270
177 3300025315 Ga0207697_10203441 Ga0207697_102034411 270
178 3300025893 Ga0207682_10160581 Ga0207682_101605811 270
179 3300025903 Ga0207680_10000143 Ga0207680_1000014313 270
180 3300025903 Ga0207680_10075353 Ga0207680_100753531 270
181 3300025903 Ga0207680_10096463 Ga0207680_100964632 270
182 3300025904 Ga0207647_10062127 Ga0207647_100621272 270
183 3300025911 Ga0207654_10150599 Ga0207654_101505992 270
184 3300025913 Ga0207695_10000021 Ga0207695_10000021477 270
185 3300025913 Ga0207695_10000039 Ga0207695_1000003930 270
186 3300025913 Ga0207695_10000073 Ga0207695_10000073229 270
187 3300025913 Ga0207695_10090834 Ga0207695_100908342 270
188 3300025914 Ga0207671_10001328 Ga0207671_1000132823 270
189 3300025914 Ga0207671_10001491 Ga0207671_1000149115 270
190 3300025914 Ga0207671_10028520 Ga0207671_100285202 270
191 3300025918 Ga0207662_10004354 Ga0207662_100043547 270
192 3300025925 Ga0207650_10269656 Ga0207650_102696562 270
193 3300025926 Ga0207659_10023973 Ga0207659_100239732 270
194 3300025926 Ga0207659_10116451 Ga0207659_101164512 270
195 3300025931 Ga0207644_10254019 Ga0207644_102540192 270
196 3300025937 Ga0207669_10027446 Ga0207669_100274462 270
197 3300025937 Ga0207669_10319850 Ga0207669_103198502 270
198 3300025938 Ga0207704_10085048 Ga0207704_100850481 270
199 3300025940 Ga0207691_10030028 Ga0207691_100300282 270
200 3300025940 Ga0207691_10311167 Ga0207691_103111672 270
201 3300025940 Ga0207691_10664107 Ga0207691_106641071 270
202 3300025942 Ga0207689_10165974 Ga0207689_101659742 270
203 3300025945 Ga0207679_10050891 Ga0207679_100508912 270
204 3300025949 Ga0207667_10014746 Ga0207667_100147461 270
205 3300025949 Ga0207667_10052940 Ga0207667_100529402 270
206 3300025960 Ga0207651_10031997 Ga0207651_100319973 270
207 3300025960 Ga0207651_10070432 Ga0207651_100704322 270
208 3300025960 Ga0207651_10211190 Ga0207651_102111902 270
209 3300025961 Ga0207712_10007340 Ga0207712_100073404 270
210 3300025972 Ga0207668_10083812 Ga0207668_100838122 270
211 3300025986 Ga0207658_10013185 Ga0207658_100131855 270
212 3300025986 Ga0207658_10376137 Ga0207658_103761371 270
213 3300025986 Ga0207658_10578393 Ga0207658_105783931 270
214 3300026023 Ga0207677_10266859 Ga0207677_102668592 270
215 3300026035 Ga0207703_10002420 Ga0207703_100024206 270
216 3300026035 Ga0207703_10427421 Ga0207703_104274211 270
217 3300026041 Ga0207639_10018037 Ga0207639_100180375 270
218 3300026041 Ga0207639_10078816 Ga0207639_100788162 270
219 3300026041 Ga0207639_10127926 Ga0207639_101279262 270
220 3300026078 Ga0207702_10514583 Ga0207702_105145831 270
221 3300026088 Ga0207641_10000828 Ga0207641_1000082816 270
222 3300026089 Ga0207648_10142347 Ga0207648_101423472 270
223 3300026095 Ga0207676_10015786 Ga0207676_100157866 270
224 3300026095 Ga0207676_10024481 Ga0207676_100244813 270
225 3300026095 Ga0207676_10092995 Ga0207676_100929953 270
226 3300026095 Ga0207676_10445851 Ga0207676_104458512 270
227 3300026116 Ga0207674_10044287 Ga0207674_100442874 270
228 3300026116 Ga0207674_10188619 Ga0207674_101886192 270
229 3300026118 Ga0207675_100183167 Ga0207675_1001831672 270
230 3300026121 Ga0207683_10340348 Ga0207683_103403482 270
231 3300026121 Ga0207683_10519333 Ga0207683_105193332 270
232 3300026142 Ga0207698_10100185 Ga0207698_101001852 270
233 3300028381 Ga0268264_10000866 Ga0268264_1000086626 270
234 3300028381 Ga0268264_10001339 Ga0268264_100013392 270
235 3300028381 Ga0268264_10005535 Ga0268264_100055353 270
236 3300028573 Ga0265334_10125355 Ga0265334_101253551 270
237 3300028794 Ga0307515_10000002 Ga0307515_10000002623 270
238 3300028794 Ga0307515_10000251 Ga0307515_1000025192 270
239 3300030522 Ga0307512_10153399 Ga0307512_101533992 270
240 3300031251 Ga0265327_10001194 Ga0265327_1000119419 270
241 3300031456 Ga0307513_10214581 Ga0307513_102145812 270
242 3300031507 Ga0307509_10131699 Ga0307509_101316992 270
243 3300031507 Ga0307509_10330883 Ga0307509_103308832 270
244 3300032004 Ga0307414_10209239 Ga0307414_102092392 270
245 3300041404 Ga0439436_0001312 Ga0439436_0001312_2184_2996 270
246 3300041406 Ga0439439_0003987 Ga0439439_0003987_80_892 270
247 3300041406 Ga0439439_0078483 Ga0439439_0078483_26_838 270
248 3300041451 Ga0451791_0533578 Ga0451791_0533578_348_1160 270
249 3300041461 Ga0451805_036005 Ga0451805_036005_79_891 270
250 3300041503 Ga0451847_0297619 Ga0451847_0297619_39_851 270
251 3300041507 Ga0451851_0414419 Ga0451851_0414419_562_1374 270
252 3300041509 Ga0451843_1041452 Ga0451843_1041452_318_1172 270
253 3300042007 Ga0439449_0001467 Ga0439449_0001467_1003_1815 270
254 3300042014 Ga0439457_040940 Ga0439457_040940_111_1007 270
255 3300042876 Ga0451577_0022176 Ga0451577_0022176_1043_1858 270
256 3300044658 Ga0466972_0000083 Ga0466972_0000083_34452_35264 270
257 3300044683 Ga0466965_0144883 Ga0466965_0144883_213_1025 270
258 3300044684 Ga0466966_0000161 Ga0466966_0000161_37671_38483 270
259 3300044693 Ga0466961_0162672 Ga0466961_0162672_109_921 270
260 3300044719 Ga0466971_0021968 Ga0466971_0021968_825_1637 270
261 3300044765 Ga0466970_0013197 Ga0466970_0013197_172_984 270
262 3300044765 Ga0466970_0248528 Ga0466970_0248528_120_932 270
263 3300044842 Ga0466957_0047767 Ga0466957_0047767_1335_2147 270
264 3300044842 Ga0466957_0094798 Ga0466957_0094798_50_862 270
265 3300045049 Ga0466959_0000005 Ga0466959_0000005_60119_60931 270
266 3300045049 Ga0466959_0000420 Ga0466959_0000420_14264_15076 270
267 3300046472 Ga0495580_0137081 Ga0495580_0137081_351_1163 270
268 3300046507 Ga0495606_0002264 Ga0495606_0002264_13443_14255 270
269 3300046519 Ga0495632_0179645 Ga0495632_0179645_50_862 270
270 3300046616 Ga0495668_0001302 Ga0495668_0001302_6833_7645 270
271 3300046616 Ga0495668_0016891 Ga0495668_0016891_1145_1957 270
272 3300046642 Ga0495634_0249100 Ga0495634_0249100_33_845 270
273 3300046648 Ga0495611_0000176 Ga0495611_0000176_5221_6033 270
274 3300046663 Ga0495635_0164274 Ga0495635_0164274_161_1039 270
275 3300046694 Ga0495649_0083988 Ga0495649_0083988_754_1566 270
276 3300047320 Ga0495672_0032051 Ga0495672_0032051_1957_2769 270
277 3300047472 Ga0495686_0000046 Ga0495686_0000046_270644_271456 270
278 3300049161 Ga0501305_014700 Ga0501305_014700_267_1079 270
279 3300049570 Ga0501033_0023956 Ga0501033_0023956_24_977 270
280 3300049570 Ga0501033_0072973 Ga0501033_0072973_1070_1882 270
281 3300049571 Ga0501034_0000043 Ga0501034_0000043_129008_129820 270
282 3300049573 Ga0501037_0002736 Ga0501037_0002736_4686_5498 270
283 3300049574 Ga0501038_0034775 Ga0501038_0034775_3425_4378 270
284 3300049575 Ga0501039_0367393 Ga0501039_0367393_114_1067 270
285 3300049579 Ga0501043_0022380 Ga0501043_0022380_482_1294 270
286 3300049581 Ga0501047_0016280 Ga0501047_0016280_4225_5037 270
287 3300049703 Ga0501219_000824 Ga0501219_000824_949_1761 270
288 3300049705 Ga0501225_0002770 Ga0501225_0002770_1291_2103 270
289 3300049758 Ga0501241_004717 Ga0501241_004717_1707_2519 270
290 3300049823 Ga0501044_0008438 Ga0501044_0008438_6355_7167 270
291 3300049823 Ga0501044_0279307 Ga0501044_0279307_745_1557 270
292 3300050005 Ga0501284_00116 Ga0501284_00116_6547_7359 270
293 3300050493 nmdc:mga0k408_138065_c1 nmdc:mga0k408_138065_c1_316_1128 270
294 3300050493 nmdc:mga0k408_14772_c1 nmdc:mga0k408_14772_c1_479_1291 270
295 3300050493 nmdc:mga0k408_97694_c1 nmdc:mga0k408_97694_c1_205_1017 270
296 3300050507 nmdc:mga05p37_122591_c1 nmdc:mga05p37_122591_c1_1467_2279 270
297 3300050507 nmdc:mga05p37_178216_c1 nmdc:mga05p37_178216_c1_1205_2017 270
298 3300050511 nmdc:mga08y16_80598_c1 nmdc:mga08y16_80598_c1_353_1165 270
299 3300053086 Ga0500578_0000066 Ga0500578_0000066_19439_20251 270
300 3300053090 Ga0500646_0003414 Ga0500646_0003414_52_864 270
301 3300053090 Ga0500646_0007293 Ga0500646_0007293_1960_2772 270
302 3300053092 Ga0500583_0000002 Ga0500583_0000002_65433_66245 270
303 3300053092 Ga0500583_0090104 Ga0500583_0090104_231_1043 270
304 3300053092 Ga0500583_0165604 Ga0500583_0165604_197_1009 270
305 3300053098 Ga0500650_0111514 Ga0500650_0111514_225_1037 270
306 3300053111 Ga0500572_034009 Ga0500572_034009_368_1180 270
307 3300053118 Ga0500594_0027636 Ga0500594_0027636_224_1036 270
308 3300053118 Ga0500594_0065086 Ga0500594_0065086_15_827 270
309 3300053131 Ga0500652_056223 Ga0500652_056223_23_835 270
310 3300053131 Ga0500652_088991 Ga0500652_088991_301_1113 270
311 3300053147 Ga0500589_090983 Ga0500589_090983_435_1247 270
312 3300053156 Ga0500622_0044461 Ga0500622_0044461_1288_2100 270
313 3300053163 Ga0500639_063419 Ga0500639_063419_119_931 270
314 3300053177 Ga0500636_0053466 Ga0500636_0053466_413_1225 270
315 3300053178 Ga0500637_0128012 Ga0500637_0128012_29_841 270
316 3300053178 Ga0500637_0156689 Ga0500637_0156689_174_986 270
317 3300059510 Ga0587090_008366 Ga0587090_008366_123_935 270
318 3300061719 Ga0466962_0028556 Ga0466962_0028556_771_1583 270
319 3300061719 Ga0466962_0099000 Ga0466962_0099000_13_825 270
320 3300005290 Ga0065712_10005826 Ga0065712_100058263 271
321 3300005295 Ga0065707_10133515 Ga0065707_101335151 271
322 3300005327 Ga0070658_10103899 Ga0070658_101038992 271
323 3300005327 Ga0070658_10139188 Ga0070658_101391882 271
324 3300005327 Ga0070658_10288388 Ga0070658_102883881 271
325 3300005328 Ga0070676_10229488 Ga0070676_102294882 271
326 3300005329 Ga0070683_100103100 Ga0070683_1001031002 271
327 3300005330 Ga0070690_100027906 Ga0070690_1000279063 271
328 3300005330 Ga0070690_100180710 Ga0070690_1001807101 271
329 3300005334 Ga0068869_100035983 Ga0068869_1000359833 271
330 3300005335 Ga0070666_10010658 Ga0070666_100106585 271
331 3300005335 Ga0070666_10083236 Ga0070666_100832362 271
332 3300005336 Ga0070680_100058177 Ga0070680_1000581772 271
333 3300005338 Ga0068868_100001043 Ga0068868_1000010436 271
334 3300005338 Ga0068868_100029643 Ga0068868_1000296432 271
335 3300005338 Ga0068868_100065320 Ga0068868_1000653203 271
336 3300005339 Ga0070660_100057247 Ga0070660_1000572472 271
337 3300005339 Ga0070660_100082570 Ga0070660_1000825702 271
338 3300005340 Ga0070689_100004681 Ga0070689_1000046816 271
339 3300005340 Ga0070689_100052935 Ga0070689_1000529352 271
340 3300005340 Ga0070689_100477535 Ga0070689_1004775351 271
341 3300005344 Ga0070661_100024249 Ga0070661_1000242492 271
342 3300005344 Ga0070661_100053597 Ga0070661_1000535972 271
343 3300005355 Ga0070671_100011489 Ga0070671_1000114893 271
344 3300005355 Ga0070671_100194614 Ga0070671_1001946142 271
345 3300005355 Ga0070671_100388927 Ga0070671_1003889271 271
346 3300005364 Ga0070673_100381374 Ga0070673_1003813741 271
347 3300005365 Ga0070688_100103808 Ga0070688_1001038082 271
348 3300005366 Ga0070659_100004541 Ga0070659_1000045411 271
349 3300005366 Ga0070659_100025849 Ga0070659_1000258491 271
350 3300005367 Ga0070667_100007177 Ga0070667_1000071772 271
351 3300005367 Ga0070667_100103143 Ga0070667_1001031432 271
352 3300005455 Ga0070663_100152503 Ga0070663_1001525032 271
353 3300005455 Ga0070663_100246379 Ga0070663_1002463792 271
354 3300005456 Ga0070678_100088325 Ga0070678_1000883252 271
355 3300005456 Ga0070678_100174740 Ga0070678_1001747401 271
356 3300005457 Ga0070662_100036587 Ga0070662_1000365874 271
357 3300005457 Ga0070662_100046457 Ga0070662_1000464572 271
358 3300005457 Ga0070662_100085275 Ga0070662_1000852752 271
359 3300005457 Ga0070662_100163292 Ga0070662_1001632922 271
360 3300005459 Ga0068867_100012719 Ga0068867_1000127196 271
361 3300005459 Ga0068867_100165149 Ga0068867_1001651492 271
362 3300005466 Ga0070685_10012051 Ga0070685_100120513 271
363 3300005466 Ga0070685_10034567 Ga0070685_100345672 271
364 3300005466 Ga0070685_10128041 Ga0070685_101280412 271
365 3300005530 Ga0070679_100138696 Ga0070679_1001386962 271
366 3300005535 Ga0070684_100001060 Ga0070684_1000010603 271
367 3300005535 Ga0070684_100022621 Ga0070684_1000226214 271
368 3300005535 Ga0070684_100089894 Ga0070684_1000898942 271
369 3300005535 Ga0070684_100379922 Ga0070684_1003799221 271
370 3300005539 Ga0068853_100077297 Ga0068853_1000772973 271
371 3300005539 Ga0068853_100134554 Ga0068853_1001345542 271
372 3300005539 Ga0068853_100170495 Ga0068853_1001704951 271
373 3300005544 Ga0070686_100154546 Ga0070686_1001545461 271
374 3300005547 Ga0070693_100077813 Ga0070693_1000778132 271
375 3300005548 Ga0070665_100141662 Ga0070665_1001416622 271
376 3300005548 Ga0070665_100389507 Ga0070665_1003895072 271
377 3300005563 Ga0068855_100138912 Ga0068855_1001389122 271
378 3300005563 Ga0068855_100224891 Ga0068855_1002248912 271
379 3300005563 Ga0068855_100448125 Ga0068855_1004481251 271
380 3300005563 Ga0068855_100708557 Ga0068855_1007085572 271
381 3300005564 Ga0070664_100018360 Ga0070664_1000183605 271
382 3300005564 Ga0070664_100059706 Ga0070664_1000597063 271
383 3300005564 Ga0070664_100087009 Ga0070664_1000870092 271
384 3300005564 Ga0070664_100554759 Ga0070664_1005547592 271
385 3300005577 Ga0068857_100102812 Ga0068857_1001028122 271
386 3300005577 Ga0068857_100368370 Ga0068857_1003683702 271
387 3300005614 Ga0068856_100515544 Ga0068856_1005155442 271
388 3300005615 Ga0070702_100121376 Ga0070702_1001213762 271
389 3300005616 Ga0068852_100001575 Ga0068852_1000015757 271
390 3300005616 Ga0068852_100011253 Ga0068852_1000112534 271
391 3300005616 Ga0068852_100298934 Ga0068852_1002989342 271
392 3300005617 Ga0068859_100027738 Ga0068859_1000277383 271
393 3300005618 Ga0068864_100111734 Ga0068864_1001117342 271
394 3300005618 Ga0068864_100116222 Ga0068864_1001162222 271
395 3300005618 Ga0068864_100156939 Ga0068864_1001569392 271
396 3300005719 Ga0068861_100875882 Ga0068861_1008758821 271
397 3300005834 Ga0068851_10173881 Ga0068851_101738812 271
398 3300005841 Ga0068863_100049329 Ga0068863_1000493293 271
399 3300005841 Ga0068863_100082885 Ga0068863_1000828854 271
400 3300005842 Ga0068858_100068991 Ga0068858_1000689912 271
401 3300005842 Ga0068858_100257394 Ga0068858_1002573942 271
402 3300005843 Ga0068860_100037206 Ga0068860_1000372063 271
403 3300005985 Ga0081539_10039886 Ga0081539_100398862 271
404 3300006237 Ga0097621_100000138 Ga0097621_10000013826 271
405 3300006237 Ga0097621_100037073 Ga0097621_1000370734 271
406 3300006358 Ga0068871_100000427 Ga0068871_10000042718 271
407 3300006358 Ga0068871_100176821 Ga0068871_1001768212 271
408 3300006358 Ga0068871_100226029 Ga0068871_1002260292 271
409 3300006881 Ga0068865_100071937 Ga0068865_1000719372 271
410 3300006931 Ga0097620_100027737 Ga0097620_1000277375 271
411 3300009093 Ga0105240_10070611 Ga0105240_100706112 271
412 3300009101 Ga0105247_10159994 Ga0105247_101599941 271
413 3300009174 Ga0105241_10003183 Ga0105241_100031836 271
414 3300009174 Ga0105241_10220468 Ga0105241_102204682 271
415 3300009174 Ga0105241_10618256 Ga0105241_106182561 271
416 3300009176 Ga0105242_10032178 Ga0105242_100321781 271
417 3300009176 Ga0105242_10115977 Ga0105242_101159772 271
418 3300009177 Ga0105248_10064081 Ga0105248_100640813 271
419 3300009177 Ga0105248_10260181 Ga0105248_102601812 271
420 3300009553 Ga0105249_10035946 Ga0105249_100359464 271
421 3300009553 Ga0105249_10926989 Ga0105249_109269891 271
422 3300009553 Ga0105249_10928837 Ga0105249_109288371 271
423 3300010375 Ga0105239_10037412 Ga0105239_100374122 271
424 3300010375 Ga0105239_10089339 Ga0105239_100893393 271
425 3300013100 Ga0157373_10004634 Ga0157373_100046343 271
426 3300013100 Ga0157373_10005619 Ga0157373_100056194 271
427 3300013100 Ga0157373_10048858 Ga0157373_100488583 271
428 3300013100 Ga0157373_10053606 Ga0157373_100536062 271
429 3300013102 Ga0157371_10026384 Ga0157371_100263845 271
430 3300013102 Ga0157371_10049953 Ga0157371_100499532 271
431 3300013102 Ga0157371_10058720 Ga0157371_100587202 271
432 3300013102 Ga0157371_10115068 Ga0157371_101150681 271
433 3300013102 Ga0157371_10409180 Ga0157371_104091802 271
434 3300013102 Ga0157371_10517603 Ga0157371_105176031 271
435 3300013104 Ga0157370_10000847 Ga0157370_1000084710 271
436 3300013104 Ga0157370_10197767 Ga0157370_101977671 271
437 3300013104 Ga0157370_10199633 Ga0157370_101996331 271
438 3300013105 Ga0157369_10107545 Ga0157369_101075451 271
439 3300013105 Ga0157369_10113362 Ga0157369_101133623 271
440 3300013105 Ga0157369_10135489 Ga0157369_101354891 271
441 3300013296 Ga0157374_10008277 Ga0157374_100082779 271
442 3300013296 Ga0157374_10095980 Ga0157374_100959801 271
443 3300013296 Ga0157374_10143139 Ga0157374_101431392 271
444 3300013296 Ga0157374_10233842 Ga0157374_102338422 271
445 3300013297 Ga0157378_10008839 Ga0157378_100088394 271
446 3300013297 Ga0157378_10131040 Ga0157378_101310401 271
447 3300013306 Ga0163162_10000531 Ga0163162_1000053126 271
448 3300013306 Ga0163162_10002874 Ga0163162_100028746 271
449 3300013306 Ga0163162_10004040 Ga0163162_100040407 271
450 3300013307 Ga0157372_10032019 Ga0157372_100320193 271
451 3300013307 Ga0157372_10090924 Ga0157372_100909243 271
452 3300013307 Ga0157372_10106290 Ga0157372_101062903 271
453 3300013307 Ga0157372_10191432 Ga0157372_101914322 271
454 3300013307 Ga0157372_10254565 Ga0157372_102545652 271
455 3300013307 Ga0157372_10395154 Ga0157372_103951541 271
456 3300013307 Ga0157372_10963571 Ga0157372_109635711 271
457 3300013308 Ga0157375_10000230 Ga0157375_1000023030 271
458 3300013308 Ga0157375_10010831 Ga0157375_100108315 271
459 3300013308 Ga0157375_10061338 Ga0157375_100613383 271
460 3300013308 Ga0157375_10289848 Ga0157375_102898482 271
461 3300013308 Ga0157375_10456092 Ga0157375_104560921 271
462 3300014325 Ga0163163_10000614 Ga0163163_1000061421 271
463 3300014325 Ga0163163_10053372 Ga0163163_100533725 271
464 3300014326 Ga0157380_10052530 Ga0157380_100525302 271
465 3300014326 Ga0157380_10167251 Ga0157380_101672512 271
466 3300014745 Ga0157377_10037738 Ga0157377_100377382 271
467 3300014745 Ga0157377_10086373 Ga0157377_100863732 271
468 3300014745 Ga0157377_10103218 Ga0157377_101032182 271
469 3300014968 Ga0157379_10011164 Ga0157379_100111646 271
470 3300014968 Ga0157379_10068753 Ga0157379_100687532 271
471 3300014968 Ga0157379_10117764 Ga0157379_101177642 271
472 3300014969 Ga0157376_10004496 Ga0157376_1000449610 271
473 3300014969 Ga0157376_10057402 Ga0157376_100574023 271
474 3300014969 Ga0157376_10065140 Ga0157376_100651402 271
475 3300014969 Ga0157376_10592730 Ga0157376_105927302 271
476 3300017792 Ga0163161_10006264 Ga0163161_100062643 271
477 3300020078 Ga0206352_11134895 Ga0206352_111348951 271
478 3300025246 Ga0209646_1004259 Ga0209646_10042592 271
479 3300025315 Ga0207697_10016623 Ga0207697_100166233 271
480 3300025899 Ga0207642_10021805 Ga0207642_100218052 271
481 3300025899 Ga0207642_10256318 Ga0207642_102563181 271
482 3300025903 Ga0207680_10067370 Ga0207680_100673702 271
483 3300025903 Ga0207680_10175033 Ga0207680_101750332 271
484 3300025903 Ga0207680_10186055 Ga0207680_101860552 271
485 3300025903 Ga0207680_10233067 Ga0207680_102330671 271
486 3300025904 Ga0207647_10001743 Ga0207647_1000174311 271
487 3300025904 Ga0207647_10011936 Ga0207647_100119362 271
488 3300025904 Ga0207647_10024176 Ga0207647_100241762 271
489 3300025907 Ga0207645_10036386 Ga0207645_100363863 271
490 3300025909 Ga0207705_10058647 Ga0207705_100586472 271
491 3300025909 Ga0207705_10116141 Ga0207705_101161412 271
492 3300025909 Ga0207705_10118921 Ga0207705_101189211 271
493 3300025911 Ga0207654_10199401 Ga0207654_101994012 271
494 3300025912 Ga0207707_10090968 Ga0207707_100909682 271
495 3300025912 Ga0207707_10226067 Ga0207707_102260672 271
496 3300025913 Ga0207695_10018494 Ga0207695_100184942 271
497 3300025917 Ga0207660_10164087 Ga0207660_101640872 271
498 3300025919 Ga0207657_10180225 Ga0207657_101802251 271
499 3300025920 Ga0207649_10003293 Ga0207649_100032932 271
500 3300025921 Ga0207652_10109714 Ga0207652_101097143 271
501 3300025923 Ga0207681_10477093 Ga0207681_104770931 271
502 3300025925 Ga0207650_10003184 Ga0207650_100031845 271
503 3300025925 Ga0207650_10036073 Ga0207650_100360732 271
504 3300025931 Ga0207644_10006165 Ga0207644_100061656 271
505 3300025931 Ga0207644_10618286 Ga0207644_106182861 271
506 3300025932 Ga0207690_10051717 Ga0207690_100517172 271
507 3300025932 Ga0207690_10141394 Ga0207690_101413942 271
508 3300025933 Ga0207706_10005379 Ga0207706_1000537913 271
509 3300025933 Ga0207706_10065416 Ga0207706_100654163 271
510 3300025934 Ga0207686_10037798 Ga0207686_100377981 271
511 3300025934 Ga0207686_10217137 Ga0207686_102171372 271
512 3300025936 Ga0207670_10040394 Ga0207670_100403942 271
513 3300025938 Ga0207704_10379295 Ga0207704_103792951 271
514 3300025940 Ga0207691_10017192 Ga0207691_100171926 271
515 3300025940 Ga0207691_10362788 Ga0207691_103627882 271
516 3300025941 Ga0207711_10109404 Ga0207711_101094042 271
517 3300025942 Ga0207689_10005086 Ga0207689_100050869 271
518 3300025942 Ga0207689_10038240 Ga0207689_100382401 271
519 3300025942 Ga0207689_10047713 Ga0207689_100477132 271
520 3300025942 Ga0207689_10194816 Ga0207689_101948161 271
521 3300025944 Ga0207661_10015292 Ga0207661_100152924 271
522 3300025944 Ga0207661_10036535 Ga0207661_100365354 271
523 3300025949 Ga0207667_10033976 Ga0207667_100339762 271
524 3300025949 Ga0207667_10451415 Ga0207667_104514151 271
525 3300025949 Ga0207667_10626661 Ga0207667_106266612 271
526 3300025960 Ga0207651_10062416 Ga0207651_100624162 271
527 3300025960 Ga0207651_10219443 Ga0207651_102194432 271
528 3300025961 Ga0207712_10025711 Ga0207712_100257112 271
529 3300025986 Ga0207658_10303863 Ga0207658_103038632 271
530 3300026023 Ga0207677_10007524 Ga0207677_100075245 271
531 3300026041 Ga0207639_10207170 Ga0207639_102071702 271
532 3300026041 Ga0207639_10413901 Ga0207639_104139011 271
533 3300026041 Ga0207639_10442084 Ga0207639_104420842 271
534 3300026067 Ga0207678_10181763 Ga0207678_101817632 271
535 3300026075 Ga0207708_10078142 Ga0207708_100781423 271
536 3300026088 Ga0207641_10024571 Ga0207641_100245715 271
537 3300026088 Ga0207641_10041119 Ga0207641_100411193 271
538 3300026089 Ga0207648_10054260 Ga0207648_100542601 271
539 3300026089 Ga0207648_10299165 Ga0207648_102991651 271
540 3300026089 Ga0207648_10419515 Ga0207648_104195152 271
541 3300026089 Ga0207648_10643837 Ga0207648_106438371 271
542 3300026095 Ga0207676_10013730 Ga0207676_100137302 271
543 3300026095 Ga0207676_10686971 Ga0207676_106869711 271
544 3300026116 Ga0207674_10103223 Ga0207674_101032232 271
545 3300026116 Ga0207674_10116688 Ga0207674_101166882 271
546 3300026118 Ga0207675_100284491 Ga0207675_1002844912 271
547 3300026118 Ga0207675_100648726 Ga0207675_1006487262 271
548 3300026142 Ga0207698_10001735 Ga0207698_100017356 271
549 3300026142 Ga0207698_10022132 Ga0207698_100221325 271
550 3300026142 Ga0207698_10110495 Ga0207698_101104952 271
551 3300026142 Ga0207698_10145157 Ga0207698_101451572 271
552 3300026142 Ga0207698_10669981 Ga0207698_106699811 271
553 3300028379 Ga0268266_10148108 Ga0268266_101481082 271
554 3300028379 Ga0268266_10190508 Ga0268266_101905082 271
555 3300028381 Ga0268264_10027078 Ga0268264_100270783 271
556 3300028381 Ga0268264_10038092 Ga0268264_100380922 271
557 3300028381 Ga0268264_10307488 Ga0268264_103074882 271
558 3300028381 Ga0268264_10404140 Ga0268264_104041402 271
559 3300037418 Ga0395900_0198786 Ga0395900_0198786_964_1779 271
560 3300037418 Ga0395900_0505618 Ga0395900_0505618_160_975 271
561 3300037466 Ga0395898_0153424 Ga0395898_0153424_155_970 271
562 3300037466 Ga0395898_0202079 Ga0395898_0202079_535_1350 271
563 3300037471 Ga0395905_0003301 Ga0395905_0003301_11646_12461 271
564 3300039437 Ga0436365_0581872 Ga0436365_0581872_493_1308 271
565 3300044673 Ga0453683_0139055 Ga0453683_0139055_241_1056 271
566 3300044712 Ga0453684_0036244 Ga0453684_0036244_4565_5380 271
567 3300046455 Ga0495603_0182035 Ga0495603_0182035_386_1201 271
568 3300046460 Ga0495638_0108006 Ga0495638_0108006_417_1235 271
569 3300046536 Ga0495587_0086349 Ga0495587_0086349_511_1326 271
570 3300048904 Ga0496101_0132741 Ga0496101_0132741_967_1785 271
571 3300048909 Ga0496106_0452880 Ga0496106_0452880_198_1016 271
572 3300048911 Ga0496108_0040306 Ga0496108_0040306_2901_3716 271
573 3300048913 Ga0496110_0251303 Ga0496110_0251303_606_1421 271
574 3300048914 Ga0496111_0388146 Ga0496111_0388146_159_974 271
575 3300049161 Ga0501305_024342 Ga0501305_024342_16_831 271
576 3300049586 Ga0501070_0102442 Ga0501070_0102442_439_1254 271
577 3300049679 Ga0501249_042812 Ga0501249_042812_91_906 271
578 3300049680 Ga0501250_006975 Ga0501250_006975_81_896 271
579 3300049708 Ga0501245_010104 Ga0501245_010104_119_979 271
580 3300049765 Ga0501268_002042 Ga0501268_002042_1757_2572 271
581 3300050513 nmdc:mga0rr50_564681_c1 nmdc:mga0rr50_564681_c1_17_832 271
582 3300053090 Ga0500646_0012679 Ga0500646_0012679_324_1139 271
583 3300053093 Ga0500651_0293158 Ga0500651_0293158_40_855 271
584 3300059642 Ga0587069_016787 Ga0587069_016787_215_1030 271
585 3300002738 JGI25154J39366_1000202 JGI25154J39366_10002026 272
586 3300003215 JGI25153J46596_10011781 JGI25153J46596_100117811 272
587 3300003215 JGI25153J46596_10045913 JGI25153J46596_100459131 272
588 3300003322 rootL2_10291472 rootL2_102914722 272
589 3300003323 rootH1_10017161 rootH1_100171614 272
590 3300003354 JGI25160J50197_1001302 JGI25160J50197_10013024 272
591 3300003354 JGI25160J50197_1003117 JGI25160J50197_10031172 272
592 3300003354 JGI25160J50197_1004565 JGI25160J50197_10045654 272
593 3300003790 Ga0055528_1000123 Ga0055528_100012323 272
594 3300003791 Ga0055530_10000315 Ga0055530_1000031527 272
595 3300003794 Ga0055531_10049917 Ga0055531_100499172 272
596 3300005262 Ga0065165_1000720 Ga0065165_100072033 272
597 3300005577 Ga0068857_100091881 Ga0068857_1000918812 272
598 3300005985 Ga0081539_10001634 Ga0081539_100016344 272
599 3300006353 Ga0075370_10067324 Ga0075370_100673242 272
600 3300013102 Ga0157371_10045022 Ga0157371_100450222 272
601 3300013102 Ga0157371_10423552 Ga0157371_104235521 272
602 3300013104 Ga0157370_10200684 Ga0157370_102006842 272
603 3300013307 Ga0157372_10011728 Ga0157372_100117283 272
604 3300025246 Ga0209646_1000006 Ga0209646_1000006415 272
605 3300025250 Ga0209026_1000551 Ga0209026_10005515 272
606 3300025258 Ga0209129_1014905 Ga0209129_10149052 272
607 3300025273 Ga0209673_1000694 Ga0209673_100069424 272
608 3300025297 Ga0209758_1015411 Ga0209758_10154113 272
609 3300025298 Ga0209050_1000163 Ga0209050_100016393 272
610 3300025302 Ga0207426_1000023 Ga0207426_1000023203 272
611 3300025302 Ga0207426_1000562 Ga0207426_100056238 272
612 3300025302 Ga0207426_1001480 Ga0207426_100148018 272
613 3300025303 Ga0209051_1041679 Ga0209051_10416792 272
614 3300025304 Ga0209257_1001886 Ga0209257_10018868 272
615 3300026116 Ga0207674_10089366 Ga0207674_100893662 272
616 3300031251 Ga0265327_10000284 Ga0265327_1000028457 272
617 3300045049 Ga0466959_0022647 Ga0466959_0022647_3341_4159 272
618 3300049571 Ga0501034_0010730 Ga0501034_0010730_4657_5475 272
619 3300059647 Ga0587079_022021 Ga0587079_022021_312_1130 272
620 2162886007 SwRhRL2b_contig_1790489 SwRhRL2b_0282.00003270 274
621 3300005548 Ga0070665_100001186 Ga0070665_10000118620 274
622 3300005578 Ga0068854_100078438 Ga0068854_1000784382 274
623 3300009093 Ga0105240_10000047 Ga0105240_10000047101 274
624 3300009093 Ga0105240_10148766 Ga0105240_101487663 274
625 3300009545 Ga0105237_10008977 Ga0105237_100089778 274
626 3300009551 Ga0105238_10102289 Ga0105238_101022892 274
627 3300010375 Ga0105239_10000916 Ga0105239_1000091621 274
628 3300010375 Ga0105239_10221010 Ga0105239_102210102 274
629 3300013105 Ga0157369_10312606 Ga0157369_103126062 274
630 3300013307 Ga0157372_10026095 Ga0157372_100260954 274
631 3300025904 Ga0207647_10081167 Ga0207647_100811672 274
632 3300025913 Ga0207695_10000010 Ga0207695_10000010138 274
633 3300025913 Ga0207695_10026798 Ga0207695_100267982 274
634 3300025914 Ga0207671_10000036 Ga0207671_10000036126 274
635 3300026041 Ga0207639_10071444 Ga0207639_100714442 274
636 3300028379 Ga0268266_10001756 Ga0268266_100017563 274
637 3300028800 Ga0265338_10085936 Ga0265338_100859363 274
638 3300031247 Ga0265340_10154448 Ga0265340_101544481 274
639 3300031251 Ga0265327_10000022 Ga0265327_10000022216 274
640 3300031251 Ga0265327_10015061 Ga0265327_100150612 274
641 3300031548 Ga0307408_100260043 Ga0307408_1002600432 274
642 3300032004 Ga0307414_10045284 Ga0307414_100452844 274
643 3300046616 Ga0495668_0000677 Ga0495668_0000677_35630_36457 274
644 3300047318 Ga0495636_0000005 Ga0495636_0000005_62937_63764 274
645 3300047472 Ga0495686_0001990 Ga0495686_0001990_14842_15669 274
646 3300048917 Ga0496114_0003713 Ga0496114_0003713_10658_11485 274
647 3300049540 Ga0501324_004432 Ga0501324_004432_115_942 274
648 3300049822 Ga0501035_0049487 Ga0501035_0049487_2515_3342 274
649 3300053104 Ga0500556_0006964 Ga0500556_0006964_1897_2724 274
650 3300053130 Ga0500642_0010420 Ga0500642_0010420_128_955 274
651 3300053153 Ga0500616_0000717 Ga0500616_0000717_14446_15273 274
652 3300053158 Ga0500627_0014027 Ga0500627_0014027_877_1704 274

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08323

Glyco_transf_5

Starch synthase catalytic domain

53

298

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cx4-assembly1.cif.gz_A crystal structure of e.coli gs mutant e377a in complex with adp and oligosaccharides 0.7995 7 228
1rzu-assembly1.cif.gz_A crystal structure of the glycogen synthase from a. tumefaciens in complex with adp 0.7831 7 228
6gnf-assembly2.cif.gz_B granule bound starch synthase from cyanobacterium sp. clg1 bound to acarbose and adp 0.7578 5 233
6gne-assembly1.cif.gz_A catalytic domain of starch synthase iv from arabidopsis thaliana bound to adp and acarbose 0.7563 5 252
6gnf-assembly1.cif.gz_A granule bound starch synthase from cyanobacterium sp. clg1 bound to acarbose and adp 0.7541 5 233
ID Description Score Start End Superfamily
af_K7TNQ6_745_904_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.7797 9 182 3.40.50.2000
af_K7TNQ6_745_904_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.771 9 182 3.40.50.2000
af_P0A6U8_3_389_3.40.367.20 Alpha Beta;3-Layer(aba) Sandwich;Hexokinase; domain 1; 0.7534 9 254 3.40.367.20
3l01A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.7462 5 268 3.40.50.2000
3d1jA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.7457 7 269 3.40.50.2000
ID Description Score Start End GO Terms
AF-A0A4Q3EXL3-F1-model_v4 starch synthase (EC 2.4.1.21) 0.9957 139 274 GO:0016757
AF-A0A4Q3EXL3-F1-model_v4 starch synthase (EC 2.4.1.21) 0.9884 139 274 GO:0016757
AF-A0A4Q5RGX5-F1-model_v4 starch synthase (EC 2.4.1.21) 0.9685 114 272 GO:0016757
AF-A0A3D2SA69-F1-model_v4 starch synthase (EC 2.4.1.21) 0.9588 110 238 GO:0016757
AF-A0A4Q0AWY8-F1-model_v4 starch synthase (EC 2.4.1.21) 0.9585 5 272 GO:0016757

Feature Viewer

pLDDT pTM Quality
90.75 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map