F472708
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 652 | 290 | 652 | 93 |
Family's Representative Sequence
| Representative Sequence | 3300048906|Ga0496103_0160847|Ga0496103_0160847_961_1311 |
| Length | 106 |
| Sequence | LAARPAATAIYSRGAVTYIIAEPCIDIKDRSCVDVCPVDCIHEADRILVIDPEECIDCGAFPEDALPDKWNAFVEINYAYDKGMNVVDELTQKYADENNVQNEPID |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 5 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 8 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 27 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 30 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 31 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 32 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 33 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 34 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 35 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 36 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 37 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 42 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 43 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 44 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 45 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 46 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 47 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300012483 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 | Metagenome | Rhizosphere |
| 57 | 3300012488 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 | Metagenome | Rhizosphere |
| 58 | 3300012490 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 | Metagenome | Rhizosphere |
| 59 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 60 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 70 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 72 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 73 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 74 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 75 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 76 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 77 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 78 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 79 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 80 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 81 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 118 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 119 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 120 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 121 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 122 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 123 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 124 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 125 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 126 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 127 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 128 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 129 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 130 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 131 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 132 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 133 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 134 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 135 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 136 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 137 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 138 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 139 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 140 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 141 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 142 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 143 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 144 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 145 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 146 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 147 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 148 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 149 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 150 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 151 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 152 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 153 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 154 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 155 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 156 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 157 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 158 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 159 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 160 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 161 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 162 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 163 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 164 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 165 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 166 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 167 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 168 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 169 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 170 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 171 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 172 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 173 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 174 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 175 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 176 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 177 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 178 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 179 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 180 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 181 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 182 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 183 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 184 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 185 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 226 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 227 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 228 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 229 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 230 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 231 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 232 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 233 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 234 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 235 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 236 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 237 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 238 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 239 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 240 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 241 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 242 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 243 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 247 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 250 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 252 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 256 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 261 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 262 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 263 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 270 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 272 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 273 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 274 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 275 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 276 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 277 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 278 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 279 | 3300059625 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 280 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 281 | 3300059627 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 282 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 283 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 284 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 285 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 286 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 287 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 288 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 290 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.48 |
| Metatranscriptomes | 5.52 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.15 |
| Nodule | 0 |
| Rhizoplane | 6.13 |
| Rhizosphere | 93.4 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.31 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25407J50210_10084025 | 3300003373 | Unclassified | 790 |
| 2 | Ga0070658_10022933 | 3300005327 | Bacteria | 5011 |
| 3 | Ga0070658_10165010 | 3300005327 | Bacteria | 1859 |
| 4 | Ga0070658_10192112 | 3300005327 | Bacteria | 1721 |
| 5 | Ga0070658_10908344 | 3300005327 | Bacteria | 766 |
| 6 | Ga0070683_100001951 | 3300005329 | Bacteria | 16161 |
| 7 | Ga0070683_100101284 | 3300005329 | Bacteria | 2712 |
| 8 | Ga0070683_100208837 | 3300005329 | Bacteria | 1854 |
| 9 | Ga0070683_100229770 | 3300005329 | Bacteria | 1764 |
| 10 | Ga0070680_100007887 | 3300005336 | Bacteria | 8120 |
| 11 | Ga0070680_100075245 | 3300005336 | Bacteria | 2779 |
| 12 | Ga0070680_100577082 | 3300005336 | Bacteria | 965 |
| 13 | Ga0070680_100744660 | 3300005336 | Bacteria | 844 |
| 14 | Ga0070682_100063342 | 3300005337 | Bacteria | 2344 |
| 15 | Ga0070682_101215812 | 3300005337 | Bacteria | 637 |
| 16 | Ga0070660_100021867 | 3300005339 | Bacteria | 4723 |
| 17 | Ga0070660_100052730 | 3300005339 | Bacteria | 3136 |
| 18 | Ga0070660_100685952 | 3300005339 | Bacteria | 858 |
| 19 | Ga0070660_100866411 | 3300005339 | Bacteria | 761 |
| 20 | Ga0070660_100960001 | 3300005339 | Bacteria | 722 |
| 21 | Ga0070691_10387246 | 3300005341 | Bacteria | 785 |
| 22 | Ga0070661_100039193 | 3300005344 | Bacteria | 3452 |
| 23 | Ga0070661_100094101 | 3300005344 | Bacteria | 2220 |
| 24 | Ga0070671_100655714 | 3300005355 | Bacteria | 909 |
| 25 | Ga0070688_101003803 | 3300005365 | Bacteria | 663 |
| 26 | Ga0070659_100208823 | 3300005366 | Bacteria | 1609 |
| 27 | Ga0070659_100336249 | 3300005366 | Bacteria | 1265 |
| 28 | Ga0070709_10037054 | 3300005434 | Bacteria | 2975 |
| 29 | Ga0070709_10221035 | 3300005434 | Bacteria | 1351 |
| 30 | Ga0070709_11331947 | 3300005434 | Bacteria | 580 |
| 31 | Ga0070714_100021544 | 3300005435 | Bacteria | 5274 |
| 32 | Ga0070714_100021974 | 3300005435 | Bacteria | 5226 |
| 33 | Ga0070714_100045084 | 3300005435 | Bacteria | 3735 |
| 34 | Ga0070714_100051876 | 3300005435 | Bacteria | 3498 |
| 35 | Ga0070714_100091757 | 3300005435 | Bacteria | 2661 |
| 36 | Ga0070714_100302060 | 3300005435 | Bacteria | 1492 |
| 37 | Ga0070714_100383323 | 3300005435 | Bacteria | 1326 |
| 38 | Ga0070714_100950241 | 3300005435 | Bacteria | 835 |
| 39 | Ga0070714_101036858 | 3300005435 | Bacteria | 799 |
| 40 | Ga0070714_101127741 | 3300005435 | Bacteria | 764 |
| 41 | Ga0070714_101236672 | 3300005435 | Bacteria | 729 |
| 42 | Ga0070713_100026902 | 3300005436 | Bacteria | 4522 |
| 43 | Ga0070713_100221979 | 3300005436 | Bacteria | 1715 |
| 44 | Ga0070713_100821402 | 3300005436 | Bacteria | 892 |
| 45 | Ga0070713_101186487 | 3300005436 | Bacteria | 739 |
| 46 | Ga0070710_11371456 | 3300005437 | Bacteria | 528 |
| 47 | Ga0070711_100022262 | 3300005439 | Bacteria | 4106 |
| 48 | Ga0070711_100707531 | 3300005439 | Bacteria | 849 |
| 49 | Ga0070694_100014705 | 3300005444 | Bacteria | 4903 |
| 50 | Ga0070708_100080498 | 3300005445 | Bacteria | 2948 |
| 51 | Ga0070708_100414201 | 3300005445 | Bacteria | 1271 |
| 52 | Ga0070678_100206979 | 3300005456 | Bacteria | 1623 |
| 53 | Ga0070681_10002352 | 3300005458 | Bacteria | 17268 |
| 54 | Ga0070681_10002582 | 3300005458 | Bacteria | 16612 |
| 55 | Ga0070681_10010574 | 3300005458 | Bacteria | 9115 |
| 56 | Ga0070706_100016811 | 3300005467 | Bacteria | 6759 |
| 57 | Ga0070706_100529015 | 3300005467 | Bacteria | 1097 |
| 58 | Ga0070707_100214354 | 3300005468 | Bacteria | 1876 |
| 59 | Ga0070707_100334808 | 3300005468 | Bacteria | 1471 |
| 60 | Ga0070707_100897528 | 3300005468 | Bacteria | 851 |
| 61 | Ga0070698_100017517 | 3300005471 | Bacteria | 7550 |
| 62 | Ga0070698_100158682 | 3300005471 | Bacteria | 2207 |
| 63 | Ga0070698_100242411 | 3300005471 | Bacteria | 1736 |
| 64 | Ga0070698_100833407 | 3300005471 | Bacteria | 867 |
| 65 | Ga0070679_100007912 | 3300005530 | Bacteria | 9974 |
| 66 | Ga0070679_100072281 | 3300005530 | Bacteria | 3441 |
| 67 | Ga0070679_101399899 | 3300005530 | Bacteria | 645 |
| 68 | Ga0070684_100016458 | 3300005535 | Bacteria | 6046 |
| 69 | Ga0070684_100036184 | 3300005535 | Bacteria | 4230 |
| 70 | Ga0070684_100971745 | 3300005535 | Bacteria | 797 |
| 71 | Ga0070684_101109502 | 3300005535 | Bacteria | 743 |
| 72 | Ga0068853_100204687 | 3300005539 | Bacteria | 1797 |
| 73 | Ga0070695_100000007 | 3300005545 | Bacteria | 89343 |
| 74 | Ga0070695_100632017 | 3300005545 | Bacteria | 844 |
| 75 | Ga0070696_101330766 | 3300005546 | Bacteria | 611 |
| 76 | Ga0070696_101412861 | 3300005546 | Bacteria | 594 |
| 77 | Ga0068855_100030809 | 3300005563 | Bacteria | 6413 |
| 78 | Ga0068855_101023735 | 3300005563 | Bacteria | 867 |
| 79 | Ga0068855_101070103 | 3300005563 | Bacteria | 844 |
| 80 | Ga0068855_101102168 | 3300005563 | Bacteria | 830 |
| 81 | Ga0068857_100024780 | 3300005577 | Bacteria | 5284 |
| 82 | Ga0068857_100097777 | 3300005577 | Bacteria | 2632 |
| 83 | Ga0068854_100288704 | 3300005578 | Bacteria | 1323 |
| 84 | Ga0068856_100249630 | 3300005614 | Bacteria | 1790 |
| 85 | Ga0068856_100810267 | 3300005614 | Bacteria | 956 |
| 86 | Ga0068852_101194313 | 3300005616 | Bacteria | 782 |
| 87 | Ga0081455_10005292 | 3300005937 | Bacteria | 14169 |
| 88 | Ga0081455_10031254 | 3300005937 | Bacteria | 4821 |
| 89 | Ga0081455_10186374 | 3300005937 | Bacteria | 1567 |
| 90 | Ga0081538_10003303 | 3300005981 | Bacteria | 15294 |
| 91 | Ga0081538_10039817 | 3300005981 | Bacteria | 3008 |
| 92 | Ga0081538_10058162 | 3300005981 | Bacteria | 2245 |
| 93 | Ga0081539_10166670 | 3300005985 | Bacteria | 1045 |
| 94 | Ga0070717_10043162 | 3300006028 | Bacteria | 3679 |
| 95 | Ga0070717_10133109 | 3300006028 | Bacteria | 2140 |
| 96 | Ga0070717_10266039 | 3300006028 | Bacteria | 1518 |
| 97 | Ga0070715_10032441 | 3300006163 | Bacteria | 2128 |
| 98 | Ga0070715_10186187 | 3300006163 | Bacteria | 1045 |
| 99 | Ga0070716_100169941 | 3300006173 | Bacteria | 1422 |
| 100 | Ga0070716_101194086 | 3300006173 | Bacteria | 611 |
| 101 | Ga0070712_100822352 | 3300006175 | Bacteria | 798 |
| 102 | Ga0070712_101113233 | 3300006175 | Bacteria | 686 |
| 103 | Ga0075428_100002031 | 3300006844 | Bacteria | 21804 |
| 104 | Ga0075433_10018360 | 3300006852 | Bacteria | 5813 |
| 105 | Ga0075433_10116012 | 3300006852 | Bacteria | 2376 |
| 106 | Ga0075433_10296171 | 3300006852 | Bacteria | 1433 |
| 107 | Ga0075434_100009519 | 3300006871 | Bacteria | 9066 |
| 108 | Ga0075434_100054617 | 3300006871 | Bacteria | 3968 |
| 109 | Ga0075434_100770360 | 3300006871 | Bacteria | 979 |
| 110 | Ga0075429_100256518 | 3300006880 | Bacteria | 1531 |
| 111 | Ga0075435_100370177 | 3300007076 | Bacteria | 1230 |
| 112 | Ga0075435_100802216 | 3300007076 | Bacteria | 820 |
| 113 | Ga0075435_101626497 | 3300007076 | Bacteria | 567 |
| 114 | Ga0099795_10171099 | 3300007788 | Bacteria | 902 |
| 115 | Ga0105240_10030751 | 3300009093 | Bacteria | 6974 |
| 116 | Ga0105240_10097231 | 3300009093 | Bacteria | 3588 |
| 117 | Ga0105240_10236909 | 3300009093 | Bacteria | 2118 |
| 118 | Ga0105240_10334080 | 3300009093 | Bacteria | 1723 |
| 119 | Ga0105240_11041553 | 3300009093 | Bacteria | 873 |
| 120 | Ga0111539_12157614 | 3300009094 | Bacteria | 646 |
| 121 | Ga0105245_10023444 | 3300009098 | Bacteria | 5418 |
| 122 | Ga0105245_10771881 | 3300009098 | Bacteria | 998 |
| 123 | Ga0105245_12068663 | 3300009098 | Bacteria | 623 |
| 124 | Ga0114129_10000663 | 3300009147 | Bacteria | 43174 |
| 125 | Ga0114129_12029904 | 3300009147 | Bacteria | 695 |
| 126 | Ga0105243_10069693 | 3300009148 | Bacteria | 2837 |
| 127 | Ga0105242_10647697 | 3300009176 | Bacteria | 1027 |
| 128 | Ga0105237_10189280 | 3300009545 | Bacteria | 2058 |
| 129 | Ga0105238_10170715 | 3300009551 | Bacteria | 2151 |
| 130 | Ga0105238_12259277 | 3300009551 | Bacteria | 579 |
| 131 | Ga0105239_10803578 | 3300010375 | Bacteria | 1078 |
| 132 | Ga0157337_1006084 | 3300012483 | Bacteria | 825 |
| 133 | Ga0157343_1000717 | 3300012488 | Bacteria | 1421 |
| 134 | Ga0157322_1012827 | 3300012490 | Bacteria | 712 |
| 135 | Ga0157314_1015485 | 3300012500 | Bacteria | 722 |
| 136 | Ga0157373_10107685 | 3300013100 | Bacteria | 1959 |
| 137 | Ga0157371_10262758 | 3300013102 | Bacteria | 1245 |
| 138 | Ga0157371_10861010 | 3300013102 | Bacteria | 685 |
| 139 | Ga0157370_10011210 | 3300013104 | Bacteria | 9401 |
| 140 | Ga0157370_10018219 | 3300013104 | Bacteria | 7066 |
| 141 | Ga0157370_10747274 | 3300013104 | Bacteria | 891 |
| 142 | Ga0157370_10747666 | 3300013104 | Bacteria | 891 |
| 143 | Ga0157370_11328543 | 3300013104 | Bacteria | 648 |
| 144 | Ga0157369_10002883 | 3300013105 | Bacteria | 20540 |
| 145 | Ga0157369_10182179 | 3300013105 | Bacteria | 2210 |
| 146 | Ga0157374_10629473 | 3300013296 | Bacteria | 1084 |
| 147 | Ga0157374_10656399 | 3300013296 | Bacteria | 1061 |
| 148 | Ga0163162_10838063 | 3300013306 | Bacteria | 1035 |
| 149 | Ga0163162_11082479 | 3300013306 | Bacteria | 908 |
| 150 | Ga0157372_10029039 | 3300013307 | Bacteria | 6034 |
| 151 | Ga0157372_10391346 | 3300013307 | Bacteria | 1620 |
| 152 | Ga0157372_10437965 | 3300013307 | Bacteria | 1523 |
| 153 | Ga0157372_11832215 | 3300013307 | Bacteria | 698 |
| 154 | Ga0157375_11220789 | 3300013308 | Bacteria | 882 |
| 155 | Ga0157380_10545104 | 3300014326 | Bacteria | 1137 |
| 156 | Ga0157380_11278662 | 3300014326 | Bacteria | 780 |
| 157 | Ga0182008_10002753 | 3300014497 | Bacteria | 10904 |
| 158 | Ga0182008_10024953 | 3300014497 | Bacteria | 3040 |
| 159 | Ga0182008_10265433 | 3300014497 | Bacteria | 889 |
| 160 | Ga0157379_10370007 | 3300014968 | Bacteria | 1314 |
| 161 | Ga0182006_1143170 | 3300015261 | Bacteria | 815 |
| 162 | Ga0182006_1162713 | 3300015261 | Bacteria | 751 |
| 163 | Ga0182007_10117022 | 3300015262 | Bacteria | 890 |
| 164 | Ga0182005_1133303 | 3300015265 | Bacteria | 714 |
| 165 | Ga0206356_10280546 | 3300020070 | Bacteria | 1182 |
| 166 | Ga0206356_11617167 | 3300020070 | Bacteria | 1300 |
| 167 | Ga0206349_1900966 | 3300020075 | Bacteria | 767 |
| 168 | Ga0206350_10482534 | 3300020080 | Bacteria | 600 |
| 169 | Ga0206354_10133384 | 3300020081 | Bacteria | 1206 |
| 170 | Ga0206354_10432702 | 3300020081 | Bacteria | 1006 |
| 171 | Ga0206354_11071589 | 3300020081 | Bacteria | 879 |
| 172 | Ga0206353_10004980 | 3300020082 | Bacteria | 12482 |
| 173 | Ga0206353_10866168 | 3300020082 | Bacteria | 6983 |
| 174 | Ga0206353_11626609 | 3300020082 | Bacteria | 938 |
| 175 | Ga0154015_1165229 | 3300020610 | Bacteria | 1208 |
| 176 | Ga0154015_1211618 | 3300020610 | Bacteria | 1288 |
| 177 | Ga0154015_1354810 | 3300020610 | Bacteria | 553 |
| 178 | Ga0224712_10125102 | 3300022467 | Bacteria | 1117 |
| 179 | Ga0207685_10156599 | 3300025905 | Bacteria | 1036 |
| 180 | Ga0207699_10029387 | 3300025906 | Bacteria | 3065 |
| 181 | Ga0207699_10289867 | 3300025906 | Bacteria | 1140 |
| 182 | Ga0207699_11343937 | 3300025906 | Bacteria | 529 |
| 183 | Ga0207705_10003887 | 3300025909 | Bacteria | 11365 |
| 184 | Ga0207705_10017397 | 3300025909 | Bacteria | 5148 |
| 185 | Ga0207705_10055106 | 3300025909 | Bacteria | 2867 |
| 186 | Ga0207684_10363276 | 3300025910 | Bacteria | 1246 |
| 187 | Ga0207684_10831640 | 3300025910 | Bacteria | 779 |
| 188 | Ga0207684_11530231 | 3300025910 | Bacteria | 542 |
| 189 | Ga0207707_10004063 | 3300025912 | Bacteria | 12958 |
| 190 | Ga0207707_10008618 | 3300025912 | Bacteria | 8845 |
| 191 | Ga0207707_10084317 | 3300025912 | Bacteria | 2775 |
| 192 | Ga0207707_10085336 | 3300025912 | Bacteria | 2759 |
| 193 | Ga0207695_10129279 | 3300025913 | Bacteria | 2484 |
| 194 | Ga0207695_10182090 | 3300025913 | Bacteria | 2022 |
| 195 | Ga0207695_10244492 | 3300025913 | Bacteria | 1695 |
| 196 | Ga0207695_10394645 | 3300025913 | Bacteria | 1268 |
| 197 | Ga0207695_10418696 | 3300025913 | Bacteria | 1224 |
| 198 | Ga0207671_10126668 | 3300025914 | Bacteria | 1957 |
| 199 | Ga0207693_11292262 | 3300025915 | Bacteria | 546 |
| 200 | Ga0207663_10033597 | 3300025916 | Bacteria | 3058 |
| 201 | Ga0207663_11244926 | 3300025916 | Bacteria | 599 |
| 202 | Ga0207660_10018636 | 3300025917 | Bacteria | 4631 |
| 203 | Ga0207660_10061836 | 3300025917 | Bacteria | 2696 |
| 204 | Ga0207660_10196183 | 3300025917 | Bacteria | 1575 |
| 205 | Ga0207660_10234096 | 3300025917 | Bacteria | 1445 |
| 206 | Ga0207660_11309995 | 3300025917 | Bacteria | 588 |
| 207 | Ga0207657_10002690 | 3300025919 | Bacteria | 19155 |
| 208 | Ga0207657_10011803 | 3300025919 | Bacteria | 8649 |
| 209 | Ga0207649_10063761 | 3300025920 | Bacteria | 2328 |
| 210 | Ga0207652_10019328 | 3300025921 | Bacteria | 5602 |
| 211 | Ga0207652_10022742 | 3300025921 | Bacteria | 5191 |
| 212 | Ga0207652_10025683 | 3300025921 | Bacteria | 4899 |
| 213 | Ga0207652_10063037 | 3300025921 | Bacteria | 3205 |
| 214 | Ga0207652_10422723 | 3300025921 | Bacteria | 1202 |
| 215 | Ga0207652_11294252 | 3300025921 | Bacteria | 632 |
| 216 | Ga0207646_10040720 | 3300025922 | Bacteria | 4178 |
| 217 | Ga0207646_10783910 | 3300025922 | Bacteria | 849 |
| 218 | Ga0207646_10831574 | 3300025922 | Bacteria | 821 |
| 219 | Ga0207646_11215303 | 3300025922 | Bacteria | 660 |
| 220 | Ga0207694_10451089 | 3300025924 | Bacteria | 1074 |
| 221 | Ga0207694_10931816 | 3300025924 | Bacteria | 735 |
| 222 | Ga0207687_10838302 | 3300025927 | Bacteria | 785 |
| 223 | Ga0207700_10000002 | 3300025928 | Bacteria | 775978 |
| 224 | Ga0207700_10353708 | 3300025928 | Bacteria | 1280 |
| 225 | Ga0207700_10371224 | 3300025928 | Bacteria | 1249 |
| 226 | Ga0207700_11058666 | 3300025928 | Bacteria | 725 |
| 227 | Ga0207664_10031085 | 3300025929 | Bacteria | 4082 |
| 228 | Ga0207664_10098342 | 3300025929 | Bacteria | 2413 |
| 229 | Ga0207664_10130990 | 3300025929 | Bacteria | 2111 |
| 230 | Ga0207664_10176988 | 3300025929 | Bacteria | 1829 |
| 231 | Ga0207664_10269729 | 3300025929 | Bacteria | 1490 |
| 232 | Ga0207664_10432326 | 3300025929 | Bacteria | 1173 |
| 233 | Ga0207664_10794695 | 3300025929 | Bacteria | 851 |
| 234 | Ga0207664_11312895 | 3300025929 | Bacteria | 643 |
| 235 | Ga0207664_11472715 | 3300025929 | Bacteria | 602 |
| 236 | Ga0207644_10564790 | 3300025931 | Bacteria | 943 |
| 237 | Ga0207644_10957269 | 3300025931 | Bacteria | 718 |
| 238 | Ga0207690_10660376 | 3300025932 | Bacteria | 857 |
| 239 | Ga0207690_11726752 | 3300025932 | Bacteria | 523 |
| 240 | Ga0207686_10059516 | 3300025934 | Bacteria | 2414 |
| 241 | Ga0207686_10207491 | 3300025934 | Bacteria | 1407 |
| 242 | Ga0207686_10242079 | 3300025934 | Bacteria | 1313 |
| 243 | Ga0207709_10057868 | 3300025935 | Bacteria | 2406 |
| 244 | Ga0207704_10380929 | 3300025938 | Bacteria | 1107 |
| 245 | Ga0207665_10002200 | 3300025939 | Bacteria | 13164 |
| 246 | Ga0207665_10181167 | 3300025939 | Bacteria | 1526 |
| 247 | Ga0207665_10212723 | 3300025939 | Bacteria | 1413 |
| 248 | Ga0207665_10379502 | 3300025939 | Bacteria | 1072 |
| 249 | Ga0207691_11053773 | 3300025940 | Bacteria | 677 |
| 250 | Ga0207711_10656114 | 3300025941 | Bacteria | 979 |
| 251 | Ga0207711_11344590 | 3300025941 | Bacteria | 657 |
| 252 | Ga0207661_10003839 | 3300025944 | Bacteria | 10475 |
| 253 | Ga0207661_10025797 | 3300025944 | Bacteria | 4472 |
| 254 | Ga0207661_10060022 | 3300025944 | Bacteria | 3066 |
| 255 | Ga0207661_10276732 | 3300025944 | Bacteria | 1499 |
| 256 | Ga0207661_10335228 | 3300025944 | Bacteria | 1362 |
| 257 | Ga0207661_11221473 | 3300025944 | Bacteria | 691 |
| 258 | Ga0207667_10050181 | 3300025949 | Bacteria | 4403 |
| 259 | Ga0207640_11459578 | 3300025981 | Bacteria | 614 |
| 260 | Ga0207677_10799876 | 3300026023 | Bacteria | 844 |
| 261 | Ga0207639_10606341 | 3300026041 | Bacteria | 1010 |
| 262 | Ga0207678_10529584 | 3300026067 | Bacteria | 1029 |
| 263 | Ga0207678_11874223 | 3300026067 | Bacteria | 524 |
| 264 | Ga0207702_10152300 | 3300026078 | Bacteria | 2104 |
| 265 | Ga0207702_11249466 | 3300026078 | Bacteria | 737 |
| 266 | Ga0207676_12359693 | 3300026095 | Bacteria | 529 |
| 267 | Ga0207674_10016181 | 3300026116 | Bacteria | 8169 |
| 268 | Ga0207674_10100393 | 3300026116 | Bacteria | 2875 |
| 269 | Ga0207683_10172724 | 3300026121 | Bacteria | 1958 |
| 270 | Ga0207428_11242980 | 3300027907 | Bacteria | 517 |
| 271 | Ga0265326_10009205 | 3300028558 | Bacteria | 2954 |
| 272 | Ga0265326_10031889 | 3300028558 | Bacteria | 1501 |
| 273 | Ga0265319_1005903 | 3300028563 | Bacteria | 5758 |
| 274 | Ga0265319_1078233 | 3300028563 | Bacteria | 1052 |
| 275 | Ga0265334_10006308 | 3300028573 | Bacteria | 5119 |
| 276 | Ga0265334_10017490 | 3300028573 | Bacteria | 2959 |
| 277 | Ga0265318_10001217 | 3300028577 | Bacteria | 15646 |
| 278 | Ga0265323_10069259 | 3300028653 | Bacteria | 1209 |
| 279 | Ga0265322_10005028 | 3300028654 | Bacteria | 3921 |
| 280 | Ga0265336_10021950 | 3300028666 | Bacteria | 2035 |
| 281 | Ga0265338_10002936 | 3300028800 | Bacteria | 24729 |
| 282 | Ga0265338_10004663 | 3300028800 | Bacteria | 18409 |
| 283 | Ga0265338_10011028 | 3300028800 | Bacteria | 10493 |
| 284 | Ga0265338_10023362 | 3300028800 | Bacteria | 6360 |
| 285 | Ga0265324_10023833 | 3300029957 | Bacteria | 2177 |
| 286 | Ga0265330_10001984 | 3300031235 | Bacteria | 11353 |
| 287 | Ga0265332_10001963 | 3300031238 | Bacteria | 10846 |
| 288 | Ga0265328_10007996 | 3300031239 | Bacteria | 4384 |
| 289 | Ga0265320_10010508 | 3300031240 | Bacteria | 5511 |
| 290 | Ga0265325_10001625 | 3300031241 | Bacteria | 15662 |
| 291 | Ga0265329_10004462 | 3300031242 | Bacteria | 5809 |
| 292 | Ga0265340_10074233 | 3300031247 | Bacteria | 1608 |
| 293 | Ga0265331_10004771 | 3300031250 | Bacteria | 8354 |
| 294 | Ga0265327_10010871 | 3300031251 | Bacteria | 6339 |
| 295 | Ga0265327_10020771 | 3300031251 | Bacteria | 3988 |
| 296 | Ga0265316_10077706 | 3300031344 | Bacteria | 2548 |
| 297 | Ga0265316_10372808 | 3300031344 | Bacteria | 1031 |
| 298 | Ga0265313_10009457 | 3300031595 | Bacteria | 6328 |
| 299 | Ga0265313_10052738 | 3300031595 | Bacteria | 1939 |
| 300 | Ga0265314_10039580 | 3300031711 | Bacteria | 3393 |
| 301 | Ga0265342_10012474 | 3300031712 | Bacteria | 5753 |
| 302 | Ga0307409_100595419 | 3300031995 | Bacteria | 1092 |
| 303 | Ga0307416_102282044 | 3300032002 | Bacteria | 642 |
| 304 | Ga0316583_10026733 | 3300032133 | Bacteria | 2060 |
| 305 | Ga0316583_10044736 | 3300032133 | Bacteria | 1564 |
| 306 | Ga0373958_0185450 | 3300034819 | Bacteria | 538 |
| 307 | Ga0373944_0065864 | 3300035089 | Bacteria | 1171 |
| 308 | Ga0373923_0378572 | 3300035111 | Bacteria | 679 |
| 309 | Ga0373936_0019904 | 3300035113 | Bacteria | 2603 |
| 310 | Ga0373936_0071391 | 3300035113 | Bacteria | 1432 |
| 311 | Ga0373945_0006065 | 3300035116 | Bacteria | 3886 |
| 312 | Ga0373956_0456669 | 3300035119 | Bacteria | 610 |
| 313 | Ga0373957_0557154 | 3300035120 | Bacteria | 502 |
| 314 | Ga0373943_0000628 | 3300035170 | Bacteria | 15270 |
| 315 | Ga0373924_0113029 | 3300035410 | Bacteria | 1175 |
| 316 | Ga0373935_0015369 | 3300035692 | Bacteria | 4626 |
| 317 | Ga0373927_0049940 | 3300035695 | Bacteria | 2704 |
| 318 | Ga0373947_0004063 | 3300035725 | Bacteria | 8608 |
| 319 | Ga0373947_0122855 | 3300035725 | Bacteria | 1651 |
| 320 | Ga0373937_0837980 | 3300036401 | Bacteria | 868 |
| 321 | Ga0373925_0002950 | 3300037068 | Bacteria | 13427 |
| 322 | Ga0395899_0183731 | 3300037312 | Bacteria | 1466 |
| 323 | Ga0395899_0186005 | 3300037312 | Bacteria | 1456 |
| 324 | Ga0395899_0730590 | 3300037312 | Bacteria | 618 |
| 325 | Ga0395900_0228700 | 3300037418 | Bacteria | 1871 |
| 326 | Ga0395900_0687282 | 3300037418 | Bacteria | 958 |
| 327 | Ga0395900_1189210 | 3300037418 | Bacteria | 678 |
| 328 | Ga0395900_1255829 | 3300037418 | Bacteria | 655 |
| 329 | Ga0395898_0178667 | 3300037466 | Bacteria | 2028 |
| 330 | Ga0395898_0263849 | 3300037466 | Bacteria | 1643 |
| 331 | Ga0395905_0229878 | 3300037471 | Bacteria | 1734 |
| 332 | Ga0395905_0845381 | 3300037471 | Bacteria | 818 |
| 333 | Ga0395905_0992280 | 3300037471 | Bacteria | 743 |
| 334 | Ga0395905_1103584 | 3300037471 | Bacteria | 697 |
| 335 | Ga0395901_0176171 | 3300038443 | Bacteria | 2243 |
| 336 | Ga0395901_0218834 | 3300038443 | Bacteria | 1991 |
| 337 | Ga0395901_0254299 | 3300038443 | Bacteria | 1830 |
| 338 | Ga0395901_0376898 | 3300038443 | Bacteria | 1461 |
| 339 | Ga0395901_0775274 | 3300038443 | Bacteria | 950 |
| 340 | Ga0395901_1238711 | 3300038443 | Bacteria | 710 |
| 341 | Ga0436365_1158022 | 3300039437 | Bacteria | 569 |
| 342 | Ga0436360_1187886 | 3300039438 | Bacteria | 1975 |
| 343 | Ga0436360_1211651 | 3300039438 | Bacteria | 4498 |
| 344 | Ga0436361_1157274 | 3300039447 | Bacteria | 634 |
| 345 | Ga0436363_1297278 | 3300039450 | Bacteria | 561 |
| 346 | Ga0436362_0404353 | 3300039453 | Bacteria | 601 |
| 347 | Ga0439453_0001773 | 3300041408 | Bacteria | 2849 |
| 348 | Ga0451789_1012533 | 3300041443 | Bacteria | 598 |
| 349 | Ga0451804_1120031 | 3300041463 | Bacteria | 1146 |
| 350 | Ga0439454_003880 | 3300042011 | Bacteria | 1692 |
| 351 | Ga0466969_0003769 | 3300044656 | Bacteria | 8058 |
| 352 | Ga0466965_0154088 | 3300044683 | Bacteria | 1202 |
| 353 | Ga0466965_0347836 | 3300044683 | Bacteria | 811 |
| 354 | Ga0466965_0382883 | 3300044683 | Bacteria | 775 |
| 355 | Ga0466966_0039151 | 3300044684 | Bacteria | 3053 |
| 356 | Ga0466966_0113754 | 3300044684 | Bacteria | 1666 |
| 357 | Ga0466966_0178062 | 3300044684 | Bacteria | 1291 |
| 358 | Ga0466966_0336939 | 3300044684 | Bacteria | 906 |
| 359 | Ga0466961_0288470 | 3300044693 | Bacteria | 1003 |
| 360 | Ga0466961_0316943 | 3300044693 | Bacteria | 951 |
| 361 | Ga0466961_0376196 | 3300044693 | Bacteria | 863 |
| 362 | Ga0466961_0389319 | 3300044693 | Bacteria | 846 |
| 363 | Ga0466961_0456284 | 3300044693 | Bacteria | 773 |
| 364 | Ga0466963_0000137 | 3300044694 | Bacteria | 28326 |
| 365 | Ga0466963_0000276 | 3300044694 | Bacteria | 22861 |
| 366 | Ga0466963_0000632 | 3300044694 | Bacteria | 16887 |
| 367 | Ga0466963_0000673 | 3300044694 | Bacteria | 16556 |
| 368 | Ga0466963_0000741 | 3300044694 | Bacteria | 16079 |
| 369 | Ga0466963_0002688 | 3300044694 | Bacteria | 10010 |
| 370 | Ga0466963_0005725 | 3300044694 | Bacteria | 7307 |
| 371 | Ga0466963_0038983 | 3300044694 | Bacteria | 3109 |
| 372 | Ga0466963_0042447 | 3300044694 | Bacteria | 2987 |
| 373 | Ga0466963_0076759 | 3300044694 | Bacteria | 2256 |
| 374 | Ga0466963_0280509 | 3300044694 | Bacteria | 1171 |
| 375 | Ga0466963_0291769 | 3300044694 | Bacteria | 1146 |
| 376 | Ga0466963_0455271 | 3300044694 | Bacteria | 903 |
| 377 | Ga0466963_0705761 | 3300044694 | Bacteria | 712 |
| 378 | Ga0466963_0900440 | 3300044694 | Bacteria | 623 |
| 379 | Ga0466964_0006725 | 3300044706 | Bacteria | 4286 |
| 380 | Ga0466964_0007832 | 3300044706 | Bacteria | 4000 |
| 381 | Ga0466964_0012342 | 3300044706 | Bacteria | 3233 |
| 382 | Ga0466964_0013707 | 3300044706 | Bacteria | 3076 |
| 383 | Ga0466964_0072548 | 3300044706 | Bacteria | 1459 |
| 384 | Ga0466964_0082817 | 3300044706 | Bacteria | 1380 |
| 385 | Ga0466964_0145094 | 3300044706 | Bacteria | 1095 |
| 386 | Ga0466964_0259981 | 3300044706 | Bacteria | 859 |
| 387 | Ga0466964_0284728 | 3300044706 | Bacteria | 827 |
| 388 | Ga0466971_0001552 | 3300044719 | Bacteria | 9688 |
| 389 | Ga0466971_0001914 | 3300044719 | Bacteria | 8834 |
| 390 | Ga0466971_0029827 | 3300044719 | Bacteria | 2440 |
| 391 | Ga0466971_0037646 | 3300044719 | Bacteria | 2169 |
| 392 | Ga0466971_0160720 | 3300044719 | Bacteria | 1051 |
| 393 | Ga0466968_0004224 | 3300044735 | Bacteria | 5355 |
| 394 | Ga0466968_0006450 | 3300044735 | Bacteria | 4423 |
| 395 | Ga0466968_0008503 | 3300044735 | Bacteria | 3931 |
| 396 | Ga0466968_0216570 | 3300044735 | Bacteria | 901 |
| 397 | Ga0466970_0014456 | 3300044765 | Bacteria | 4052 |
| 398 | Ga0466957_0001689 | 3300044842 | Bacteria | 11606 |
| 399 | Ga0466957_0003049 | 3300044842 | Bacteria | 9108 |
| 400 | Ga0466957_0003662 | 3300044842 | Bacteria | 8480 |
| 401 | Ga0466957_0022017 | 3300044842 | Bacteria | 3758 |
| 402 | Ga0466957_0039136 | 3300044842 | Bacteria | 2860 |
| 403 | Ga0466957_0051735 | 3300044842 | Bacteria | 2500 |
| 404 | Ga0466957_0091504 | 3300044842 | Bacteria | 1907 |
| 405 | Ga0466957_0160392 | 3300044842 | Bacteria | 1460 |
| 406 | Ga0466957_0208452 | 3300044842 | Bacteria | 1286 |
| 407 | Ga0466957_0671945 | 3300044842 | Bacteria | 729 |
| 408 | Ga0466957_0942087 | 3300044842 | Bacteria | 618 |
| 409 | Ga0466960_0004958 | 3300044901 | Bacteria | 5241 |
| 410 | Ga0466960_0066119 | 3300044901 | Bacteria | 1787 |
| 411 | Ga0466960_0101262 | 3300044901 | Bacteria | 1483 |
| 412 | Ga0466960_0193673 | 3300044901 | Bacteria | 1107 |
| 413 | Ga0466960_0367764 | 3300044901 | Bacteria | 823 |
| 414 | Ga0466959_0010806 | 3300045049 | Bacteria | 6543 |
| 415 | Ga0466959_0013103 | 3300045049 | Bacteria | 6004 |
| 416 | Ga0466959_0034372 | 3300045049 | Bacteria | 3749 |
| 417 | Ga0466959_0151365 | 3300045049 | Bacteria | 1635 |
| 418 | Ga0466959_0662311 | 3300045049 | Bacteria | 700 |
| 419 | Ga0466958_0002075 | 3300045836 | Bacteria | 9910 |
| 420 | Ga0466958_0004062 | 3300045836 | Bacteria | 7677 |
| 421 | Ga0466958_0005483 | 3300045836 | Bacteria | 6838 |
| 422 | Ga0466958_0007875 | 3300045836 | Bacteria | 5888 |
| 423 | Ga0466958_0010034 | 3300045836 | Bacteria | 5292 |
| 424 | Ga0466958_0030937 | 3300045836 | Bacteria | 3181 |
| 425 | Ga0466958_0038614 | 3300045836 | Bacteria | 2865 |
| 426 | Ga0466958_0087483 | 3300045836 | Bacteria | 1924 |
| 427 | Ga0466958_0116393 | 3300045836 | Bacteria | 1671 |
| 428 | Ga0466958_0172170 | 3300045836 | Bacteria | 1371 |
| 429 | Ga0466958_0178992 | 3300045836 | Bacteria | 1345 |
| 430 | Ga0466958_0299619 | 3300045836 | Bacteria | 1032 |
| 431 | Ga0466958_0490985 | 3300045836 | Bacteria | 796 |
| 432 | Ga0466958_1010761 | 3300045836 | Bacteria | 543 |
| 433 | Ga0466967_0000047 | 3300045976 | Bacteria | 43648 |
| 434 | Ga0466967_0000300 | 3300045976 | Bacteria | 22193 |
| 435 | Ga0466967_0002201 | 3300045976 | Bacteria | 11993 |
| 436 | Ga0466967_0003956 | 3300045976 | Bacteria | 9857 |
| 437 | Ga0466967_0043133 | 3300045976 | Bacteria | 3904 |
| 438 | Ga0466967_0044979 | 3300045976 | Bacteria | 3834 |
| 439 | Ga0466967_0058202 | 3300045976 | Bacteria | 3415 |
| 440 | Ga0466967_0079604 | 3300045976 | Bacteria | 2954 |
| 441 | Ga0466967_0104505 | 3300045976 | Bacteria | 2593 |
| 442 | Ga0466967_0134110 | 3300045976 | Bacteria | 2302 |
| 443 | Ga0466967_0179243 | 3300045976 | Bacteria | 1997 |
| 444 | Ga0466967_0189071 | 3300045976 | Bacteria | 1945 |
| 445 | Ga0466967_0207017 | 3300045976 | Bacteria | 1859 |
| 446 | Ga0466967_0284491 | 3300045976 | Bacteria | 1587 |
| 447 | Ga0466967_0290513 | 3300045976 | Bacteria | 1571 |
| 448 | Ga0466967_0344547 | 3300045976 | Bacteria | 1441 |
| 449 | Ga0466967_0425213 | 3300045976 | Bacteria | 1295 |
| 450 | Ga0466967_0508189 | 3300045976 | Bacteria | 1183 |
| 451 | Ga0466967_0766082 | 3300045976 | Bacteria | 957 |
| 452 | Ga0466967_1030558 | 3300045976 | Bacteria | 819 |
| 453 | Ga0466967_2305337 | 3300045976 | Bacteria | 534 |
| 454 | Ga0466967_2386858 | 3300045976 | Bacteria | 524 |
| 455 | Ga0495592_0163026 | 3300046454 | Bacteria | 1532 |
| 456 | Ga0495592_0825576 | 3300046454 | Bacteria | 549 |
| 457 | Ga0495629_0014949 | 3300046459 | Bacteria | 5576 |
| 458 | Ga0495629_0018947 | 3300046459 | Bacteria | 4922 |
| 459 | Ga0495629_0184357 | 3300046459 | Bacteria | 1446 |
| 460 | Ga0495641_0003398 | 3300046461 | Bacteria | 11936 |
| 461 | Ga0495651_0054488 | 3300046462 | Bacteria | 3075 |
| 462 | Ga0495651_0271049 | 3300046462 | Bacteria | 1151 |
| 463 | Ga0495653_0005518 | 3300046463 | Bacteria | 10305 |
| 464 | Ga0495653_0351210 | 3300046463 | Bacteria | 948 |
| 465 | Ga0495580_0006348 | 3300046472 | Bacteria | 9644 |
| 466 | Ga0495582_0007435 | 3300046473 | Bacteria | 6064 |
| 467 | Ga0495582_0036147 | 3300046473 | Bacteria | 2717 |
| 468 | Ga0495582_0095326 | 3300046473 | Bacteria | 1662 |
| 469 | Ga0495582_0231824 | 3300046473 | Bacteria | 1057 |
| 470 | Ga0495582_0844511 | 3300046473 | Bacteria | 530 |
| 471 | Ga0495639_0000291 | 3300046475 | Bacteria | 24492 |
| 472 | Ga0495639_0558953 | 3300046475 | Bacteria | 587 |
| 473 | Ga0495662_0006357 | 3300046476 | Bacteria | 5903 |
| 474 | Ga0495664_0007586 | 3300046477 | Bacteria | 6031 |
| 475 | Ga0495664_0318602 | 3300046477 | Bacteria | 938 |
| 476 | Ga0495664_0325591 | 3300046477 | Bacteria | 927 |
| 477 | Ga0495664_0371177 | 3300046477 | Bacteria | 860 |
| 478 | Ga0495594_0058692 | 3300046499 | Bacteria | 2127 |
| 479 | Ga0495608_0363750 | 3300046511 | Bacteria | 889 |
| 480 | Ga0495608_0714352 | 3300046511 | Bacteria | 596 |
| 481 | Ga0495618_0006267 | 3300046514 | Bacteria | 7219 |
| 482 | Ga0495618_0147317 | 3300046514 | Bacteria | 1505 |
| 483 | Ga0495618_0242156 | 3300046514 | Bacteria | 1133 |
| 484 | Ga0495618_0409009 | 3300046514 | Bacteria | 829 |
| 485 | Ga0495628_0056803 | 3300046516 | Bacteria | 3080 |
| 486 | Ga0495630_0000631 | 3300046517 | Bacteria | 25489 |
| 487 | Ga0495630_0029216 | 3300046517 | Bacteria | 4097 |
| 488 | Ga0495630_0177662 | 3300046517 | Bacteria | 1623 |
| 489 | Ga0495666_0000270 | 3300046526 | Bacteria | 22402 |
| 490 | Ga0495652_0004378 | 3300046529 | Bacteria | 13510 |
| 491 | Ga0495665_0001487 | 3300046531 | Bacteria | 12555 |
| 492 | Ga0495665_0409077 | 3300046531 | Bacteria | 688 |
| 493 | Ga0495640_0019213 | 3300046533 | Bacteria | 5047 |
| 494 | Ga0495640_0048828 | 3300046533 | Bacteria | 2921 |
| 495 | Ga0495640_0891658 | 3300046533 | Bacteria | 527 |
| 496 | Ga0495586_0004266 | 3300046535 | Bacteria | 7645 |
| 497 | Ga0495586_0040895 | 3300046535 | Bacteria | 2495 |
| 498 | Ga0495645_0035797 | 3300046543 | Bacteria | 3619 |
| 499 | Ga0495645_0394003 | 3300046543 | Bacteria | 884 |
| 500 | Ga0495645_0759221 | 3300046543 | Bacteria | 585 |
| 501 | Ga0495622_0193164 | 3300046557 | Bacteria | 909 |
| 502 | Ga0495667_0015940 | 3300046559 | Bacteria | 5080 |
| 503 | Ga0495667_0651563 | 3300046559 | Bacteria | 654 |
| 504 | Ga0495634_0004560 | 3300046642 | Bacteria | 10823 |
| 505 | Ga0495634_0546683 | 3300046642 | Bacteria | 675 |
| 506 | Ga0495635_0006305 | 3300046663 | Bacteria | 8263 |
| 507 | Ga0495635_0013922 | 3300046663 | Bacteria | 5627 |
| 508 | Ga0495635_0491252 | 3300046663 | Bacteria | 809 |
| 509 | Ga0495657_0358762 | 3300046675 | Bacteria | 862 |
| 510 | Ga0495646_0185283 | 3300046680 | Bacteria | 1140 |
| 511 | Ga0495647_0000243 | 3300046681 | Bacteria | 14906 |
| 512 | Ga0495658_0000970 | 3300046683 | Bacteria | 15222 |
| 513 | Ga0495613_0008628 | 3300046689 | Bacteria | 7561 |
| 514 | Ga0495613_0292129 | 3300046689 | Bacteria | 1130 |
| 515 | Ga0495624_0001273 | 3300046690 | Bacteria | 19870 |
| 516 | Ga0495624_0270191 | 3300046690 | Bacteria | 1027 |
| 517 | Ga0495600_0534694 | 3300046809 | Bacteria | 717 |
| 518 | Ga0495581_0000258 | 3300047315 | Bacteria | 25364 |
| 519 | Ga0495581_0815074 | 3300047315 | Bacteria | 535 |
| 520 | Ga0495604_0245697 | 3300047317 | Bacteria | 1222 |
| 521 | Ga0495604_0788061 | 3300047317 | Bacteria | 599 |
| 522 | Ga0495674_0004337 | 3300047319 | Bacteria | 13635 |
| 523 | Ga0495674_0036575 | 3300047319 | Bacteria | 4418 |
| 524 | Ga0495676_0007780 | 3300047321 | Bacteria | 9832 |
| 525 | Ga0495676_0147592 | 3300047321 | Bacteria | 1678 |
| 526 | Ga0495680_0001263 | 3300047322 | Bacteria | 27605 |
| 527 | Ga0495680_0581729 | 3300047322 | Bacteria | 751 |
| 528 | Ga0495684_0007604 | 3300047471 | Bacteria | 8385 |
| 529 | Ga0495684_0030087 | 3300047471 | Bacteria | 4168 |
| 530 | Ga0495684_0479343 | 3300047471 | Bacteria | 859 |
| 531 | Ga0495593_0000732 | 3300047673 | Bacteria | 19043 |
| 532 | Ga0495614_0000557 | 3300048089 | Bacteria | 15456 |
| 533 | Ga0495614_0072198 | 3300048089 | Bacteria | 1489 |
| 534 | Ga0496100_0030261 | 3300048903 | Bacteria | 3357 |
| 535 | Ga0496100_1226679 | 3300048903 | Bacteria | 592 |
| 536 | Ga0496101_0006366 | 3300048904 | Bacteria | 7599 |
| 537 | Ga0496101_0095023 | 3300048904 | Bacteria | 2223 |
| 538 | Ga0496101_0319407 | 3300048904 | Bacteria | 1218 |
| 539 | Ga0496101_0954084 | 3300048904 | Bacteria | 675 |
| 540 | Ga0496102_0108541 | 3300048905 | Bacteria | 2585 |
| 541 | Ga0496102_0484871 | 3300048905 | Bacteria | 1158 |
| 542 | Ga0496102_1601388 | 3300048905 | Bacteria | 569 |
| 543 | Ga0496103_0160847 | 3300048906 | Bacteria | 1440 |
| 544 | Ga0496104_0119244 | 3300048907 | Bacteria | 2533 |
| 545 | Ga0496105_0187197 | 3300048908 | Bacteria | 1694 |
| 546 | Ga0496106_0110837 | 3300048909 | Bacteria | 2136 |
| 547 | Ga0496107_0010564 | 3300048910 | Bacteria | 6418 |
| 548 | Ga0496108_0006645 | 3300048911 | Bacteria | 9367 |
| 549 | Ga0496108_0007700 | 3300048911 | Bacteria | 8726 |
| 550 | Ga0496109_0001934 | 3300048912 | Bacteria | 17222 |
| 551 | Ga0496109_0081876 | 3300048912 | Bacteria | 2974 |
| 552 | Ga0496109_0125107 | 3300048912 | Bacteria | 2397 |
| 553 | Ga0496110_0032858 | 3300048913 | Bacteria | 4485 |
| 554 | Ga0496110_0073039 | 3300048913 | Bacteria | 3044 |
| 555 | Ga0496110_0218420 | 3300048913 | Bacteria | 1733 |
| 556 | Ga0496111_0014931 | 3300048914 | Bacteria | 5319 |
| 557 | Ga0496111_0123737 | 3300048914 | Bacteria | 1911 |
| 558 | Ga0496111_0160277 | 3300048914 | Bacteria | 1670 |
| 559 | Ga0496112_0007079 | 3300048915 | Bacteria | 9912 |
| 560 | Ga0496112_0039823 | 3300048915 | Bacteria | 4593 |
| 561 | Ga0496112_0110513 | 3300048915 | Bacteria | 2719 |
| 562 | Ga0496112_0588131 | 3300048915 | Bacteria | 1045 |
| 563 | Ga0496112_1035491 | 3300048915 | Bacteria | 740 |
| 564 | Ga0496113_0097567 | 3300048916 | Bacteria | 2274 |
| 565 | Ga0496113_0259431 | 3300048916 | Bacteria | 1388 |
| 566 | Ga0496113_0922535 | 3300048916 | Bacteria | 690 |
| 567 | Ga0496113_1507849 | 3300048916 | Bacteria | 519 |
| 568 | Ga0496114_0063742 | 3300048917 | Bacteria | 3086 |
| 569 | Ga0496114_0140685 | 3300048917 | Bacteria | 2089 |
| 570 | Ga0496114_0267734 | 3300048917 | Bacteria | 1505 |
| 571 | Ga0496115_0591165 | 3300048918 | Bacteria | 883 |
| 572 | Ga0501034_0266654 | 3300049571 | Bacteria | 1654 |
| 573 | Ga0501040_0311879 | 3300049576 | Bacteria | 1125 |
| 574 | Ga0501040_0385919 | 3300049576 | Bacteria | 1005 |
| 575 | Ga0501046_0827389 | 3300049580 | Bacteria | 648 |
| 576 | Ga0501047_0021100 | 3300049581 | Bacteria | 6254 |
| 577 | Ga0501047_0127973 | 3300049581 | Bacteria | 2420 |
| 578 | Ga0501067_0013960 | 3300049583 | Bacteria | 4450 |
| 579 | Ga0501067_0061749 | 3300049583 | Bacteria | 2074 |
| 580 | Ga0501069_0059726 | 3300049585 | Bacteria | 2128 |
| 581 | Ga0501070_0009671 | 3300049586 | Bacteria | 8153 |
| 582 | Ga0501070_0010356 | 3300049586 | Bacteria | 7881 |
| 583 | Ga0501070_0014314 | 3300049586 | Bacteria | 6676 |
| 584 | Ga0501071_0064023 | 3300049587 | Bacteria | 2667 |
| 585 | Ga0501071_0314695 | 3300049587 | Bacteria | 1188 |
| 586 | Ga0501072_0012822 | 3300049588 | Bacteria | 6408 |
| 587 | Ga0501072_0489856 | 3300049588 | Bacteria | 972 |
| 588 | Ga0501074_0035771 | 3300049590 | Bacteria | 3598 |
| 589 | Ga0501074_0072379 | 3300049590 | Bacteria | 2476 |
| 590 | Ga0501074_0342879 | 3300049590 | Bacteria | 1060 |
| 591 | Ga0501075_0294822 | 3300049591 | Bacteria | 1236 |
| 592 | Ga0501075_0430212 | 3300049591 | Bacteria | 1006 |
| 593 | Ga0501076_0283778 | 3300049592 | Bacteria | 1357 |
| 594 | Ga0501076_1769809 | 3300049592 | Bacteria | 507 |
| 595 | Ga0501079_0009230 | 3300049741 | Bacteria | 7471 |
| 596 | Ga0501079_0149033 | 3300049741 | Bacteria | 1824 |
| 597 | Ga0501079_0150533 | 3300049741 | Bacteria | 1814 |
| 598 | Ga0501080_0005101 | 3300049742 | Bacteria | 11698 |
| 599 | Ga0501080_1469891 | 3300049742 | Bacteria | 580 |
| 600 | Ga0501081_0263738 | 3300049743 | Bacteria | 1259 |
| 601 | Ga0501083_0001297 | 3300049744 | Bacteria | 16900 |
| 602 | Ga0501035_0306938 | 3300049822 | Bacteria | 1336 |
| 603 | Ga0501035_0600197 | 3300049822 | Bacteria | 897 |
| 604 | Ga0501044_0428119 | 3300049823 | Bacteria | 1233 |
| 605 | Ga0501045_0086269 | 3300049824 | Bacteria | 2317 |
| 606 | nmdc:mga05p37_39439_c1 | 3300050507 | Bacteria | 5799 |
| 607 | nmdc:mga08y16_1480483_c1 | 3300050511 | Bacteria | 640 |
| 608 | nmdc:mga08y16_218293_c1 | 3300050511 | Bacteria | 1974 |
| 609 | nmdc:mga0n895_1006599_c1 | 3300050512 | Bacteria | 814 |
| 610 | nmdc:mga0n895_164125_c1 | 3300050512 | Bacteria | 2253 |
| 611 | nmdc:mga0n895_47778_c1 | 3300050512 | Bacteria | 4186 |
| 612 | nmdc:mga0rr50_213005_c1 | 3300050513 | Bacteria | 1592 |
| 613 | nmdc:mga0rr50_250507_c1 | 3300050513 | Bacteria | 1471 |
| 614 | nmdc:mga0a205_287569_c1 | 3300050515 | Bacteria | 1519 |
| 615 | nmdc:mga0a205_300588_c1 | 3300050515 | Bacteria | 1478 |
| 616 | Ga0495601_0005063 | 3300053077 | Bacteria | 7649 |
| 617 | Ga0495601_0006407 | 3300053077 | Bacteria | 6882 |
| 618 | Ga0495601_0026332 | 3300053077 | Bacteria | 3591 |
| 619 | Ga0495601_0605073 | 3300053077 | Bacteria | 703 |
| 620 | Ga0495612_0007992 | 3300053078 | Bacteria | 4307 |
| 621 | Ga0495612_0441465 | 3300053078 | Bacteria | 594 |
| 622 | Ga0495655_0328558 | 3300053083 | Bacteria | 531 |
| 623 | Ga0495619_0001368 | 3300053085 | Bacteria | 16040 |
| 624 | Ga0495619_0118221 | 3300053085 | Bacteria | 1816 |
| 625 | Ga0500566_0004146 | 3300053094 | Bacteria | 8645 |
| 626 | Ga0501084_1429245 | 3300054114 | Bacteria | 579 |
| 627 | Ga0587066_148541 | 3300059490 | Bacteria | 579 |
| 628 | Ga0587070_170407 | 3300059491 | Bacteria | 560 |
| 629 | Ga0587083_0164829 | 3300059505 | Bacteria | 609 |
| 630 | Ga0587083_0206411 | 3300059505 | Bacteria | 564 |
| 631 | Ga0587088_150452 | 3300059508 | Bacteria | 563 |
| 632 | Ga0587091_211672 | 3300059511 | Bacteria | 526 |
| 633 | Ga0587094_115285 | 3300059513 | Bacteria | 533 |
| 634 | Ga0587098_092447 | 3300059604 | Bacteria | 518 |
| 635 | Ga0587106_083299 | 3300059605 | Bacteria | 627 |
| 636 | Ga0587113_040616 | 3300059625 | Bacteria | 556 |
| 637 | Ga0587115_109514 | 3300059626 | Bacteria | 521 |
| 638 | Ga0587117_067999 | 3300059627 | Bacteria | 626 |
| 639 | Ga0587117_100780 | 3300059627 | Bacteria | 550 |
| 640 | Ga0587128_081156 | 3300059630 | Bacteria | 649 |
| 641 | Ga0587069_071279 | 3300059642 | Bacteria | 660 |
| 642 | Ga0587076_061076 | 3300059645 | Bacteria | 760 |
| 643 | Ga0587079_193845 | 3300059647 | Bacteria | 551 |
| 644 | Ga0587079_205117 | 3300059647 | Bacteria | 540 |
| 645 | Ga0587079_210684 | 3300059647 | Bacteria | 535 |
| 646 | Ga0587107_061295 | 3300059652 | Bacteria | 664 |
| 647 | Ga0587111_0082839 | 3300060346 | Bacteria | 770 |
| 648 | Ga0587111_0083332 | 3300060346 | Bacteria | 768 |
| 649 | Ga0501082_0227616 | 3300060353 | Bacteria | 1623 |
| 650 | Ga0466962_0010761 | 3300061719 | Bacteria | 4396 |
| 651 | Ga0466962_0728864 | 3300061719 | Bacteria | 509 |
| 652 | Ga0530510_0670244 | 3300061734 | Bacteria | 790 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300041443 | Ga0451789_1012533 | Ga0451789_1012533_21_302 | 59 |
| 2 | 3300047471 | Ga0495684_0479343 | Ga0495684_0479343_581_835 | 74 |
| 3 | 3300053077 | Ga0495601_0605073 | Ga0495601_0605073_434_688 | 74 |
| 4 | 3300046514 | Ga0495618_0147317 | Ga0495618_0147317_869_1174 | 75 |
| 5 | 3300025910 | Ga0207684_10363276 | Ga0207684_103632761 | 81 |
| 6 | 3300025922 | Ga0207646_10831574 | Ga0207646_108315742 | 81 |
| 7 | 3300005434 | Ga0070709_10221035 | Ga0070709_102210353 | 82 |
| 8 | 3300005435 | Ga0070714_100021974 | Ga0070714_1000219746 | 82 |
| 9 | 3300005435 | Ga0070714_100302060 | Ga0070714_1003020604 | 82 |
| 10 | 3300005436 | Ga0070713_100221979 | Ga0070713_1002219793 | 82 |
| 11 | 3300005439 | Ga0070711_100707531 | Ga0070711_1007075312 | 82 |
| 12 | 3300005445 | Ga0070708_100080498 | Ga0070708_1000804983 | 82 |
| 13 | 3300005467 | Ga0070706_100016811 | Ga0070706_1000168113 | 82 |
| 14 | 3300005468 | Ga0070707_100214354 | Ga0070707_1002143542 | 82 |
| 15 | 3300005468 | Ga0070707_100334808 | Ga0070707_1003348084 | 82 |
| 16 | 3300005471 | Ga0070698_100017517 | Ga0070698_1000175173 | 82 |
| 17 | 3300005471 | Ga0070698_100242411 | Ga0070698_1002424114 | 82 |
| 18 | 3300005546 | Ga0070696_101330766 | Ga0070696_1013307662 | 82 |
| 19 | 3300005937 | Ga0081455_10186374 | Ga0081455_101863742 | 82 |
| 20 | 3300005981 | Ga0081538_10058162 | Ga0081538_100581623 | 82 |
| 21 | 3300006028 | Ga0070717_10133109 | Ga0070717_101331092 | 82 |
| 22 | 3300006852 | Ga0075433_10296171 | Ga0075433_102961713 | 82 |
| 23 | 3300006871 | Ga0075434_100009519 | Ga0075434_1000095194 | 82 |
| 24 | 3300007076 | Ga0075435_100802216 | Ga0075435_1008022162 | 82 |
| 25 | 3300009098 | Ga0105245_10771881 | Ga0105245_107718811 | 82 |
| 26 | 3300009147 | Ga0114129_12029904 | Ga0114129_120299042 | 82 |
| 27 | 3300009176 | Ga0105242_10647697 | Ga0105242_106476972 | 82 |
| 28 | 3300010375 | Ga0105239_10803578 | Ga0105239_108035782 | 82 |
| 29 | 3300012490 | Ga0157322_1012827 | Ga0157322_10128272 | 82 |
| 30 | 3300025906 | Ga0207699_10289867 | Ga0207699_102898672 | 82 |
| 31 | 3300025910 | Ga0207684_10831640 | Ga0207684_108316401 | 82 |
| 32 | 3300025916 | Ga0207663_11244926 | Ga0207663_112449261 | 82 |
| 33 | 3300025922 | Ga0207646_10040720 | Ga0207646_100407203 | 82 |
| 34 | 3300025934 | Ga0207686_10242079 | Ga0207686_102420792 | 82 |
| 35 | 3300032002 | Ga0307416_102282044 | Ga0307416_1022820442 | 82 |
| 36 | 3300034819 | Ga0373958_0185450 | Ga0373958_0185450_130_435 | 82 |
| 37 | 3300037312 | Ga0395899_0183731 | Ga0395899_0183731_230_535 | 82 |
| 38 | 3300037418 | Ga0395900_0228700 | Ga0395900_0228700_1078_1383 | 82 |
| 39 | 3300037418 | Ga0395900_1255829 | Ga0395900_1255829_187_492 | 82 |
| 40 | 3300037466 | Ga0395898_0178667 | Ga0395898_0178667_1582_1887 | 82 |
| 41 | 3300037471 | Ga0395905_0229878 | Ga0395905_0229878_965_1270 | 82 |
| 42 | 3300037471 | Ga0395905_0845381 | Ga0395905_0845381_294_599 | 82 |
| 43 | 3300038443 | Ga0395901_0176171 | Ga0395901_0176171_1624_1929 | 82 |
| 44 | 3300038443 | Ga0395901_0376898 | Ga0395901_0376898_370_675 | 82 |
| 45 | 3300038443 | Ga0395901_1238711 | Ga0395901_1238711_83_388 | 82 |
| 46 | 3300044684 | Ga0466966_0336939 | Ga0466966_0336939_346_651 | 82 |
| 47 | 3300044842 | Ga0466957_0051735 | Ga0466957_0051735_1233_1538 | 82 |
| 48 | 3300046473 | Ga0495582_0036147 | Ga0495582_0036147_1930_2235 | 82 |
| 49 | 3300046473 | Ga0495582_0095326 | Ga0495582_0095326_871_1176 | 82 |
| 50 | 3300046473 | Ga0495582_0231824 | Ga0495582_0231824_60_365 | 82 |
| 51 | 3300046475 | Ga0495639_0558953 | Ga0495639_0558953_258_563 | 82 |
| 52 | 3300046499 | Ga0495594_0058692 | Ga0495594_0058692_1671_1976 | 82 |
| 53 | 3300046531 | Ga0495665_0409077 | Ga0495665_0409077_342_647 | 82 |
| 54 | 3300046557 | Ga0495622_0193164 | Ga0495622_0193164_414_719 | 82 |
| 55 | 3300046690 | Ga0495624_0270191 | Ga0495624_0270191_329_634 | 82 |
| 56 | 3300047315 | Ga0495581_0815074 | Ga0495581_0815074_119_424 | 82 |
| 57 | 3300047321 | Ga0495676_0147592 | Ga0495676_0147592_273_578 | 82 |
| 58 | 3300048089 | Ga0495614_0072198 | Ga0495614_0072198_869_1174 | 82 |
| 59 | 3300049592 | Ga0501076_1769809 | Ga0501076_1769809_92_397 | 82 |
| 60 | 3300050511 | nmdc:mga08y16_218293_c1 | nmdc:mga08y16_218293_c1_1654_1959 | 82 |
| 61 | 3300050512 | nmdc:mga0n895_164125_c1 | nmdc:mga0n895_164125_c1_38_343 | 82 |
| 62 | 3300050513 | nmdc:mga0rr50_213005_c1 | nmdc:mga0rr50_213005_c1_968_1273 | 82 |
| 63 | 3300050515 | nmdc:mga0a205_300588_c1 | nmdc:mga0a205_300588_c1_108_413 | 82 |
| 64 | 3300005435 | Ga0070714_101036858 | Ga0070714_1010368582 | 83 |
| 65 | 3300005981 | Ga0081538_10039817 | Ga0081538_100398177 | 83 |
| 66 | 3300006844 | Ga0075428_100002031 | Ga0075428_10000203125 | 83 |
| 67 | 3300009147 | Ga0114129_10000663 | Ga0114129_100006636 | 83 |
| 68 | 3300025929 | Ga0207664_11312895 | Ga0207664_113128951 | 83 |
| 69 | 3300050507 | nmdc:mga05p37_39439_c1 | nmdc:mga05p37_39439_c1_1905_2213 | 83 |
| 70 | 3300005937 | Ga0081455_10005292 | Ga0081455_100052928 | 84 |
| 71 | 3300035725 | Ga0373947_0122855 | Ga0373947_0122855_598_882 | 84 |
| 72 | 3300046477 | Ga0495664_0318602 | Ga0495664_0318602_562_846 | 84 |
| 73 | 3300046533 | Ga0495640_0891658 | Ga0495640_0891658_130_414 | 84 |
| 74 | 3300046559 | Ga0495667_0651563 | Ga0495667_0651563_126_410 | 84 |
| 75 | 3300053077 | Ga0495601_0026332 | Ga0495601_0026332_771_1055 | 84 |
| 76 | 3300053085 | Ga0495619_0118221 | Ga0495619_0118221_129_413 | 84 |
| 77 | 3300045049 | Ga0466959_0034372 | Ga0466959_0034372_3432_3737 | 85 |
| 78 | 3300031251 | Ga0265327_10020771 | Ga0265327_100207717 | 87 |
| 79 | 3300039438 | Ga0436360_1187886 | Ga0436360_1187886_1130_1423 | 87 |
| 80 | 3300039450 | Ga0436363_1297278 | Ga0436363_1297278_143_445 | 87 |
| 81 | 3300048915 | Ga0496112_0110513 | Ga0496112_0110513_885_1178 | 87 |
| 82 | 3300059627 | Ga0587117_067999 | Ga0587117_067999_292_600 | 87 |
| 83 | 3300060346 | Ga0587111_0083332 | Ga0587111_0083332_322_615 | 87 |
| 84 | 3300046477 | Ga0495664_0325591 | Ga0495664_0325591_156_461 | 89 |
| 85 | 3300005365 | Ga0070688_101003803 | Ga0070688_1010038031 | 90 |
| 86 | 3300005435 | Ga0070714_100051876 | Ga0070714_1000518766 | 90 |
| 87 | 3300009098 | Ga0105245_12068663 | Ga0105245_120686632 | 90 |
| 88 | 3300014968 | Ga0157379_10370007 | Ga0157379_103700072 | 90 |
| 89 | 3300025929 | Ga0207664_10098342 | Ga0207664_100983423 | 90 |
| 90 | 3300036401 | Ga0373937_0837980 | Ga0373937_0837980_489_791 | 90 |
| 91 | 3300037312 | Ga0395899_0186005 | Ga0395899_0186005_701_1003 | 90 |
| 92 | 3300005327 | Ga0070658_10022933 | Ga0070658_100229333 | 91 |
| 93 | 3300005327 | Ga0070658_10165010 | Ga0070658_101650103 | 91 |
| 94 | 3300005327 | Ga0070658_10192112 | Ga0070658_101921123 | 91 |
| 95 | 3300005327 | Ga0070658_10908344 | Ga0070658_109083442 | 91 |
| 96 | 3300005329 | Ga0070683_100001951 | Ga0070683_10000195113 | 91 |
| 97 | 3300005329 | Ga0070683_100101284 | Ga0070683_1001012843 | 91 |
| 98 | 3300005329 | Ga0070683_100208837 | Ga0070683_1002088372 | 91 |
| 99 | 3300005329 | Ga0070683_100229770 | Ga0070683_1002297702 | 91 |
| 100 | 3300005336 | Ga0070680_100007887 | Ga0070680_1000078878 | 91 |
| 101 | 3300005336 | Ga0070680_100075245 | Ga0070680_1000752452 | 91 |
| 102 | 3300005336 | Ga0070680_100744660 | Ga0070680_1007446602 | 91 |
| 103 | 3300005337 | Ga0070682_100063342 | Ga0070682_1000633423 | 91 |
| 104 | 3300005339 | Ga0070660_100021867 | Ga0070660_1000218677 | 91 |
| 105 | 3300005339 | Ga0070660_100685952 | Ga0070660_1006859521 | 91 |
| 106 | 3300005339 | Ga0070660_100866411 | Ga0070660_1008664112 | 91 |
| 107 | 3300005339 | Ga0070660_100960001 | Ga0070660_1009600011 | 91 |
| 108 | 3300005341 | Ga0070691_10387246 | Ga0070691_103872462 | 91 |
| 109 | 3300005344 | Ga0070661_100039193 | Ga0070661_1000391937 | 91 |
| 110 | 3300005344 | Ga0070661_100094101 | Ga0070661_1000941012 | 91 |
| 111 | 3300005366 | Ga0070659_100208823 | Ga0070659_1002088233 | 91 |
| 112 | 3300005434 | Ga0070709_10037054 | Ga0070709_100370543 | 91 |
| 113 | 3300005435 | Ga0070714_100045084 | Ga0070714_1000450842 | 91 |
| 114 | 3300005435 | Ga0070714_100091757 | Ga0070714_1000917573 | 91 |
| 115 | 3300005435 | Ga0070714_100950241 | Ga0070714_1009502411 | 91 |
| 116 | 3300005435 | Ga0070714_101127741 | Ga0070714_1011277412 | 91 |
| 117 | 3300005436 | Ga0070713_100026902 | Ga0070713_1000269028 | 91 |
| 118 | 3300005436 | Ga0070713_100821402 | Ga0070713_1008214023 | 91 |
| 119 | 3300005436 | Ga0070713_101186487 | Ga0070713_1011864871 | 91 |
| 120 | 3300005437 | Ga0070710_11371456 | Ga0070710_113714561 | 91 |
| 121 | 3300005439 | Ga0070711_100022262 | Ga0070711_1000222625 | 91 |
| 122 | 3300005444 | Ga0070694_100014705 | Ga0070694_1000147058 | 91 |
| 123 | 3300005445 | Ga0070708_100414201 | Ga0070708_1004142013 | 91 |
| 124 | 3300005456 | Ga0070678_100206979 | Ga0070678_1002069794 | 91 |
| 125 | 3300005458 | Ga0070681_10002352 | Ga0070681_1000235221 | 91 |
| 126 | 3300005458 | Ga0070681_10002582 | Ga0070681_1000258223 | 91 |
| 127 | 3300005458 | Ga0070681_10010574 | Ga0070681_1001057412 | 91 |
| 128 | 3300005467 | Ga0070706_100529015 | Ga0070706_1005290152 | 91 |
| 129 | 3300005468 | Ga0070707_100897528 | Ga0070707_1008975281 | 91 |
| 130 | 3300005471 | Ga0070698_100158682 | Ga0070698_1001586822 | 91 |
| 131 | 3300005471 | Ga0070698_100833407 | Ga0070698_1008334073 | 91 |
| 132 | 3300005530 | Ga0070679_100007912 | Ga0070679_10000791214 | 91 |
| 133 | 3300005530 | Ga0070679_100072281 | Ga0070679_1000722814 | 91 |
| 134 | 3300005535 | Ga0070684_100016458 | Ga0070684_1000164584 | 91 |
| 135 | 3300005535 | Ga0070684_100036184 | Ga0070684_1000361842 | 91 |
| 136 | 3300005535 | Ga0070684_100971745 | Ga0070684_1009717452 | 91 |
| 137 | 3300005535 | Ga0070684_101109502 | Ga0070684_1011095022 | 91 |
| 138 | 3300005539 | Ga0068853_100204687 | Ga0068853_1002046872 | 91 |
| 139 | 3300005545 | Ga0070695_100000007 | Ga0070695_10000000776 | 91 |
| 140 | 3300005545 | Ga0070695_100632017 | Ga0070695_1006320172 | 91 |
| 141 | 3300005546 | Ga0070696_101412861 | Ga0070696_1014128612 | 91 |
| 142 | 3300005563 | Ga0068855_100030809 | Ga0068855_1000308094 | 91 |
| 143 | 3300005563 | Ga0068855_101023735 | Ga0068855_1010237351 | 91 |
| 144 | 3300005563 | Ga0068855_101070103 | Ga0068855_1010701031 | 91 |
| 145 | 3300005563 | Ga0068855_101102168 | Ga0068855_1011021682 | 91 |
| 146 | 3300005577 | Ga0068857_100024780 | Ga0068857_1000247802 | 91 |
| 147 | 3300005577 | Ga0068857_100097777 | Ga0068857_1000977774 | 91 |
| 148 | 3300005578 | Ga0068854_100288704 | Ga0068854_1002887042 | 91 |
| 149 | 3300005614 | Ga0068856_100249630 | Ga0068856_1002496302 | 91 |
| 150 | 3300005614 | Ga0068856_100810267 | Ga0068856_1008102672 | 91 |
| 151 | 3300005616 | Ga0068852_101194313 | Ga0068852_1011943132 | 91 |
| 152 | 3300005937 | Ga0081455_10031254 | Ga0081455_100312543 | 91 |
| 153 | 3300005985 | Ga0081539_10166670 | Ga0081539_101666702 | 91 |
| 154 | 3300006028 | Ga0070717_10043162 | Ga0070717_100431622 | 91 |
| 155 | 3300006028 | Ga0070717_10266039 | Ga0070717_102660393 | 91 |
| 156 | 3300006163 | Ga0070715_10032441 | Ga0070715_100324413 | 91 |
| 157 | 3300006163 | Ga0070715_10186187 | Ga0070715_101861872 | 91 |
| 158 | 3300006173 | Ga0070716_100169941 | Ga0070716_1001699412 | 91 |
| 159 | 3300006173 | Ga0070716_101194086 | Ga0070716_1011940862 | 91 |
| 160 | 3300006175 | Ga0070712_101113233 | Ga0070712_1011132332 | 91 |
| 161 | 3300006852 | Ga0075433_10018360 | Ga0075433_100183601 | 91 |
| 162 | 3300006852 | Ga0075433_10116012 | Ga0075433_101160123 | 91 |
| 163 | 3300006871 | Ga0075434_100054617 | Ga0075434_1000546177 | 91 |
| 164 | 3300006871 | Ga0075434_100770360 | Ga0075434_1007703602 | 91 |
| 165 | 3300006880 | Ga0075429_100256518 | Ga0075429_1002565183 | 91 |
| 166 | 3300007076 | Ga0075435_100370177 | Ga0075435_1003701772 | 91 |
| 167 | 3300007076 | Ga0075435_101626497 | Ga0075435_1016264971 | 91 |
| 168 | 3300009093 | Ga0105240_10030751 | Ga0105240_100307515 | 91 |
| 169 | 3300009093 | Ga0105240_10097231 | Ga0105240_100972317 | 91 |
| 170 | 3300009093 | Ga0105240_10236909 | Ga0105240_102369092 | 91 |
| 171 | 3300009093 | Ga0105240_10334080 | Ga0105240_103340803 | 91 |
| 172 | 3300009098 | Ga0105245_10023444 | Ga0105245_100234449 | 91 |
| 173 | 3300009148 | Ga0105243_10069693 | Ga0105243_100696933 | 91 |
| 174 | 3300009545 | Ga0105237_10189280 | Ga0105237_101892804 | 91 |
| 175 | 3300009551 | Ga0105238_10170715 | Ga0105238_101707154 | 91 |
| 176 | 3300012483 | Ga0157337_1006084 | Ga0157337_10060841 | 91 |
| 177 | 3300012488 | Ga0157343_1000717 | Ga0157343_10007171 | 91 |
| 178 | 3300012500 | Ga0157314_1015485 | Ga0157314_10154852 | 91 |
| 179 | 3300013102 | Ga0157371_10861010 | Ga0157371_108610102 | 91 |
| 180 | 3300013104 | Ga0157370_10011210 | Ga0157370_1001121013 | 91 |
| 181 | 3300013104 | Ga0157370_10018219 | Ga0157370_100182192 | 91 |
| 182 | 3300013104 | Ga0157370_10747666 | Ga0157370_107476662 | 91 |
| 183 | 3300013104 | Ga0157370_11328543 | Ga0157370_113285432 | 91 |
| 184 | 3300013105 | Ga0157369_10002883 | Ga0157369_100028834 | 91 |
| 185 | 3300013105 | Ga0157369_10182179 | Ga0157369_101821792 | 91 |
| 186 | 3300013296 | Ga0157374_10629473 | Ga0157374_106294732 | 91 |
| 187 | 3300013296 | Ga0157374_10656399 | Ga0157374_106563991 | 91 |
| 188 | 3300013306 | Ga0163162_10838063 | Ga0163162_108380632 | 91 |
| 189 | 3300013306 | Ga0163162_11082479 | Ga0163162_110824792 | 91 |
| 190 | 3300013307 | Ga0157372_10029039 | Ga0157372_100290393 | 91 |
| 191 | 3300013307 | Ga0157372_10391346 | Ga0157372_103913464 | 91 |
| 192 | 3300013307 | Ga0157372_10437965 | Ga0157372_104379652 | 91 |
| 193 | 3300013307 | Ga0157372_11832215 | Ga0157372_118322152 | 91 |
| 194 | 3300013308 | Ga0157375_11220789 | Ga0157375_112207893 | 91 |
| 195 | 3300014326 | Ga0157380_11278662 | Ga0157380_112786622 | 91 |
| 196 | 3300014497 | Ga0182008_10002753 | Ga0182008_100027537 | 91 |
| 197 | 3300014497 | Ga0182008_10024953 | Ga0182008_100249532 | 91 |
| 198 | 3300014497 | Ga0182008_10265433 | Ga0182008_102654332 | 91 |
| 199 | 3300015261 | Ga0182006_1143170 | Ga0182006_11431701 | 91 |
| 200 | 3300015261 | Ga0182006_1162713 | Ga0182006_11627132 | 91 |
| 201 | 3300015262 | Ga0182007_10117022 | Ga0182007_101170222 | 91 |
| 202 | 3300015265 | Ga0182005_1133303 | Ga0182005_11333032 | 91 |
| 203 | 3300020070 | Ga0206356_10280546 | Ga0206356_102805461 | 91 |
| 204 | 3300020070 | Ga0206356_11617167 | Ga0206356_116171673 | 91 |
| 205 | 3300020075 | Ga0206349_1900966 | Ga0206349_19009661 | 91 |
| 206 | 3300020080 | Ga0206350_10482534 | Ga0206350_104825342 | 91 |
| 207 | 3300020081 | Ga0206354_10133384 | Ga0206354_101333842 | 91 |
| 208 | 3300020081 | Ga0206354_10432702 | Ga0206354_104327022 | 91 |
| 209 | 3300020081 | Ga0206354_11071589 | Ga0206354_110715892 | 91 |
| 210 | 3300020082 | Ga0206353_10004980 | Ga0206353_100049809 | 91 |
| 211 | 3300020082 | Ga0206353_10866168 | Ga0206353_108661689 | 91 |
| 212 | 3300020082 | Ga0206353_11626609 | Ga0206353_116266092 | 91 |
| 213 | 3300020610 | Ga0154015_1165229 | Ga0154015_11652292 | 91 |
| 214 | 3300020610 | Ga0154015_1211618 | Ga0154015_12116182 | 91 |
| 215 | 3300020610 | Ga0154015_1354810 | Ga0154015_13548102 | 91 |
| 216 | 3300022467 | Ga0224712_10125102 | Ga0224712_101251022 | 91 |
| 217 | 3300025905 | Ga0207685_10156599 | Ga0207685_101565991 | 91 |
| 218 | 3300025906 | Ga0207699_10029387 | Ga0207699_100293875 | 91 |
| 219 | 3300025906 | Ga0207699_11343937 | Ga0207699_113439372 | 91 |
| 220 | 3300025909 | Ga0207705_10003887 | Ga0207705_100038876 | 91 |
| 221 | 3300025909 | Ga0207705_10017397 | Ga0207705_100173973 | 91 |
| 222 | 3300025909 | Ga0207705_10055106 | Ga0207705_100551063 | 91 |
| 223 | 3300025910 | Ga0207684_11530231 | Ga0207684_115302311 | 91 |
| 224 | 3300025912 | Ga0207707_10004063 | Ga0207707_1000406319 | 91 |
| 225 | 3300025912 | Ga0207707_10008618 | Ga0207707_1000861813 | 91 |
| 226 | 3300025912 | Ga0207707_10085336 | Ga0207707_100853365 | 91 |
| 227 | 3300025913 | Ga0207695_10182090 | Ga0207695_101820902 | 91 |
| 228 | 3300025913 | Ga0207695_10244492 | Ga0207695_102444922 | 91 |
| 229 | 3300025913 | Ga0207695_10394645 | Ga0207695_103946452 | 91 |
| 230 | 3300025913 | Ga0207695_10418696 | Ga0207695_104186962 | 91 |
| 231 | 3300025914 | Ga0207671_10126668 | Ga0207671_101266682 | 91 |
| 232 | 3300025916 | Ga0207663_10033597 | Ga0207663_100335974 | 91 |
| 233 | 3300025917 | Ga0207660_10018636 | Ga0207660_100186367 | 91 |
| 234 | 3300025917 | Ga0207660_10061836 | Ga0207660_100618362 | 91 |
| 235 | 3300025917 | Ga0207660_10196183 | Ga0207660_101961832 | 91 |
| 236 | 3300025917 | Ga0207660_10234096 | Ga0207660_102340962 | 91 |
| 237 | 3300025919 | Ga0207657_10002690 | Ga0207657_100026909 | 91 |
| 238 | 3300025920 | Ga0207649_10063761 | Ga0207649_100637615 | 91 |
| 239 | 3300025921 | Ga0207652_10019328 | Ga0207652_100193289 | 91 |
| 240 | 3300025921 | Ga0207652_10022742 | Ga0207652_100227427 | 91 |
| 241 | 3300025921 | Ga0207652_10025683 | Ga0207652_100256837 | 91 |
| 242 | 3300025921 | Ga0207652_10422723 | Ga0207652_104227232 | 91 |
| 243 | 3300025922 | Ga0207646_10783910 | Ga0207646_107839102 | 91 |
| 244 | 3300025922 | Ga0207646_11215303 | Ga0207646_112153032 | 91 |
| 245 | 3300025924 | Ga0207694_10451089 | Ga0207694_104510892 | 91 |
| 246 | 3300025924 | Ga0207694_10931816 | Ga0207694_109318162 | 91 |
| 247 | 3300025927 | Ga0207687_10838302 | Ga0207687_108383022 | 91 |
| 248 | 3300025928 | Ga0207700_10000002 | Ga0207700_10000002603 | 91 |
| 249 | 3300025928 | Ga0207700_10353708 | Ga0207700_103537083 | 91 |
| 250 | 3300025928 | Ga0207700_10371224 | Ga0207700_103712242 | 91 |
| 251 | 3300025928 | Ga0207700_11058666 | Ga0207700_110586662 | 91 |
| 252 | 3300025929 | Ga0207664_10031085 | Ga0207664_100310852 | 91 |
| 253 | 3300025929 | Ga0207664_10130990 | Ga0207664_101309902 | 91 |
| 254 | 3300025929 | Ga0207664_10176988 | Ga0207664_101769884 | 91 |
| 255 | 3300025929 | Ga0207664_10794695 | Ga0207664_107946952 | 91 |
| 256 | 3300025931 | Ga0207644_10957269 | Ga0207644_109572692 | 91 |
| 257 | 3300025932 | Ga0207690_11726752 | Ga0207690_117267522 | 91 |
| 258 | 3300025934 | Ga0207686_10059516 | Ga0207686_100595164 | 91 |
| 259 | 3300025934 | Ga0207686_10207491 | Ga0207686_102074913 | 91 |
| 260 | 3300025935 | Ga0207709_10057868 | Ga0207709_100578684 | 91 |
| 261 | 3300025938 | Ga0207704_10380929 | Ga0207704_103809291 | 91 |
| 262 | 3300025939 | Ga0207665_10002200 | Ga0207665_1000220017 | 91 |
| 263 | 3300025939 | Ga0207665_10181167 | Ga0207665_101811673 | 91 |
| 264 | 3300025939 | Ga0207665_10212723 | Ga0207665_102127234 | 91 |
| 265 | 3300025939 | Ga0207665_10379502 | Ga0207665_103795023 | 91 |
| 266 | 3300025940 | Ga0207691_11053773 | Ga0207691_110537732 | 91 |
| 267 | 3300025941 | Ga0207711_10656114 | Ga0207711_106561142 | 91 |
| 268 | 3300025941 | Ga0207711_11344590 | Ga0207711_113445901 | 91 |
| 269 | 3300025944 | Ga0207661_10003839 | Ga0207661_100038394 | 91 |
| 270 | 3300025944 | Ga0207661_10025797 | Ga0207661_100257977 | 91 |
| 271 | 3300025944 | Ga0207661_10060022 | Ga0207661_100600222 | 91 |
| 272 | 3300025944 | Ga0207661_10276732 | Ga0207661_102767323 | 91 |
| 273 | 3300025944 | Ga0207661_11221473 | Ga0207661_112214731 | 91 |
| 274 | 3300025949 | Ga0207667_10050181 | Ga0207667_100501817 | 91 |
| 275 | 3300025981 | Ga0207640_11459578 | Ga0207640_114595781 | 91 |
| 276 | 3300026023 | Ga0207677_10799876 | Ga0207677_107998762 | 91 |
| 277 | 3300026041 | Ga0207639_10606341 | Ga0207639_106063412 | 91 |
| 278 | 3300026067 | Ga0207678_11874223 | Ga0207678_118742231 | 91 |
| 279 | 3300026078 | Ga0207702_10152300 | Ga0207702_101523004 | 91 |
| 280 | 3300026078 | Ga0207702_11249466 | Ga0207702_112494662 | 91 |
| 281 | 3300026095 | Ga0207676_12359693 | Ga0207676_123596931 | 91 |
| 282 | 3300026116 | Ga0207674_10016181 | Ga0207674_1001618110 | 91 |
| 283 | 3300026116 | Ga0207674_10100393 | Ga0207674_101003935 | 91 |
| 284 | 3300026121 | Ga0207683_10172724 | Ga0207683_101727244 | 91 |
| 285 | 3300028558 | Ga0265326_10009205 | Ga0265326_100092054 | 91 |
| 286 | 3300028558 | Ga0265326_10031889 | Ga0265326_100318892 | 91 |
| 287 | 3300028563 | Ga0265319_1005903 | Ga0265319_10059033 | 91 |
| 288 | 3300028563 | Ga0265319_1078233 | Ga0265319_10782332 | 91 |
| 289 | 3300028573 | Ga0265334_10006308 | Ga0265334_100063086 | 91 |
| 290 | 3300028573 | Ga0265334_10017490 | Ga0265334_100174903 | 91 |
| 291 | 3300028577 | Ga0265318_10001217 | Ga0265318_1000121718 | 91 |
| 292 | 3300028653 | Ga0265323_10069259 | Ga0265323_100692593 | 91 |
| 293 | 3300028654 | Ga0265322_10005028 | Ga0265322_100050286 | 91 |
| 294 | 3300028666 | Ga0265336_10021950 | Ga0265336_100219503 | 91 |
| 295 | 3300028800 | Ga0265338_10002936 | Ga0265338_1000293621 | 91 |
| 296 | 3300028800 | Ga0265338_10004663 | Ga0265338_1000466311 | 91 |
| 297 | 3300028800 | Ga0265338_10011028 | Ga0265338_100110289 | 91 |
| 298 | 3300028800 | Ga0265338_10023362 | Ga0265338_1002336211 | 91 |
| 299 | 3300029957 | Ga0265324_10023833 | Ga0265324_100238333 | 91 |
| 300 | 3300031235 | Ga0265330_10001984 | Ga0265330_100019845 | 91 |
| 301 | 3300031238 | Ga0265332_10001963 | Ga0265332_100019639 | 91 |
| 302 | 3300031239 | Ga0265328_10007996 | Ga0265328_100079964 | 91 |
| 303 | 3300031240 | Ga0265320_10010508 | Ga0265320_100105089 | 91 |
| 304 | 3300031241 | Ga0265325_10001625 | Ga0265325_1000162515 | 91 |
| 305 | 3300031242 | Ga0265329_10004462 | Ga0265329_100044629 | 91 |
| 306 | 3300031247 | Ga0265340_10074233 | Ga0265340_100742333 | 91 |
| 307 | 3300031250 | Ga0265331_10004771 | Ga0265331_100047716 | 91 |
| 308 | 3300031251 | Ga0265327_10010871 | Ga0265327_1001087110 | 91 |
| 309 | 3300031344 | Ga0265316_10077706 | Ga0265316_100777065 | 91 |
| 310 | 3300031344 | Ga0265316_10372808 | Ga0265316_103728082 | 91 |
| 311 | 3300031595 | Ga0265313_10009457 | Ga0265313_100094574 | 91 |
| 312 | 3300031595 | Ga0265313_10052738 | Ga0265313_100527383 | 91 |
| 313 | 3300031711 | Ga0265314_10039580 | Ga0265314_100395803 | 91 |
| 314 | 3300031712 | Ga0265342_10012474 | Ga0265342_100124749 | 91 |
| 315 | 3300031995 | Ga0307409_100595419 | Ga0307409_1005954191 | 91 |
| 316 | 3300032133 | Ga0316583_10026733 | Ga0316583_100267332 | 91 |
| 317 | 3300032133 | Ga0316583_10044736 | Ga0316583_100447363 | 91 |
| 318 | 3300035089 | Ga0373944_0065864 | Ga0373944_0065864_164_469 | 91 |
| 319 | 3300035111 | Ga0373923_0378572 | Ga0373923_0378572_349_654 | 91 |
| 320 | 3300035113 | Ga0373936_0019904 | Ga0373936_0019904_840_1145 | 91 |
| 321 | 3300035113 | Ga0373936_0071391 | Ga0373936_0071391_765_1070 | 91 |
| 322 | 3300035116 | Ga0373945_0006065 | Ga0373945_0006065_3441_3746 | 91 |
| 323 | 3300035119 | Ga0373956_0456669 | Ga0373956_0456669_197_511 | 91 |
| 324 | 3300035120 | Ga0373957_0557154 | Ga0373957_0557154_109_414 | 91 |
| 325 | 3300035170 | Ga0373943_0000628 | Ga0373943_0000628_5354_5659 | 91 |
| 326 | 3300035410 | Ga0373924_0113029 | Ga0373924_0113029_600_905 | 91 |
| 327 | 3300035692 | Ga0373935_0015369 | Ga0373935_0015369_3776_4081 | 91 |
| 328 | 3300035695 | Ga0373927_0049940 | Ga0373927_0049940_472_777 | 91 |
| 329 | 3300035725 | Ga0373947_0004063 | Ga0373947_0004063_451_756 | 91 |
| 330 | 3300037068 | Ga0373925_0002950 | Ga0373925_0002950_10985_11290 | 91 |
| 331 | 3300037312 | Ga0395899_0730590 | Ga0395899_0730590_79_384 | 91 |
| 332 | 3300037418 | Ga0395900_0687282 | Ga0395900_0687282_314_619 | 91 |
| 333 | 3300037418 | Ga0395900_1189210 | Ga0395900_1189210_30_335 | 91 |
| 334 | 3300037471 | Ga0395905_1103584 | Ga0395905_1103584_135_440 | 91 |
| 335 | 3300038443 | Ga0395901_0218834 | Ga0395901_0218834_546_851 | 91 |
| 336 | 3300038443 | Ga0395901_0254299 | Ga0395901_0254299_740_1045 | 91 |
| 337 | 3300038443 | Ga0395901_0775274 | Ga0395901_0775274_393_698 | 91 |
| 338 | 3300039437 | Ga0436365_1158022 | Ga0436365_1158022_95_400 | 91 |
| 339 | 3300039438 | Ga0436360_1211651 | Ga0436360_1211651_4011_4316 | 91 |
| 340 | 3300039447 | Ga0436361_1157274 | Ga0436361_1157274_145_450 | 91 |
| 341 | 3300039453 | Ga0436362_0404353 | Ga0436362_0404353_158_463 | 91 |
| 342 | 3300041408 | Ga0439453_0001773 | Ga0439453_0001773_1172_1477 | 91 |
| 343 | 3300041463 | Ga0451804_1120031 | Ga0451804_1120031_535_840 | 91 |
| 344 | 3300042011 | Ga0439454_003880 | Ga0439454_003880_798_1103 | 91 |
| 345 | 3300044656 | Ga0466969_0003769 | Ga0466969_0003769_2172_2477 | 91 |
| 346 | 3300044683 | Ga0466965_0154088 | Ga0466965_0154088_341_646 | 91 |
| 347 | 3300044683 | Ga0466965_0347836 | Ga0466965_0347836_477_782 | 91 |
| 348 | 3300044683 | Ga0466965_0382883 | Ga0466965_0382883_150_455 | 91 |
| 349 | 3300044684 | Ga0466966_0039151 | Ga0466966_0039151_989_1294 | 91 |
| 350 | 3300044684 | Ga0466966_0113754 | Ga0466966_0113754_426_731 | 91 |
| 351 | 3300044684 | Ga0466966_0178062 | Ga0466966_0178062_200_505 | 91 |
| 352 | 3300044693 | Ga0466961_0288470 | Ga0466961_0288470_343_648 | 91 |
| 353 | 3300044693 | Ga0466961_0316943 | Ga0466961_0316943_137_442 | 91 |
| 354 | 3300044693 | Ga0466961_0389319 | Ga0466961_0389319_202_507 | 91 |
| 355 | 3300044694 | Ga0466963_0000137 | Ga0466963_0000137_22411_22716 | 91 |
| 356 | 3300044694 | Ga0466963_0000276 | Ga0466963_0000276_15134_15439 | 91 |
| 357 | 3300044694 | Ga0466963_0000632 | Ga0466963_0000632_3922_4227 | 91 |
| 358 | 3300044694 | Ga0466963_0000673 | Ga0466963_0000673_12397_12702 | 91 |
| 359 | 3300044694 | Ga0466963_0000741 | Ga0466963_0000741_7878_8183 | 91 |
| 360 | 3300044694 | Ga0466963_0002688 | Ga0466963_0002688_1963_2268 | 91 |
| 361 | 3300044694 | Ga0466963_0005725 | Ga0466963_0005725_6350_6655 | 91 |
| 362 | 3300044694 | Ga0466963_0038983 | Ga0466963_0038983_1711_2016 | 91 |
| 363 | 3300044694 | Ga0466963_0042447 | Ga0466963_0042447_1456_1761 | 91 |
| 364 | 3300044694 | Ga0466963_0076759 | Ga0466963_0076759_454_759 | 91 |
| 365 | 3300044694 | Ga0466963_0280509 | Ga0466963_0280509_695_1000 | 91 |
| 366 | 3300044694 | Ga0466963_0291769 | Ga0466963_0291769_449_754 | 91 |
| 367 | 3300044694 | Ga0466963_0705761 | Ga0466963_0705761_78_383 | 91 |
| 368 | 3300044706 | Ga0466964_0006725 | Ga0466964_0006725_3022_3327 | 91 |
| 369 | 3300044706 | Ga0466964_0007832 | Ga0466964_0007832_2480_2785 | 91 |
| 370 | 3300044706 | Ga0466964_0013707 | Ga0466964_0013707_1823_2128 | 91 |
| 371 | 3300044706 | Ga0466964_0072548 | Ga0466964_0072548_901_1206 | 91 |
| 372 | 3300044706 | Ga0466964_0082817 | Ga0466964_0082817_666_971 | 91 |
| 373 | 3300044706 | Ga0466964_0145094 | Ga0466964_0145094_371_676 | 91 |
| 374 | 3300044706 | Ga0466964_0284728 | Ga0466964_0284728_185_490 | 91 |
| 375 | 3300044719 | Ga0466971_0001552 | Ga0466971_0001552_7613_7918 | 91 |
| 376 | 3300044719 | Ga0466971_0001914 | Ga0466971_0001914_1515_1820 | 91 |
| 377 | 3300044719 | Ga0466971_0037646 | Ga0466971_0037646_706_1011 | 91 |
| 378 | 3300044735 | Ga0466968_0004224 | Ga0466968_0004224_2723_3028 | 91 |
| 379 | 3300044735 | Ga0466968_0006450 | Ga0466968_0006450_765_1070 | 91 |
| 380 | 3300044735 | Ga0466968_0008503 | Ga0466968_0008503_1975_2280 | 91 |
| 381 | 3300044765 | Ga0466970_0014456 | Ga0466970_0014456_3365_3670 | 91 |
| 382 | 3300044842 | Ga0466957_0001689 | Ga0466957_0001689_8880_9185 | 91 |
| 383 | 3300044842 | Ga0466957_0003049 | Ga0466957_0003049_5339_5644 | 91 |
| 384 | 3300044842 | Ga0466957_0003662 | Ga0466957_0003662_4786_5091 | 91 |
| 385 | 3300044842 | Ga0466957_0022017 | Ga0466957_0022017_2370_2675 | 91 |
| 386 | 3300044842 | Ga0466957_0039136 | Ga0466957_0039136_2460_2765 | 91 |
| 387 | 3300044842 | Ga0466957_0160392 | Ga0466957_0160392_712_1017 | 91 |
| 388 | 3300044842 | Ga0466957_0208452 | Ga0466957_0208452_301_606 | 91 |
| 389 | 3300044842 | Ga0466957_0671945 | Ga0466957_0671945_73_378 | 91 |
| 390 | 3300044842 | Ga0466957_0942087 | Ga0466957_0942087_232_537 | 91 |
| 391 | 3300044901 | Ga0466960_0004958 | Ga0466960_0004958_4632_4937 | 91 |
| 392 | 3300044901 | Ga0466960_0101262 | Ga0466960_0101262_691_996 | 91 |
| 393 | 3300044901 | Ga0466960_0193673 | Ga0466960_0193673_314_619 | 91 |
| 394 | 3300044901 | Ga0466960_0367764 | Ga0466960_0367764_329_634 | 91 |
| 395 | 3300045049 | Ga0466959_0010806 | Ga0466959_0010806_2682_2987 | 91 |
| 396 | 3300045049 | Ga0466959_0013103 | Ga0466959_0013103_4688_4993 | 91 |
| 397 | 3300045049 | Ga0466959_0151365 | Ga0466959_0151365_1080_1385 | 91 |
| 398 | 3300045049 | Ga0466959_0662311 | Ga0466959_0662311_10_315 | 91 |
| 399 | 3300045836 | Ga0466958_0002075 | Ga0466958_0002075_7187_7492 | 91 |
| 400 | 3300045836 | Ga0466958_0004062 | Ga0466958_0004062_3906_4211 | 91 |
| 401 | 3300045836 | Ga0466958_0005483 | Ga0466958_0005483_2082_2387 | 91 |
| 402 | 3300045836 | Ga0466958_0007875 | Ga0466958_0007875_1499_1804 | 91 |
| 403 | 3300045836 | Ga0466958_0010034 | Ga0466958_0010034_1525_1830 | 91 |
| 404 | 3300045836 | Ga0466958_0030937 | Ga0466958_0030937_1907_2212 | 91 |
| 405 | 3300045836 | Ga0466958_0038614 | Ga0466958_0038614_484_789 | 91 |
| 406 | 3300045836 | Ga0466958_0116393 | Ga0466958_0116393_645_950 | 91 |
| 407 | 3300045836 | Ga0466958_0178992 | Ga0466958_0178992_736_1041 | 91 |
| 408 | 3300045836 | Ga0466958_0299619 | Ga0466958_0299619_85_390 | 91 |
| 409 | 3300045836 | Ga0466958_0490985 | Ga0466958_0490985_136_441 | 91 |
| 410 | 3300045836 | Ga0466958_1010761 | Ga0466958_1010761_102_407 | 91 |
| 411 | 3300045976 | Ga0466967_0000300 | Ga0466967_0000300_6746_7051 | 91 |
| 412 | 3300045976 | Ga0466967_0002201 | Ga0466967_0002201_3570_3875 | 91 |
| 413 | 3300045976 | Ga0466967_0003956 | Ga0466967_0003956_1046_1351 | 91 |
| 414 | 3300045976 | Ga0466967_0043133 | Ga0466967_0043133_2737_3042 | 91 |
| 415 | 3300045976 | Ga0466967_0044979 | Ga0466967_0044979_948_1253 | 91 |
| 416 | 3300045976 | Ga0466967_0058202 | Ga0466967_0058202_2828_3133 | 91 |
| 417 | 3300045976 | Ga0466967_0079604 | Ga0466967_0079604_1630_1935 | 91 |
| 418 | 3300045976 | Ga0466967_0104505 | Ga0466967_0104505_892_1197 | 91 |
| 419 | 3300045976 | Ga0466967_0134110 | Ga0466967_0134110_795_1100 | 91 |
| 420 | 3300045976 | Ga0466967_0179243 | Ga0466967_0179243_367_672 | 91 |
| 421 | 3300045976 | Ga0466967_0189071 | Ga0466967_0189071_674_979 | 91 |
| 422 | 3300045976 | Ga0466967_0207017 | Ga0466967_0207017_1399_1704 | 91 |
| 423 | 3300045976 | Ga0466967_0284491 | Ga0466967_0284491_619_924 | 91 |
| 424 | 3300045976 | Ga0466967_0425213 | Ga0466967_0425213_523_828 | 91 |
| 425 | 3300045976 | Ga0466967_0508189 | Ga0466967_0508189_306_611 | 91 |
| 426 | 3300045976 | Ga0466967_0766082 | Ga0466967_0766082_22_327 | 91 |
| 427 | 3300045976 | Ga0466967_1030558 | Ga0466967_1030558_426_731 | 91 |
| 428 | 3300045976 | Ga0466967_2305337 | Ga0466967_2305337_98_403 | 91 |
| 429 | 3300045976 | Ga0466967_2386858 | Ga0466967_2386858_204_509 | 91 |
| 430 | 3300046454 | Ga0495592_0163026 | Ga0495592_0163026_596_901 | 91 |
| 431 | 3300046454 | Ga0495592_0825576 | Ga0495592_0825576_208_513 | 91 |
| 432 | 3300046459 | Ga0495629_0014949 | Ga0495629_0014949_3076_3381 | 91 |
| 433 | 3300046459 | Ga0495629_0018947 | Ga0495629_0018947_2780_3085 | 91 |
| 434 | 3300046459 | Ga0495629_0184357 | Ga0495629_0184357_353_658 | 91 |
| 435 | 3300046461 | Ga0495641_0003398 | Ga0495641_0003398_4264_4569 | 91 |
| 436 | 3300046462 | Ga0495651_0054488 | Ga0495651_0054488_2474_2779 | 91 |
| 437 | 3300046462 | Ga0495651_0271049 | Ga0495651_0271049_445_750 | 91 |
| 438 | 3300046463 | Ga0495653_0005518 | Ga0495653_0005518_9162_9467 | 91 |
| 439 | 3300046463 | Ga0495653_0351210 | Ga0495653_0351210_246_551 | 91 |
| 440 | 3300046472 | Ga0495580_0006348 | Ga0495580_0006348_676_981 | 91 |
| 441 | 3300046473 | Ga0495582_0007435 | Ga0495582_0007435_3564_3869 | 91 |
| 442 | 3300046475 | Ga0495639_0000291 | Ga0495639_0000291_14962_15267 | 91 |
| 443 | 3300046476 | Ga0495662_0006357 | Ga0495662_0006357_2068_2373 | 91 |
| 444 | 3300046477 | Ga0495664_0007586 | Ga0495664_0007586_3659_3964 | 91 |
| 445 | 3300046477 | Ga0495664_0371177 | Ga0495664_0371177_319_624 | 91 |
| 446 | 3300046511 | Ga0495608_0363750 | Ga0495608_0363750_527_832 | 91 |
| 447 | 3300046511 | Ga0495608_0714352 | Ga0495608_0714352_133_438 | 91 |
| 448 | 3300046514 | Ga0495618_0006267 | Ga0495618_0006267_4596_4901 | 91 |
| 449 | 3300046514 | Ga0495618_0242156 | Ga0495618_0242156_57_362 | 91 |
| 450 | 3300046516 | Ga0495628_0056803 | Ga0495628_0056803_465_770 | 91 |
| 451 | 3300046517 | Ga0495630_0000631 | Ga0495630_0000631_12456_12761 | 91 |
| 452 | 3300046517 | Ga0495630_0029216 | Ga0495630_0029216_2261_2566 | 91 |
| 453 | 3300046517 | Ga0495630_0177662 | Ga0495630_0177662_232_537 | 91 |
| 454 | 3300046526 | Ga0495666_0000270 | Ga0495666_0000270_18440_18745 | 91 |
| 455 | 3300046529 | Ga0495652_0004378 | Ga0495652_0004378_12456_12761 | 91 |
| 456 | 3300046531 | Ga0495665_0001487 | Ga0495665_0001487_4136_4441 | 91 |
| 457 | 3300046533 | Ga0495640_0019213 | Ga0495640_0019213_4551_4856 | 91 |
| 458 | 3300046533 | Ga0495640_0048828 | Ga0495640_0048828_549_854 | 91 |
| 459 | 3300046535 | Ga0495586_0004266 | Ga0495586_0004266_3659_3964 | 91 |
| 460 | 3300046535 | Ga0495586_0040895 | Ga0495586_0040895_17_322 | 91 |
| 461 | 3300046543 | Ga0495645_0035797 | Ga0495645_0035797_3227_3532 | 91 |
| 462 | 3300046543 | Ga0495645_0759221 | Ga0495645_0759221_207_512 | 91 |
| 463 | 3300046559 | Ga0495667_0015940 | Ga0495667_0015940_4468_4773 | 91 |
| 464 | 3300046642 | Ga0495634_0004560 | Ga0495634_0004560_6860_7165 | 91 |
| 465 | 3300046642 | Ga0495634_0546683 | Ga0495634_0546683_11_316 | 91 |
| 466 | 3300046663 | Ga0495635_0006305 | Ga0495635_0006305_3541_3846 | 91 |
| 467 | 3300046663 | Ga0495635_0013922 | Ga0495635_0013922_1132_1437 | 91 |
| 468 | 3300046680 | Ga0495646_0185283 | Ga0495646_0185283_496_801 | 91 |
| 469 | 3300046681 | Ga0495647_0000243 | Ga0495647_0000243_3531_3836 | 91 |
| 470 | 3300046683 | Ga0495658_0000970 | Ga0495658_0000970_10500_10805 | 91 |
| 471 | 3300046689 | Ga0495613_0008628 | Ga0495613_0008628_2196_2501 | 91 |
| 472 | 3300046689 | Ga0495613_0292129 | Ga0495613_0292129_370_675 | 91 |
| 473 | 3300046690 | Ga0495624_0001273 | Ga0495624_0001273_12362_12667 | 91 |
| 474 | 3300046809 | Ga0495600_0534694 | Ga0495600_0534694_357_662 | 91 |
| 475 | 3300047315 | Ga0495581_0000258 | Ga0495581_0000258_16735_17040 | 91 |
| 476 | 3300047317 | Ga0495604_0788061 | Ga0495604_0788061_243_548 | 91 |
| 477 | 3300047319 | Ga0495674_0004337 | Ga0495674_0004337_4666_4971 | 91 |
| 478 | 3300047319 | Ga0495674_0036575 | Ga0495674_0036575_3717_4022 | 91 |
| 479 | 3300047321 | Ga0495676_0007780 | Ga0495676_0007780_2196_2501 | 91 |
| 480 | 3300047322 | Ga0495680_0001263 | Ga0495680_0001263_13326_13631 | 91 |
| 481 | 3300047322 | Ga0495680_0581729 | Ga0495680_0581729_249_554 | 91 |
| 482 | 3300047471 | Ga0495684_0007604 | Ga0495684_0007604_3531_3836 | 91 |
| 483 | 3300047471 | Ga0495684_0030087 | Ga0495684_0030087_397_702 | 91 |
| 484 | 3300047673 | Ga0495593_0000732 | Ga0495593_0000732_4136_4441 | 91 |
| 485 | 3300048089 | Ga0495614_0000557 | Ga0495614_0000557_10559_10864 | 91 |
| 486 | 3300048903 | Ga0496100_0030261 | Ga0496100_0030261_1486_1791 | 91 |
| 487 | 3300048903 | Ga0496100_1226679 | Ga0496100_1226679_211_516 | 91 |
| 488 | 3300048904 | Ga0496101_0006366 | Ga0496101_0006366_6392_6697 | 91 |
| 489 | 3300048904 | Ga0496101_0095023 | Ga0496101_0095023_1116_1421 | 91 |
| 490 | 3300048904 | Ga0496101_0954084 | Ga0496101_0954084_58_363 | 91 |
| 491 | 3300048905 | Ga0496102_0108541 | Ga0496102_0108541_725_1030 | 91 |
| 492 | 3300048905 | Ga0496102_0484871 | Ga0496102_0484871_705_1010 | 91 |
| 493 | 3300048905 | Ga0496102_1601388 | Ga0496102_1601388_192_497 | 91 |
| 494 | 3300048906 | Ga0496103_0160847 | Ga0496103_0160847_961_1311 | 91 |
| 495 | 3300048909 | Ga0496106_0110837 | Ga0496106_0110837_1212_1517 | 91 |
| 496 | 3300048910 | Ga0496107_0010564 | Ga0496107_0010564_833_1138 | 91 |
| 497 | 3300048911 | Ga0496108_0007700 | Ga0496108_0007700_7874_8179 | 91 |
| 498 | 3300048912 | Ga0496109_0001934 | Ga0496109_0001934_11551_11856 | 91 |
| 499 | 3300048913 | Ga0496110_0032858 | Ga0496110_0032858_1476_1781 | 91 |
| 500 | 3300048913 | Ga0496110_0073039 | Ga0496110_0073039_796_1101 | 91 |
| 501 | 3300048914 | Ga0496111_0014931 | Ga0496111_0014931_1695_2000 | 91 |
| 502 | 3300048914 | Ga0496111_0160277 | Ga0496111_0160277_386_691 | 91 |
| 503 | 3300048915 | Ga0496112_0039823 | Ga0496112_0039823_4257_4562 | 91 |
| 504 | 3300048915 | Ga0496112_0588131 | Ga0496112_0588131_706_1011 | 91 |
| 505 | 3300048915 | Ga0496112_1035491 | Ga0496112_1035491_305_610 | 91 |
| 506 | 3300048916 | Ga0496113_0097567 | Ga0496113_0097567_958_1263 | 91 |
| 507 | 3300048916 | Ga0496113_0259431 | Ga0496113_0259431_378_683 | 91 |
| 508 | 3300048916 | Ga0496113_0922535 | Ga0496113_0922535_113_418 | 91 |
| 509 | 3300048916 | Ga0496113_1507849 | Ga0496113_1507849_43_348 | 91 |
| 510 | 3300048917 | Ga0496114_0140685 | Ga0496114_0140685_392_697 | 91 |
| 511 | 3300048917 | Ga0496114_0267734 | Ga0496114_0267734_375_680 | 91 |
| 512 | 3300049571 | Ga0501034_0266654 | Ga0501034_0266654_820_1125 | 91 |
| 513 | 3300049581 | Ga0501047_0021100 | Ga0501047_0021100_3626_3931 | 91 |
| 514 | 3300049581 | Ga0501047_0127973 | Ga0501047_0127973_709_1014 | 91 |
| 515 | 3300049583 | Ga0501067_0061749 | Ga0501067_0061749_117_422 | 91 |
| 516 | 3300049586 | Ga0501070_0009671 | Ga0501070_0009671_1754_2059 | 91 |
| 517 | 3300049586 | Ga0501070_0010356 | Ga0501070_0010356_2607_2912 | 91 |
| 518 | 3300049586 | Ga0501070_0014314 | Ga0501070_0014314_180_485 | 91 |
| 519 | 3300049588 | Ga0501072_0012822 | Ga0501072_0012822_1777_2082 | 91 |
| 520 | 3300049590 | Ga0501074_0035771 | Ga0501074_0035771_1227_1532 | 91 |
| 521 | 3300049590 | Ga0501074_0072379 | Ga0501074_0072379_981_1286 | 91 |
| 522 | 3300049590 | Ga0501074_0342879 | Ga0501074_0342879_107_412 | 91 |
| 523 | 3300049741 | Ga0501079_0009230 | Ga0501079_0009230_3474_3779 | 91 |
| 524 | 3300049742 | Ga0501080_0005101 | Ga0501080_0005101_751_1056 | 91 |
| 525 | 3300049744 | Ga0501083_0001297 | Ga0501083_0001297_14760_15065 | 91 |
| 526 | 3300049822 | Ga0501035_0306938 | Ga0501035_0306938_594_899 | 91 |
| 527 | 3300049823 | Ga0501044_0428119 | Ga0501044_0428119_841_1146 | 91 |
| 528 | 3300050512 | nmdc:mga0n895_1006599_c1 | nmdc:mga0n895_1006599_c1_496_801 | 91 |
| 529 | 3300050512 | nmdc:mga0n895_47778_c1 | nmdc:mga0n895_47778_c1_2558_2863 | 91 |
| 530 | 3300050513 | nmdc:mga0rr50_250507_c1 | nmdc:mga0rr50_250507_c1_441_746 | 91 |
| 531 | 3300050515 | nmdc:mga0a205_287569_c1 | nmdc:mga0a205_287569_c1_1196_1501 | 91 |
| 532 | 3300053077 | Ga0495601_0005063 | Ga0495601_0005063_2196_2501 | 91 |
| 533 | 3300053077 | Ga0495601_0006407 | Ga0495601_0006407_1909_2214 | 91 |
| 534 | 3300053078 | Ga0495612_0007992 | Ga0495612_0007992_2254_2559 | 91 |
| 535 | 3300053083 | Ga0495655_0328558 | Ga0495655_0328558_66_371 | 91 |
| 536 | 3300053085 | Ga0495619_0001368 | Ga0495619_0001368_14030_14335 | 91 |
| 537 | 3300053094 | Ga0500566_0004146 | Ga0500566_0004146_956_1261 | 91 |
| 538 | 3300054114 | Ga0501084_1429245 | Ga0501084_1429245_116_421 | 91 |
| 539 | 3300059490 | Ga0587066_148541 | Ga0587066_148541_229_534 | 91 |
| 540 | 3300059491 | Ga0587070_170407 | Ga0587070_170407_182_487 | 91 |
| 541 | 3300059505 | Ga0587083_0164829 | Ga0587083_0164829_34_378 | 91 |
| 542 | 3300059508 | Ga0587088_150452 | Ga0587088_150452_173_478 | 91 |
| 543 | 3300059511 | Ga0587091_211672 | Ga0587091_211672_52_357 | 91 |
| 544 | 3300059513 | Ga0587094_115285 | Ga0587094_115285_149_454 | 91 |
| 545 | 3300059604 | Ga0587098_092447 | Ga0587098_092447_16_321 | 91 |
| 546 | 3300059605 | Ga0587106_083299 | Ga0587106_083299_260_565 | 91 |
| 547 | 3300059625 | Ga0587113_040616 | Ga0587113_040616_186_491 | 91 |
| 548 | 3300059626 | Ga0587115_109514 | Ga0587115_109514_17_322 | 91 |
| 549 | 3300059627 | Ga0587117_100780 | Ga0587117_100780_192_497 | 91 |
| 550 | 3300059630 | Ga0587128_081156 | Ga0587128_081156_195_500 | 91 |
| 551 | 3300059642 | Ga0587069_071279 | Ga0587069_071279_101_406 | 91 |
| 552 | 3300059645 | Ga0587076_061076 | Ga0587076_061076_182_487 | 91 |
| 553 | 3300059647 | Ga0587079_205117 | Ga0587079_205117_42_347 | 91 |
| 554 | 3300059647 | Ga0587079_210684 | Ga0587079_210684_127_432 | 91 |
| 555 | 3300059652 | Ga0587107_061295 | Ga0587107_061295_164_469 | 91 |
| 556 | 3300060346 | Ga0587111_0082839 | Ga0587111_0082839_86_391 | 91 |
| 557 | 3300061719 | Ga0466962_0010761 | Ga0466962_0010761_2175_2480 | 91 |
| 558 | 3300061719 | Ga0466962_0728864 | Ga0466962_0728864_180_485 | 91 |
| 559 | 3300061734 | Ga0530510_0670244 | Ga0530510_0670244_410_715 | 91 |
| 560 | 3300005355 | Ga0070671_100655714 | Ga0070671_1006557142 | 92 |
| 561 | 3300006175 | Ga0070712_100822352 | Ga0070712_1008223522 | 92 |
| 562 | 3300009551 | Ga0105238_12259277 | Ga0105238_122592771 | 92 |
| 563 | 3300025915 | Ga0207693_11292262 | Ga0207693_112922622 | 92 |
| 564 | 3300025931 | Ga0207644_10564790 | Ga0207644_105647902 | 92 |
| 565 | 3300044842 | Ga0466957_0091504 | Ga0466957_0091504_1406_1714 | 92 |
| 566 | 3300044901 | Ga0466960_0066119 | Ga0466960_0066119_553_861 | 92 |
| 567 | 3300045976 | Ga0466967_0290513 | Ga0466967_0290513_655_963 | 92 |
| 568 | 3300046473 | Ga0495582_0844511 | Ga0495582_0844511_186_503 | 92 |
| 569 | 3300046514 | Ga0495618_0409009 | Ga0495618_0409009_173_490 | 92 |
| 570 | 3300046663 | Ga0495635_0491252 | Ga0495635_0491252_87_395 | 92 |
| 571 | 3300047317 | Ga0495604_0245697 | Ga0495604_0245697_249_557 | 92 |
| 572 | 3300048904 | Ga0496101_0319407 | Ga0496101_0319407_103_411 | 92 |
| 573 | 3300048907 | Ga0496104_0119244 | Ga0496104_0119244_636_944 | 92 |
| 574 | 3300048908 | Ga0496105_0187197 | Ga0496105_0187197_1271_1579 | 92 |
| 575 | 3300048911 | Ga0496108_0006645 | Ga0496108_0006645_3507_3815 | 92 |
| 576 | 3300048912 | Ga0496109_0081876 | Ga0496109_0081876_932_1240 | 92 |
| 577 | 3300048912 | Ga0496109_0125107 | Ga0496109_0125107_1910_2218 | 92 |
| 578 | 3300048913 | Ga0496110_0218420 | Ga0496110_0218420_401_709 | 92 |
| 579 | 3300048914 | Ga0496111_0123737 | Ga0496111_0123737_857_1165 | 92 |
| 580 | 3300048915 | Ga0496112_0007079 | Ga0496112_0007079_3215_3523 | 92 |
| 581 | 3300048917 | Ga0496114_0063742 | Ga0496114_0063742_1494_1802 | 92 |
| 582 | 3300049583 | Ga0501067_0013960 | Ga0501067_0013960_3553_3861 | 92 |
| 583 | 3300049585 | Ga0501069_0059726 | Ga0501069_0059726_216_524 | 92 |
| 584 | 3300003373 | JGI25407J50210_10084025 | JGI25407J50210_100840252 | 93 |
| 585 | 3300005336 | Ga0070680_100577082 | Ga0070680_1005770823 | 93 |
| 586 | 3300005337 | Ga0070682_101215812 | Ga0070682_1012158121 | 93 |
| 587 | 3300005339 | Ga0070660_100052730 | Ga0070660_1000527305 | 93 |
| 588 | 3300005366 | Ga0070659_100336249 | Ga0070659_1003362493 | 93 |
| 589 | 3300005434 | Ga0070709_11331947 | Ga0070709_113319471 | 93 |
| 590 | 3300005435 | Ga0070714_100021544 | Ga0070714_1000215448 | 93 |
| 591 | 3300005435 | Ga0070714_100383323 | Ga0070714_1003833232 | 93 |
| 592 | 3300005435 | Ga0070714_101236672 | Ga0070714_1012366722 | 93 |
| 593 | 3300005530 | Ga0070679_101399899 | Ga0070679_1013998992 | 93 |
| 594 | 3300005981 | Ga0081538_10003303 | Ga0081538_100033037 | 93 |
| 595 | 3300007788 | Ga0099795_10171099 | Ga0099795_101710992 | 93 |
| 596 | 3300009093 | Ga0105240_11041553 | Ga0105240_110415532 | 93 |
| 597 | 3300009094 | Ga0111539_12157614 | Ga0111539_121576142 | 93 |
| 598 | 3300013100 | Ga0157373_10107685 | Ga0157373_101076853 | 93 |
| 599 | 3300013102 | Ga0157371_10262758 | Ga0157371_102627582 | 93 |
| 600 | 3300013104 | Ga0157370_10747274 | Ga0157370_107472743 | 93 |
| 601 | 3300014326 | Ga0157380_10545104 | Ga0157380_105451042 | 93 |
| 602 | 3300025912 | Ga0207707_10084317 | Ga0207707_100843174 | 93 |
| 603 | 3300025913 | Ga0207695_10129279 | Ga0207695_101292793 | 93 |
| 604 | 3300025917 | Ga0207660_11309995 | Ga0207660_113099952 | 93 |
| 605 | 3300025919 | Ga0207657_10011803 | Ga0207657_1001180310 | 93 |
| 606 | 3300025921 | Ga0207652_10063037 | Ga0207652_100630374 | 93 |
| 607 | 3300025921 | Ga0207652_11294252 | Ga0207652_112942522 | 93 |
| 608 | 3300025929 | Ga0207664_10269729 | Ga0207664_102697294 | 93 |
| 609 | 3300025929 | Ga0207664_10432326 | Ga0207664_104323262 | 93 |
| 610 | 3300025929 | Ga0207664_11472715 | Ga0207664_114727151 | 93 |
| 611 | 3300025932 | Ga0207690_10660376 | Ga0207690_106603761 | 93 |
| 612 | 3300025944 | Ga0207661_10335228 | Ga0207661_103352283 | 93 |
| 613 | 3300026067 | Ga0207678_10529584 | Ga0207678_105295842 | 93 |
| 614 | 3300027907 | Ga0207428_11242980 | Ga0207428_112429801 | 93 |
| 615 | 3300037466 | Ga0395898_0263849 | Ga0395898_0263849_335_646 | 93 |
| 616 | 3300037471 | Ga0395905_0992280 | Ga0395905_0992280_408_719 | 93 |
| 617 | 3300044693 | Ga0466961_0376196 | Ga0466961_0376196_286_597 | 93 |
| 618 | 3300044693 | Ga0466961_0456284 | Ga0466961_0456284_428_748 | 93 |
| 619 | 3300044694 | Ga0466963_0455271 | Ga0466963_0455271_373_684 | 93 |
| 620 | 3300044694 | Ga0466963_0900440 | Ga0466963_0900440_40_360 | 93 |
| 621 | 3300044706 | Ga0466964_0012342 | Ga0466964_0012342_1706_2026 | 93 |
| 622 | 3300044706 | Ga0466964_0259981 | Ga0466964_0259981_206_517 | 93 |
| 623 | 3300044719 | Ga0466971_0029827 | Ga0466971_0029827_1522_1842 | 93 |
| 624 | 3300044719 | Ga0466971_0160720 | Ga0466971_0160720_548_859 | 93 |
| 625 | 3300044735 | Ga0466968_0216570 | Ga0466968_0216570_559_879 | 93 |
| 626 | 3300045836 | Ga0466958_0087483 | Ga0466958_0087483_415_726 | 93 |
| 627 | 3300045836 | Ga0466958_0172170 | Ga0466958_0172170_390_710 | 93 |
| 628 | 3300045976 | Ga0466967_0000047 | Ga0466967_0000047_19770_20081 | 93 |
| 629 | 3300045976 | Ga0466967_0344547 | Ga0466967_0344547_381_692 | 93 |
| 630 | 3300046543 | Ga0495645_0394003 | Ga0495645_0394003_118_429 | 93 |
| 631 | 3300046675 | Ga0495657_0358762 | Ga0495657_0358762_300_611 | 93 |
| 632 | 3300048918 | Ga0496115_0591165 | Ga0496115_0591165_49_360 | 93 |
| 633 | 3300049576 | Ga0501040_0311879 | Ga0501040_0311879_730_1041 | 93 |
| 634 | 3300049576 | Ga0501040_0385919 | Ga0501040_0385919_316_627 | 93 |
| 635 | 3300049580 | Ga0501046_0827389 | Ga0501046_0827389_44_355 | 93 |
| 636 | 3300049587 | Ga0501071_0064023 | Ga0501071_0064023_517_828 | 93 |
| 637 | 3300049587 | Ga0501071_0314695 | Ga0501071_0314695_853_1164 | 93 |
| 638 | 3300049588 | Ga0501072_0489856 | Ga0501072_0489856_198_509 | 93 |
| 639 | 3300049591 | Ga0501075_0294822 | Ga0501075_0294822_469_780 | 93 |
| 640 | 3300049591 | Ga0501075_0430212 | Ga0501075_0430212_46_357 | 93 |
| 641 | 3300049592 | Ga0501076_0283778 | Ga0501076_0283778_381_692 | 93 |
| 642 | 3300049741 | Ga0501079_0149033 | Ga0501079_0149033_824_1135 | 93 |
| 643 | 3300049741 | Ga0501079_0150533 | Ga0501079_0150533_1160_1471 | 93 |
| 644 | 3300049742 | Ga0501080_1469891 | Ga0501080_1469891_158_469 | 93 |
| 645 | 3300049743 | Ga0501081_0263738 | Ga0501081_0263738_442_753 | 93 |
| 646 | 3300049822 | Ga0501035_0600197 | Ga0501035_0600197_180_491 | 93 |
| 647 | 3300049824 | Ga0501045_0086269 | Ga0501045_0086269_741_1052 | 93 |
| 648 | 3300050511 | nmdc:mga08y16_1480483_c1 | nmdc:mga08y16_1480483_c1_268_579 | 93 |
| 649 | 3300053078 | Ga0495612_0441465 | Ga0495612_0441465_148_459 | 93 |
| 650 | 3300059505 | Ga0587083_0206411 | Ga0587083_0206411_106_417 | 93 |
| 651 | 3300059647 | Ga0587079_193845 | Ga0587079_193845_165_476 | 93 |
| 652 | 3300060353 | Ga0501082_0227616 | Ga0501082_0227616_643_954 | 93 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2zvs-assembly1.cif.gz_A | crystal structure of the 2[4fe-4s] ferredoxin from escherichia coli | 0.8224 | 17 | 43 |
| 1h98-assembly1.cif.gz_A | new insights into thermostability of bacterial ferredoxins: high resolution crystal structure of the seven-iron ferredoxin from thermus thermophilus | 0.7259 | 7 | 62 |
| 3or1-assembly1.cif.gz_D | crystal structure of dissimilatory sulfite reductase i (dsri) | 0.7076 | 18 | 45 |
| 2xsj-assembly1.cif.gz_D | structure of desulforubidin from desulfomicrobium norvegicum | 0.6987 | 11 | 45 |
| 1fdn-assembly1.cif.gz_A | refined crystal structure of the 2[4fe-4s] ferredoxin from clostridium acidurici at 1.84 angstroms resolution | 0.6893 | 15 | 52 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1h98A00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.7259 | 7 | 62 | 3.30.70.20 |
| 1fcaA00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.6876 | 16 | 52 | 3.30.70.20 |
| 2v4jA04 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.6851 | 18 | 45 | 3.30.70.20 |
| af_O50433_2_106_3.30.70.20 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.6734 | 2 | 62 | 3.30.70.20 |
| 1bd6A00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.6642 | 3 | 65 | 3.30.70.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W1JHG4-F1-model_v4 | Ferredoxin | 0.9004 | 16 | 92 |
GO:0009055
GO:0046872 GO:0051538 GO:0051539 |
| AF-A0A2N1UPJ6-F1-model_v4 | Ferredoxin | 0.825 | 17 | 45 |
GO:0046872
GO:0051536 |
| AF-A0A7G9WBM1-F1-model_v4 | Aldo/keto reductase | 0.7924 | 17 | 45 |
GO:0005829
GO:0016491 GO:0046872 GO:0051536 |
| AF-A0A645G770-F1-model_v4 | 4Fe-4S ferredoxin-type domain-containing protein | 0.7855 | 16 | 45 |
|
| AF-A0A7W1JHG4-F1-model_v4 | Ferredoxin | 0.7849 | 16 | 92 |
GO:0009055
GO:0046872 GO:0051538 GO:0051539 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar