F472708

General Info

Members Datasets Scaffolds Average Seq Length
652 290 652 93

Family's Representative Sequence

Representative Sequence 3300048906|Ga0496103_0160847|Ga0496103_0160847_961_1311
Length 106
Sequence LAARPAATAIYSRGAVTYIIAEPCIDIKDRSCVDVCPVDCIHEADRILVIDPEECIDCGAFPEDALPDKWNAFVEINYAYDKGMNVVDELTQKYADENNVQNEPID

Samples

Sample ID Description Type Environment
1 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
36 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
39 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
46 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
57 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
58 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
59 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
72 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
73 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
74 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
80 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
118 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
119 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
120 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
121 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
122 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
123 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
124 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
125 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
126 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
127 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
128 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
129 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
130 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
131 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
132 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
133 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
134 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
135 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
136 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
137 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
138 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
139 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
140 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
141 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
142 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
143 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
144 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
145 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
146 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
147 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
148 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
149 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
150 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
151 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
152 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
153 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
154 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
155 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
156 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
157 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
158 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
159 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
160 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
161 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
162 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
163 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
164 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
165 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
166 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
167 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
168 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
169 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
170 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
171 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
172 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
173 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
174 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
175 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
176 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
177 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
178 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
179 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
180 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
181 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
182 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
183 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
184 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
185 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
186 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
187 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
188 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
189 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
190 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
191 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
192 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
193 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
194 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
195 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
196 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
197 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
198 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
199 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
200 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
201 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
202 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
203 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
204 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
205 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
206 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
207 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
208 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
209 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
210 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
211 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
212 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
213 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
214 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
215 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
216 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
217 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
218 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
219 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
220 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
221 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
222 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
223 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
224 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
225 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
226 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
227 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
228 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
229 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
230 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
231 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
232 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
233 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
234 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
235 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
236 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
237 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
238 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
239 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
240 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
241 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
246 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
247 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
248 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
249 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
250 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
251 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
252 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
253 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
254 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
255 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
256 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
257 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
260 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
261 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
262 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
263 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
264 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
265 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
266 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
267 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
268 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
269 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
270 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
271 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
272 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
273 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
274 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
275 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
276 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
277 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
278 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
279 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
280 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
281 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
282 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
283 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
284 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
285 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
286 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
287 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
288 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
289 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
290 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.48
Metatranscriptomes 5.52
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.15
Nodule 0
Rhizoplane 6.13
Rhizosphere 93.4
Stem 0
Stem Tuber 0
Unclassified 0.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10084025 3300003373 Unclassified 790
2 Ga0070658_10022933 3300005327 Bacteria 5011
3 Ga0070658_10165010 3300005327 Bacteria 1859
4 Ga0070658_10192112 3300005327 Bacteria 1721
5 Ga0070658_10908344 3300005327 Bacteria 766
6 Ga0070683_100001951 3300005329 Bacteria 16161
7 Ga0070683_100101284 3300005329 Bacteria 2712
8 Ga0070683_100208837 3300005329 Bacteria 1854
9 Ga0070683_100229770 3300005329 Bacteria 1764
10 Ga0070680_100007887 3300005336 Bacteria 8120
11 Ga0070680_100075245 3300005336 Bacteria 2779
12 Ga0070680_100577082 3300005336 Bacteria 965
13 Ga0070680_100744660 3300005336 Bacteria 844
14 Ga0070682_100063342 3300005337 Bacteria 2344
15 Ga0070682_101215812 3300005337 Bacteria 637
16 Ga0070660_100021867 3300005339 Bacteria 4723
17 Ga0070660_100052730 3300005339 Bacteria 3136
18 Ga0070660_100685952 3300005339 Bacteria 858
19 Ga0070660_100866411 3300005339 Bacteria 761
20 Ga0070660_100960001 3300005339 Bacteria 722
21 Ga0070691_10387246 3300005341 Bacteria 785
22 Ga0070661_100039193 3300005344 Bacteria 3452
23 Ga0070661_100094101 3300005344 Bacteria 2220
24 Ga0070671_100655714 3300005355 Bacteria 909
25 Ga0070688_101003803 3300005365 Bacteria 663
26 Ga0070659_100208823 3300005366 Bacteria 1609
27 Ga0070659_100336249 3300005366 Bacteria 1265
28 Ga0070709_10037054 3300005434 Bacteria 2975
29 Ga0070709_10221035 3300005434 Bacteria 1351
30 Ga0070709_11331947 3300005434 Bacteria 580
31 Ga0070714_100021544 3300005435 Bacteria 5274
32 Ga0070714_100021974 3300005435 Bacteria 5226
33 Ga0070714_100045084 3300005435 Bacteria 3735
34 Ga0070714_100051876 3300005435 Bacteria 3498
35 Ga0070714_100091757 3300005435 Bacteria 2661
36 Ga0070714_100302060 3300005435 Bacteria 1492
37 Ga0070714_100383323 3300005435 Bacteria 1326
38 Ga0070714_100950241 3300005435 Bacteria 835
39 Ga0070714_101036858 3300005435 Bacteria 799
40 Ga0070714_101127741 3300005435 Bacteria 764
41 Ga0070714_101236672 3300005435 Bacteria 729
42 Ga0070713_100026902 3300005436 Bacteria 4522
43 Ga0070713_100221979 3300005436 Bacteria 1715
44 Ga0070713_100821402 3300005436 Bacteria 892
45 Ga0070713_101186487 3300005436 Bacteria 739
46 Ga0070710_11371456 3300005437 Bacteria 528
47 Ga0070711_100022262 3300005439 Bacteria 4106
48 Ga0070711_100707531 3300005439 Bacteria 849
49 Ga0070694_100014705 3300005444 Bacteria 4903
50 Ga0070708_100080498 3300005445 Bacteria 2948
51 Ga0070708_100414201 3300005445 Bacteria 1271
52 Ga0070678_100206979 3300005456 Bacteria 1623
53 Ga0070681_10002352 3300005458 Bacteria 17268
54 Ga0070681_10002582 3300005458 Bacteria 16612
55 Ga0070681_10010574 3300005458 Bacteria 9115
56 Ga0070706_100016811 3300005467 Bacteria 6759
57 Ga0070706_100529015 3300005467 Bacteria 1097
58 Ga0070707_100214354 3300005468 Bacteria 1876
59 Ga0070707_100334808 3300005468 Bacteria 1471
60 Ga0070707_100897528 3300005468 Bacteria 851
61 Ga0070698_100017517 3300005471 Bacteria 7550
62 Ga0070698_100158682 3300005471 Bacteria 2207
63 Ga0070698_100242411 3300005471 Bacteria 1736
64 Ga0070698_100833407 3300005471 Bacteria 867
65 Ga0070679_100007912 3300005530 Bacteria 9974
66 Ga0070679_100072281 3300005530 Bacteria 3441
67 Ga0070679_101399899 3300005530 Bacteria 645
68 Ga0070684_100016458 3300005535 Bacteria 6046
69 Ga0070684_100036184 3300005535 Bacteria 4230
70 Ga0070684_100971745 3300005535 Bacteria 797
71 Ga0070684_101109502 3300005535 Bacteria 743
72 Ga0068853_100204687 3300005539 Bacteria 1797
73 Ga0070695_100000007 3300005545 Bacteria 89343
74 Ga0070695_100632017 3300005545 Bacteria 844
75 Ga0070696_101330766 3300005546 Bacteria 611
76 Ga0070696_101412861 3300005546 Bacteria 594
77 Ga0068855_100030809 3300005563 Bacteria 6413
78 Ga0068855_101023735 3300005563 Bacteria 867
79 Ga0068855_101070103 3300005563 Bacteria 844
80 Ga0068855_101102168 3300005563 Bacteria 830
81 Ga0068857_100024780 3300005577 Bacteria 5284
82 Ga0068857_100097777 3300005577 Bacteria 2632
83 Ga0068854_100288704 3300005578 Bacteria 1323
84 Ga0068856_100249630 3300005614 Bacteria 1790
85 Ga0068856_100810267 3300005614 Bacteria 956
86 Ga0068852_101194313 3300005616 Bacteria 782
87 Ga0081455_10005292 3300005937 Bacteria 14169
88 Ga0081455_10031254 3300005937 Bacteria 4821
89 Ga0081455_10186374 3300005937 Bacteria 1567
90 Ga0081538_10003303 3300005981 Bacteria 15294
91 Ga0081538_10039817 3300005981 Bacteria 3008
92 Ga0081538_10058162 3300005981 Bacteria 2245
93 Ga0081539_10166670 3300005985 Bacteria 1045
94 Ga0070717_10043162 3300006028 Bacteria 3679
95 Ga0070717_10133109 3300006028 Bacteria 2140
96 Ga0070717_10266039 3300006028 Bacteria 1518
97 Ga0070715_10032441 3300006163 Bacteria 2128
98 Ga0070715_10186187 3300006163 Bacteria 1045
99 Ga0070716_100169941 3300006173 Bacteria 1422
100 Ga0070716_101194086 3300006173 Bacteria 611
101 Ga0070712_100822352 3300006175 Bacteria 798
102 Ga0070712_101113233 3300006175 Bacteria 686
103 Ga0075428_100002031 3300006844 Bacteria 21804
104 Ga0075433_10018360 3300006852 Bacteria 5813
105 Ga0075433_10116012 3300006852 Bacteria 2376
106 Ga0075433_10296171 3300006852 Bacteria 1433
107 Ga0075434_100009519 3300006871 Bacteria 9066
108 Ga0075434_100054617 3300006871 Bacteria 3968
109 Ga0075434_100770360 3300006871 Bacteria 979
110 Ga0075429_100256518 3300006880 Bacteria 1531
111 Ga0075435_100370177 3300007076 Bacteria 1230
112 Ga0075435_100802216 3300007076 Bacteria 820
113 Ga0075435_101626497 3300007076 Bacteria 567
114 Ga0099795_10171099 3300007788 Bacteria 902
115 Ga0105240_10030751 3300009093 Bacteria 6974
116 Ga0105240_10097231 3300009093 Bacteria 3588
117 Ga0105240_10236909 3300009093 Bacteria 2118
118 Ga0105240_10334080 3300009093 Bacteria 1723
119 Ga0105240_11041553 3300009093 Bacteria 873
120 Ga0111539_12157614 3300009094 Bacteria 646
121 Ga0105245_10023444 3300009098 Bacteria 5418
122 Ga0105245_10771881 3300009098 Bacteria 998
123 Ga0105245_12068663 3300009098 Bacteria 623
124 Ga0114129_10000663 3300009147 Bacteria 43174
125 Ga0114129_12029904 3300009147 Bacteria 695
126 Ga0105243_10069693 3300009148 Bacteria 2837
127 Ga0105242_10647697 3300009176 Bacteria 1027
128 Ga0105237_10189280 3300009545 Bacteria 2058
129 Ga0105238_10170715 3300009551 Bacteria 2151
130 Ga0105238_12259277 3300009551 Bacteria 579
131 Ga0105239_10803578 3300010375 Bacteria 1078
132 Ga0157337_1006084 3300012483 Bacteria 825
133 Ga0157343_1000717 3300012488 Bacteria 1421
134 Ga0157322_1012827 3300012490 Bacteria 712
135 Ga0157314_1015485 3300012500 Bacteria 722
136 Ga0157373_10107685 3300013100 Bacteria 1959
137 Ga0157371_10262758 3300013102 Bacteria 1245
138 Ga0157371_10861010 3300013102 Bacteria 685
139 Ga0157370_10011210 3300013104 Bacteria 9401
140 Ga0157370_10018219 3300013104 Bacteria 7066
141 Ga0157370_10747274 3300013104 Bacteria 891
142 Ga0157370_10747666 3300013104 Bacteria 891
143 Ga0157370_11328543 3300013104 Bacteria 648
144 Ga0157369_10002883 3300013105 Bacteria 20540
145 Ga0157369_10182179 3300013105 Bacteria 2210
146 Ga0157374_10629473 3300013296 Bacteria 1084
147 Ga0157374_10656399 3300013296 Bacteria 1061
148 Ga0163162_10838063 3300013306 Bacteria 1035
149 Ga0163162_11082479 3300013306 Bacteria 908
150 Ga0157372_10029039 3300013307 Bacteria 6034
151 Ga0157372_10391346 3300013307 Bacteria 1620
152 Ga0157372_10437965 3300013307 Bacteria 1523
153 Ga0157372_11832215 3300013307 Bacteria 698
154 Ga0157375_11220789 3300013308 Bacteria 882
155 Ga0157380_10545104 3300014326 Bacteria 1137
156 Ga0157380_11278662 3300014326 Bacteria 780
157 Ga0182008_10002753 3300014497 Bacteria 10904
158 Ga0182008_10024953 3300014497 Bacteria 3040
159 Ga0182008_10265433 3300014497 Bacteria 889
160 Ga0157379_10370007 3300014968 Bacteria 1314
161 Ga0182006_1143170 3300015261 Bacteria 815
162 Ga0182006_1162713 3300015261 Bacteria 751
163 Ga0182007_10117022 3300015262 Bacteria 890
164 Ga0182005_1133303 3300015265 Bacteria 714
165 Ga0206356_10280546 3300020070 Bacteria 1182
166 Ga0206356_11617167 3300020070 Bacteria 1300
167 Ga0206349_1900966 3300020075 Bacteria 767
168 Ga0206350_10482534 3300020080 Bacteria 600
169 Ga0206354_10133384 3300020081 Bacteria 1206
170 Ga0206354_10432702 3300020081 Bacteria 1006
171 Ga0206354_11071589 3300020081 Bacteria 879
172 Ga0206353_10004980 3300020082 Bacteria 12482
173 Ga0206353_10866168 3300020082 Bacteria 6983
174 Ga0206353_11626609 3300020082 Bacteria 938
175 Ga0154015_1165229 3300020610 Bacteria 1208
176 Ga0154015_1211618 3300020610 Bacteria 1288
177 Ga0154015_1354810 3300020610 Bacteria 553
178 Ga0224712_10125102 3300022467 Bacteria 1117
179 Ga0207685_10156599 3300025905 Bacteria 1036
180 Ga0207699_10029387 3300025906 Bacteria 3065
181 Ga0207699_10289867 3300025906 Bacteria 1140
182 Ga0207699_11343937 3300025906 Bacteria 529
183 Ga0207705_10003887 3300025909 Bacteria 11365
184 Ga0207705_10017397 3300025909 Bacteria 5148
185 Ga0207705_10055106 3300025909 Bacteria 2867
186 Ga0207684_10363276 3300025910 Bacteria 1246
187 Ga0207684_10831640 3300025910 Bacteria 779
188 Ga0207684_11530231 3300025910 Bacteria 542
189 Ga0207707_10004063 3300025912 Bacteria 12958
190 Ga0207707_10008618 3300025912 Bacteria 8845
191 Ga0207707_10084317 3300025912 Bacteria 2775
192 Ga0207707_10085336 3300025912 Bacteria 2759
193 Ga0207695_10129279 3300025913 Bacteria 2484
194 Ga0207695_10182090 3300025913 Bacteria 2022
195 Ga0207695_10244492 3300025913 Bacteria 1695
196 Ga0207695_10394645 3300025913 Bacteria 1268
197 Ga0207695_10418696 3300025913 Bacteria 1224
198 Ga0207671_10126668 3300025914 Bacteria 1957
199 Ga0207693_11292262 3300025915 Bacteria 546
200 Ga0207663_10033597 3300025916 Bacteria 3058
201 Ga0207663_11244926 3300025916 Bacteria 599
202 Ga0207660_10018636 3300025917 Bacteria 4631
203 Ga0207660_10061836 3300025917 Bacteria 2696
204 Ga0207660_10196183 3300025917 Bacteria 1575
205 Ga0207660_10234096 3300025917 Bacteria 1445
206 Ga0207660_11309995 3300025917 Bacteria 588
207 Ga0207657_10002690 3300025919 Bacteria 19155
208 Ga0207657_10011803 3300025919 Bacteria 8649
209 Ga0207649_10063761 3300025920 Bacteria 2328
210 Ga0207652_10019328 3300025921 Bacteria 5602
211 Ga0207652_10022742 3300025921 Bacteria 5191
212 Ga0207652_10025683 3300025921 Bacteria 4899
213 Ga0207652_10063037 3300025921 Bacteria 3205
214 Ga0207652_10422723 3300025921 Bacteria 1202
215 Ga0207652_11294252 3300025921 Bacteria 632
216 Ga0207646_10040720 3300025922 Bacteria 4178
217 Ga0207646_10783910 3300025922 Bacteria 849
218 Ga0207646_10831574 3300025922 Bacteria 821
219 Ga0207646_11215303 3300025922 Bacteria 660
220 Ga0207694_10451089 3300025924 Bacteria 1074
221 Ga0207694_10931816 3300025924 Bacteria 735
222 Ga0207687_10838302 3300025927 Bacteria 785
223 Ga0207700_10000002 3300025928 Bacteria 775978
224 Ga0207700_10353708 3300025928 Bacteria 1280
225 Ga0207700_10371224 3300025928 Bacteria 1249
226 Ga0207700_11058666 3300025928 Bacteria 725
227 Ga0207664_10031085 3300025929 Bacteria 4082
228 Ga0207664_10098342 3300025929 Bacteria 2413
229 Ga0207664_10130990 3300025929 Bacteria 2111
230 Ga0207664_10176988 3300025929 Bacteria 1829
231 Ga0207664_10269729 3300025929 Bacteria 1490
232 Ga0207664_10432326 3300025929 Bacteria 1173
233 Ga0207664_10794695 3300025929 Bacteria 851
234 Ga0207664_11312895 3300025929 Bacteria 643
235 Ga0207664_11472715 3300025929 Bacteria 602
236 Ga0207644_10564790 3300025931 Bacteria 943
237 Ga0207644_10957269 3300025931 Bacteria 718
238 Ga0207690_10660376 3300025932 Bacteria 857
239 Ga0207690_11726752 3300025932 Bacteria 523
240 Ga0207686_10059516 3300025934 Bacteria 2414
241 Ga0207686_10207491 3300025934 Bacteria 1407
242 Ga0207686_10242079 3300025934 Bacteria 1313
243 Ga0207709_10057868 3300025935 Bacteria 2406
244 Ga0207704_10380929 3300025938 Bacteria 1107
245 Ga0207665_10002200 3300025939 Bacteria 13164
246 Ga0207665_10181167 3300025939 Bacteria 1526
247 Ga0207665_10212723 3300025939 Bacteria 1413
248 Ga0207665_10379502 3300025939 Bacteria 1072
249 Ga0207691_11053773 3300025940 Bacteria 677
250 Ga0207711_10656114 3300025941 Bacteria 979
251 Ga0207711_11344590 3300025941 Bacteria 657
252 Ga0207661_10003839 3300025944 Bacteria 10475
253 Ga0207661_10025797 3300025944 Bacteria 4472
254 Ga0207661_10060022 3300025944 Bacteria 3066
255 Ga0207661_10276732 3300025944 Bacteria 1499
256 Ga0207661_10335228 3300025944 Bacteria 1362
257 Ga0207661_11221473 3300025944 Bacteria 691
258 Ga0207667_10050181 3300025949 Bacteria 4403
259 Ga0207640_11459578 3300025981 Bacteria 614
260 Ga0207677_10799876 3300026023 Bacteria 844
261 Ga0207639_10606341 3300026041 Bacteria 1010
262 Ga0207678_10529584 3300026067 Bacteria 1029
263 Ga0207678_11874223 3300026067 Bacteria 524
264 Ga0207702_10152300 3300026078 Bacteria 2104
265 Ga0207702_11249466 3300026078 Bacteria 737
266 Ga0207676_12359693 3300026095 Bacteria 529
267 Ga0207674_10016181 3300026116 Bacteria 8169
268 Ga0207674_10100393 3300026116 Bacteria 2875
269 Ga0207683_10172724 3300026121 Bacteria 1958
270 Ga0207428_11242980 3300027907 Bacteria 517
271 Ga0265326_10009205 3300028558 Bacteria 2954
272 Ga0265326_10031889 3300028558 Bacteria 1501
273 Ga0265319_1005903 3300028563 Bacteria 5758
274 Ga0265319_1078233 3300028563 Bacteria 1052
275 Ga0265334_10006308 3300028573 Bacteria 5119
276 Ga0265334_10017490 3300028573 Bacteria 2959
277 Ga0265318_10001217 3300028577 Bacteria 15646
278 Ga0265323_10069259 3300028653 Bacteria 1209
279 Ga0265322_10005028 3300028654 Bacteria 3921
280 Ga0265336_10021950 3300028666 Bacteria 2035
281 Ga0265338_10002936 3300028800 Bacteria 24729
282 Ga0265338_10004663 3300028800 Bacteria 18409
283 Ga0265338_10011028 3300028800 Bacteria 10493
284 Ga0265338_10023362 3300028800 Bacteria 6360
285 Ga0265324_10023833 3300029957 Bacteria 2177
286 Ga0265330_10001984 3300031235 Bacteria 11353
287 Ga0265332_10001963 3300031238 Bacteria 10846
288 Ga0265328_10007996 3300031239 Bacteria 4384
289 Ga0265320_10010508 3300031240 Bacteria 5511
290 Ga0265325_10001625 3300031241 Bacteria 15662
291 Ga0265329_10004462 3300031242 Bacteria 5809
292 Ga0265340_10074233 3300031247 Bacteria 1608
293 Ga0265331_10004771 3300031250 Bacteria 8354
294 Ga0265327_10010871 3300031251 Bacteria 6339
295 Ga0265327_10020771 3300031251 Bacteria 3988
296 Ga0265316_10077706 3300031344 Bacteria 2548
297 Ga0265316_10372808 3300031344 Bacteria 1031
298 Ga0265313_10009457 3300031595 Bacteria 6328
299 Ga0265313_10052738 3300031595 Bacteria 1939
300 Ga0265314_10039580 3300031711 Bacteria 3393
301 Ga0265342_10012474 3300031712 Bacteria 5753
302 Ga0307409_100595419 3300031995 Bacteria 1092
303 Ga0307416_102282044 3300032002 Bacteria 642
304 Ga0316583_10026733 3300032133 Bacteria 2060
305 Ga0316583_10044736 3300032133 Bacteria 1564
306 Ga0373958_0185450 3300034819 Bacteria 538
307 Ga0373944_0065864 3300035089 Bacteria 1171
308 Ga0373923_0378572 3300035111 Bacteria 679
309 Ga0373936_0019904 3300035113 Bacteria 2603
310 Ga0373936_0071391 3300035113 Bacteria 1432
311 Ga0373945_0006065 3300035116 Bacteria 3886
312 Ga0373956_0456669 3300035119 Bacteria 610
313 Ga0373957_0557154 3300035120 Bacteria 502
314 Ga0373943_0000628 3300035170 Bacteria 15270
315 Ga0373924_0113029 3300035410 Bacteria 1175
316 Ga0373935_0015369 3300035692 Bacteria 4626
317 Ga0373927_0049940 3300035695 Bacteria 2704
318 Ga0373947_0004063 3300035725 Bacteria 8608
319 Ga0373947_0122855 3300035725 Bacteria 1651
320 Ga0373937_0837980 3300036401 Bacteria 868
321 Ga0373925_0002950 3300037068 Bacteria 13427
322 Ga0395899_0183731 3300037312 Bacteria 1466
323 Ga0395899_0186005 3300037312 Bacteria 1456
324 Ga0395899_0730590 3300037312 Bacteria 618
325 Ga0395900_0228700 3300037418 Bacteria 1871
326 Ga0395900_0687282 3300037418 Bacteria 958
327 Ga0395900_1189210 3300037418 Bacteria 678
328 Ga0395900_1255829 3300037418 Bacteria 655
329 Ga0395898_0178667 3300037466 Bacteria 2028
330 Ga0395898_0263849 3300037466 Bacteria 1643
331 Ga0395905_0229878 3300037471 Bacteria 1734
332 Ga0395905_0845381 3300037471 Bacteria 818
333 Ga0395905_0992280 3300037471 Bacteria 743
334 Ga0395905_1103584 3300037471 Bacteria 697
335 Ga0395901_0176171 3300038443 Bacteria 2243
336 Ga0395901_0218834 3300038443 Bacteria 1991
337 Ga0395901_0254299 3300038443 Bacteria 1830
338 Ga0395901_0376898 3300038443 Bacteria 1461
339 Ga0395901_0775274 3300038443 Bacteria 950
340 Ga0395901_1238711 3300038443 Bacteria 710
341 Ga0436365_1158022 3300039437 Bacteria 569
342 Ga0436360_1187886 3300039438 Bacteria 1975
343 Ga0436360_1211651 3300039438 Bacteria 4498
344 Ga0436361_1157274 3300039447 Bacteria 634
345 Ga0436363_1297278 3300039450 Bacteria 561
346 Ga0436362_0404353 3300039453 Bacteria 601
347 Ga0439453_0001773 3300041408 Bacteria 2849
348 Ga0451789_1012533 3300041443 Bacteria 598
349 Ga0451804_1120031 3300041463 Bacteria 1146
350 Ga0439454_003880 3300042011 Bacteria 1692
351 Ga0466969_0003769 3300044656 Bacteria 8058
352 Ga0466965_0154088 3300044683 Bacteria 1202
353 Ga0466965_0347836 3300044683 Bacteria 811
354 Ga0466965_0382883 3300044683 Bacteria 775
355 Ga0466966_0039151 3300044684 Bacteria 3053
356 Ga0466966_0113754 3300044684 Bacteria 1666
357 Ga0466966_0178062 3300044684 Bacteria 1291
358 Ga0466966_0336939 3300044684 Bacteria 906
359 Ga0466961_0288470 3300044693 Bacteria 1003
360 Ga0466961_0316943 3300044693 Bacteria 951
361 Ga0466961_0376196 3300044693 Bacteria 863
362 Ga0466961_0389319 3300044693 Bacteria 846
363 Ga0466961_0456284 3300044693 Bacteria 773
364 Ga0466963_0000137 3300044694 Bacteria 28326
365 Ga0466963_0000276 3300044694 Bacteria 22861
366 Ga0466963_0000632 3300044694 Bacteria 16887
367 Ga0466963_0000673 3300044694 Bacteria 16556
368 Ga0466963_0000741 3300044694 Bacteria 16079
369 Ga0466963_0002688 3300044694 Bacteria 10010
370 Ga0466963_0005725 3300044694 Bacteria 7307
371 Ga0466963_0038983 3300044694 Bacteria 3109
372 Ga0466963_0042447 3300044694 Bacteria 2987
373 Ga0466963_0076759 3300044694 Bacteria 2256
374 Ga0466963_0280509 3300044694 Bacteria 1171
375 Ga0466963_0291769 3300044694 Bacteria 1146
376 Ga0466963_0455271 3300044694 Bacteria 903
377 Ga0466963_0705761 3300044694 Bacteria 712
378 Ga0466963_0900440 3300044694 Bacteria 623
379 Ga0466964_0006725 3300044706 Bacteria 4286
380 Ga0466964_0007832 3300044706 Bacteria 4000
381 Ga0466964_0012342 3300044706 Bacteria 3233
382 Ga0466964_0013707 3300044706 Bacteria 3076
383 Ga0466964_0072548 3300044706 Bacteria 1459
384 Ga0466964_0082817 3300044706 Bacteria 1380
385 Ga0466964_0145094 3300044706 Bacteria 1095
386 Ga0466964_0259981 3300044706 Bacteria 859
387 Ga0466964_0284728 3300044706 Bacteria 827
388 Ga0466971_0001552 3300044719 Bacteria 9688
389 Ga0466971_0001914 3300044719 Bacteria 8834
390 Ga0466971_0029827 3300044719 Bacteria 2440
391 Ga0466971_0037646 3300044719 Bacteria 2169
392 Ga0466971_0160720 3300044719 Bacteria 1051
393 Ga0466968_0004224 3300044735 Bacteria 5355
394 Ga0466968_0006450 3300044735 Bacteria 4423
395 Ga0466968_0008503 3300044735 Bacteria 3931
396 Ga0466968_0216570 3300044735 Bacteria 901
397 Ga0466970_0014456 3300044765 Bacteria 4052
398 Ga0466957_0001689 3300044842 Bacteria 11606
399 Ga0466957_0003049 3300044842 Bacteria 9108
400 Ga0466957_0003662 3300044842 Bacteria 8480
401 Ga0466957_0022017 3300044842 Bacteria 3758
402 Ga0466957_0039136 3300044842 Bacteria 2860
403 Ga0466957_0051735 3300044842 Bacteria 2500
404 Ga0466957_0091504 3300044842 Bacteria 1907
405 Ga0466957_0160392 3300044842 Bacteria 1460
406 Ga0466957_0208452 3300044842 Bacteria 1286
407 Ga0466957_0671945 3300044842 Bacteria 729
408 Ga0466957_0942087 3300044842 Bacteria 618
409 Ga0466960_0004958 3300044901 Bacteria 5241
410 Ga0466960_0066119 3300044901 Bacteria 1787
411 Ga0466960_0101262 3300044901 Bacteria 1483
412 Ga0466960_0193673 3300044901 Bacteria 1107
413 Ga0466960_0367764 3300044901 Bacteria 823
414 Ga0466959_0010806 3300045049 Bacteria 6543
415 Ga0466959_0013103 3300045049 Bacteria 6004
416 Ga0466959_0034372 3300045049 Bacteria 3749
417 Ga0466959_0151365 3300045049 Bacteria 1635
418 Ga0466959_0662311 3300045049 Bacteria 700
419 Ga0466958_0002075 3300045836 Bacteria 9910
420 Ga0466958_0004062 3300045836 Bacteria 7677
421 Ga0466958_0005483 3300045836 Bacteria 6838
422 Ga0466958_0007875 3300045836 Bacteria 5888
423 Ga0466958_0010034 3300045836 Bacteria 5292
424 Ga0466958_0030937 3300045836 Bacteria 3181
425 Ga0466958_0038614 3300045836 Bacteria 2865
426 Ga0466958_0087483 3300045836 Bacteria 1924
427 Ga0466958_0116393 3300045836 Bacteria 1671
428 Ga0466958_0172170 3300045836 Bacteria 1371
429 Ga0466958_0178992 3300045836 Bacteria 1345
430 Ga0466958_0299619 3300045836 Bacteria 1032
431 Ga0466958_0490985 3300045836 Bacteria 796
432 Ga0466958_1010761 3300045836 Bacteria 543
433 Ga0466967_0000047 3300045976 Bacteria 43648
434 Ga0466967_0000300 3300045976 Bacteria 22193
435 Ga0466967_0002201 3300045976 Bacteria 11993
436 Ga0466967_0003956 3300045976 Bacteria 9857
437 Ga0466967_0043133 3300045976 Bacteria 3904
438 Ga0466967_0044979 3300045976 Bacteria 3834
439 Ga0466967_0058202 3300045976 Bacteria 3415
440 Ga0466967_0079604 3300045976 Bacteria 2954
441 Ga0466967_0104505 3300045976 Bacteria 2593
442 Ga0466967_0134110 3300045976 Bacteria 2302
443 Ga0466967_0179243 3300045976 Bacteria 1997
444 Ga0466967_0189071 3300045976 Bacteria 1945
445 Ga0466967_0207017 3300045976 Bacteria 1859
446 Ga0466967_0284491 3300045976 Bacteria 1587
447 Ga0466967_0290513 3300045976 Bacteria 1571
448 Ga0466967_0344547 3300045976 Bacteria 1441
449 Ga0466967_0425213 3300045976 Bacteria 1295
450 Ga0466967_0508189 3300045976 Bacteria 1183
451 Ga0466967_0766082 3300045976 Bacteria 957
452 Ga0466967_1030558 3300045976 Bacteria 819
453 Ga0466967_2305337 3300045976 Bacteria 534
454 Ga0466967_2386858 3300045976 Bacteria 524
455 Ga0495592_0163026 3300046454 Bacteria 1532
456 Ga0495592_0825576 3300046454 Bacteria 549
457 Ga0495629_0014949 3300046459 Bacteria 5576
458 Ga0495629_0018947 3300046459 Bacteria 4922
459 Ga0495629_0184357 3300046459 Bacteria 1446
460 Ga0495641_0003398 3300046461 Bacteria 11936
461 Ga0495651_0054488 3300046462 Bacteria 3075
462 Ga0495651_0271049 3300046462 Bacteria 1151
463 Ga0495653_0005518 3300046463 Bacteria 10305
464 Ga0495653_0351210 3300046463 Bacteria 948
465 Ga0495580_0006348 3300046472 Bacteria 9644
466 Ga0495582_0007435 3300046473 Bacteria 6064
467 Ga0495582_0036147 3300046473 Bacteria 2717
468 Ga0495582_0095326 3300046473 Bacteria 1662
469 Ga0495582_0231824 3300046473 Bacteria 1057
470 Ga0495582_0844511 3300046473 Bacteria 530
471 Ga0495639_0000291 3300046475 Bacteria 24492
472 Ga0495639_0558953 3300046475 Bacteria 587
473 Ga0495662_0006357 3300046476 Bacteria 5903
474 Ga0495664_0007586 3300046477 Bacteria 6031
475 Ga0495664_0318602 3300046477 Bacteria 938
476 Ga0495664_0325591 3300046477 Bacteria 927
477 Ga0495664_0371177 3300046477 Bacteria 860
478 Ga0495594_0058692 3300046499 Bacteria 2127
479 Ga0495608_0363750 3300046511 Bacteria 889
480 Ga0495608_0714352 3300046511 Bacteria 596
481 Ga0495618_0006267 3300046514 Bacteria 7219
482 Ga0495618_0147317 3300046514 Bacteria 1505
483 Ga0495618_0242156 3300046514 Bacteria 1133
484 Ga0495618_0409009 3300046514 Bacteria 829
485 Ga0495628_0056803 3300046516 Bacteria 3080
486 Ga0495630_0000631 3300046517 Bacteria 25489
487 Ga0495630_0029216 3300046517 Bacteria 4097
488 Ga0495630_0177662 3300046517 Bacteria 1623
489 Ga0495666_0000270 3300046526 Bacteria 22402
490 Ga0495652_0004378 3300046529 Bacteria 13510
491 Ga0495665_0001487 3300046531 Bacteria 12555
492 Ga0495665_0409077 3300046531 Bacteria 688
493 Ga0495640_0019213 3300046533 Bacteria 5047
494 Ga0495640_0048828 3300046533 Bacteria 2921
495 Ga0495640_0891658 3300046533 Bacteria 527
496 Ga0495586_0004266 3300046535 Bacteria 7645
497 Ga0495586_0040895 3300046535 Bacteria 2495
498 Ga0495645_0035797 3300046543 Bacteria 3619
499 Ga0495645_0394003 3300046543 Bacteria 884
500 Ga0495645_0759221 3300046543 Bacteria 585
501 Ga0495622_0193164 3300046557 Bacteria 909
502 Ga0495667_0015940 3300046559 Bacteria 5080
503 Ga0495667_0651563 3300046559 Bacteria 654
504 Ga0495634_0004560 3300046642 Bacteria 10823
505 Ga0495634_0546683 3300046642 Bacteria 675
506 Ga0495635_0006305 3300046663 Bacteria 8263
507 Ga0495635_0013922 3300046663 Bacteria 5627
508 Ga0495635_0491252 3300046663 Bacteria 809
509 Ga0495657_0358762 3300046675 Bacteria 862
510 Ga0495646_0185283 3300046680 Bacteria 1140
511 Ga0495647_0000243 3300046681 Bacteria 14906
512 Ga0495658_0000970 3300046683 Bacteria 15222
513 Ga0495613_0008628 3300046689 Bacteria 7561
514 Ga0495613_0292129 3300046689 Bacteria 1130
515 Ga0495624_0001273 3300046690 Bacteria 19870
516 Ga0495624_0270191 3300046690 Bacteria 1027
517 Ga0495600_0534694 3300046809 Bacteria 717
518 Ga0495581_0000258 3300047315 Bacteria 25364
519 Ga0495581_0815074 3300047315 Bacteria 535
520 Ga0495604_0245697 3300047317 Bacteria 1222
521 Ga0495604_0788061 3300047317 Bacteria 599
522 Ga0495674_0004337 3300047319 Bacteria 13635
523 Ga0495674_0036575 3300047319 Bacteria 4418
524 Ga0495676_0007780 3300047321 Bacteria 9832
525 Ga0495676_0147592 3300047321 Bacteria 1678
526 Ga0495680_0001263 3300047322 Bacteria 27605
527 Ga0495680_0581729 3300047322 Bacteria 751
528 Ga0495684_0007604 3300047471 Bacteria 8385
529 Ga0495684_0030087 3300047471 Bacteria 4168
530 Ga0495684_0479343 3300047471 Bacteria 859
531 Ga0495593_0000732 3300047673 Bacteria 19043
532 Ga0495614_0000557 3300048089 Bacteria 15456
533 Ga0495614_0072198 3300048089 Bacteria 1489
534 Ga0496100_0030261 3300048903 Bacteria 3357
535 Ga0496100_1226679 3300048903 Bacteria 592
536 Ga0496101_0006366 3300048904 Bacteria 7599
537 Ga0496101_0095023 3300048904 Bacteria 2223
538 Ga0496101_0319407 3300048904 Bacteria 1218
539 Ga0496101_0954084 3300048904 Bacteria 675
540 Ga0496102_0108541 3300048905 Bacteria 2585
541 Ga0496102_0484871 3300048905 Bacteria 1158
542 Ga0496102_1601388 3300048905 Bacteria 569
543 Ga0496103_0160847 3300048906 Bacteria 1440
544 Ga0496104_0119244 3300048907 Bacteria 2533
545 Ga0496105_0187197 3300048908 Bacteria 1694
546 Ga0496106_0110837 3300048909 Bacteria 2136
547 Ga0496107_0010564 3300048910 Bacteria 6418
548 Ga0496108_0006645 3300048911 Bacteria 9367
549 Ga0496108_0007700 3300048911 Bacteria 8726
550 Ga0496109_0001934 3300048912 Bacteria 17222
551 Ga0496109_0081876 3300048912 Bacteria 2974
552 Ga0496109_0125107 3300048912 Bacteria 2397
553 Ga0496110_0032858 3300048913 Bacteria 4485
554 Ga0496110_0073039 3300048913 Bacteria 3044
555 Ga0496110_0218420 3300048913 Bacteria 1733
556 Ga0496111_0014931 3300048914 Bacteria 5319
557 Ga0496111_0123737 3300048914 Bacteria 1911
558 Ga0496111_0160277 3300048914 Bacteria 1670
559 Ga0496112_0007079 3300048915 Bacteria 9912
560 Ga0496112_0039823 3300048915 Bacteria 4593
561 Ga0496112_0110513 3300048915 Bacteria 2719
562 Ga0496112_0588131 3300048915 Bacteria 1045
563 Ga0496112_1035491 3300048915 Bacteria 740
564 Ga0496113_0097567 3300048916 Bacteria 2274
565 Ga0496113_0259431 3300048916 Bacteria 1388
566 Ga0496113_0922535 3300048916 Bacteria 690
567 Ga0496113_1507849 3300048916 Bacteria 519
568 Ga0496114_0063742 3300048917 Bacteria 3086
569 Ga0496114_0140685 3300048917 Bacteria 2089
570 Ga0496114_0267734 3300048917 Bacteria 1505
571 Ga0496115_0591165 3300048918 Bacteria 883
572 Ga0501034_0266654 3300049571 Bacteria 1654
573 Ga0501040_0311879 3300049576 Bacteria 1125
574 Ga0501040_0385919 3300049576 Bacteria 1005
575 Ga0501046_0827389 3300049580 Bacteria 648
576 Ga0501047_0021100 3300049581 Bacteria 6254
577 Ga0501047_0127973 3300049581 Bacteria 2420
578 Ga0501067_0013960 3300049583 Bacteria 4450
579 Ga0501067_0061749 3300049583 Bacteria 2074
580 Ga0501069_0059726 3300049585 Bacteria 2128
581 Ga0501070_0009671 3300049586 Bacteria 8153
582 Ga0501070_0010356 3300049586 Bacteria 7881
583 Ga0501070_0014314 3300049586 Bacteria 6676
584 Ga0501071_0064023 3300049587 Bacteria 2667
585 Ga0501071_0314695 3300049587 Bacteria 1188
586 Ga0501072_0012822 3300049588 Bacteria 6408
587 Ga0501072_0489856 3300049588 Bacteria 972
588 Ga0501074_0035771 3300049590 Bacteria 3598
589 Ga0501074_0072379 3300049590 Bacteria 2476
590 Ga0501074_0342879 3300049590 Bacteria 1060
591 Ga0501075_0294822 3300049591 Bacteria 1236
592 Ga0501075_0430212 3300049591 Bacteria 1006
593 Ga0501076_0283778 3300049592 Bacteria 1357
594 Ga0501076_1769809 3300049592 Bacteria 507
595 Ga0501079_0009230 3300049741 Bacteria 7471
596 Ga0501079_0149033 3300049741 Bacteria 1824
597 Ga0501079_0150533 3300049741 Bacteria 1814
598 Ga0501080_0005101 3300049742 Bacteria 11698
599 Ga0501080_1469891 3300049742 Bacteria 580
600 Ga0501081_0263738 3300049743 Bacteria 1259
601 Ga0501083_0001297 3300049744 Bacteria 16900
602 Ga0501035_0306938 3300049822 Bacteria 1336
603 Ga0501035_0600197 3300049822 Bacteria 897
604 Ga0501044_0428119 3300049823 Bacteria 1233
605 Ga0501045_0086269 3300049824 Bacteria 2317
606 nmdc:mga05p37_39439_c1 3300050507 Bacteria 5799
607 nmdc:mga08y16_1480483_c1 3300050511 Bacteria 640
608 nmdc:mga08y16_218293_c1 3300050511 Bacteria 1974
609 nmdc:mga0n895_1006599_c1 3300050512 Bacteria 814
610 nmdc:mga0n895_164125_c1 3300050512 Bacteria 2253
611 nmdc:mga0n895_47778_c1 3300050512 Bacteria 4186
612 nmdc:mga0rr50_213005_c1 3300050513 Bacteria 1592
613 nmdc:mga0rr50_250507_c1 3300050513 Bacteria 1471
614 nmdc:mga0a205_287569_c1 3300050515 Bacteria 1519
615 nmdc:mga0a205_300588_c1 3300050515 Bacteria 1478
616 Ga0495601_0005063 3300053077 Bacteria 7649
617 Ga0495601_0006407 3300053077 Bacteria 6882
618 Ga0495601_0026332 3300053077 Bacteria 3591
619 Ga0495601_0605073 3300053077 Bacteria 703
620 Ga0495612_0007992 3300053078 Bacteria 4307
621 Ga0495612_0441465 3300053078 Bacteria 594
622 Ga0495655_0328558 3300053083 Bacteria 531
623 Ga0495619_0001368 3300053085 Bacteria 16040
624 Ga0495619_0118221 3300053085 Bacteria 1816
625 Ga0500566_0004146 3300053094 Bacteria 8645
626 Ga0501084_1429245 3300054114 Bacteria 579
627 Ga0587066_148541 3300059490 Bacteria 579
628 Ga0587070_170407 3300059491 Bacteria 560
629 Ga0587083_0164829 3300059505 Bacteria 609
630 Ga0587083_0206411 3300059505 Bacteria 564
631 Ga0587088_150452 3300059508 Bacteria 563
632 Ga0587091_211672 3300059511 Bacteria 526
633 Ga0587094_115285 3300059513 Bacteria 533
634 Ga0587098_092447 3300059604 Bacteria 518
635 Ga0587106_083299 3300059605 Bacteria 627
636 Ga0587113_040616 3300059625 Bacteria 556
637 Ga0587115_109514 3300059626 Bacteria 521
638 Ga0587117_067999 3300059627 Bacteria 626
639 Ga0587117_100780 3300059627 Bacteria 550
640 Ga0587128_081156 3300059630 Bacteria 649
641 Ga0587069_071279 3300059642 Bacteria 660
642 Ga0587076_061076 3300059645 Bacteria 760
643 Ga0587079_193845 3300059647 Bacteria 551
644 Ga0587079_205117 3300059647 Bacteria 540
645 Ga0587079_210684 3300059647 Bacteria 535
646 Ga0587107_061295 3300059652 Bacteria 664
647 Ga0587111_0082839 3300060346 Bacteria 770
648 Ga0587111_0083332 3300060346 Bacteria 768
649 Ga0501082_0227616 3300060353 Bacteria 1623
650 Ga0466962_0010761 3300061719 Bacteria 4396
651 Ga0466962_0728864 3300061719 Bacteria 509
652 Ga0530510_0670244 3300061734 Bacteria 790

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041443 Ga0451789_1012533 Ga0451789_1012533_21_302 59
2 3300047471 Ga0495684_0479343 Ga0495684_0479343_581_835 74
3 3300053077 Ga0495601_0605073 Ga0495601_0605073_434_688 74
4 3300046514 Ga0495618_0147317 Ga0495618_0147317_869_1174 75
5 3300025910 Ga0207684_10363276 Ga0207684_103632761 81
6 3300025922 Ga0207646_10831574 Ga0207646_108315742 81
7 3300005434 Ga0070709_10221035 Ga0070709_102210353 82
8 3300005435 Ga0070714_100021974 Ga0070714_1000219746 82
9 3300005435 Ga0070714_100302060 Ga0070714_1003020604 82
10 3300005436 Ga0070713_100221979 Ga0070713_1002219793 82
11 3300005439 Ga0070711_100707531 Ga0070711_1007075312 82
12 3300005445 Ga0070708_100080498 Ga0070708_1000804983 82
13 3300005467 Ga0070706_100016811 Ga0070706_1000168113 82
14 3300005468 Ga0070707_100214354 Ga0070707_1002143542 82
15 3300005468 Ga0070707_100334808 Ga0070707_1003348084 82
16 3300005471 Ga0070698_100017517 Ga0070698_1000175173 82
17 3300005471 Ga0070698_100242411 Ga0070698_1002424114 82
18 3300005546 Ga0070696_101330766 Ga0070696_1013307662 82
19 3300005937 Ga0081455_10186374 Ga0081455_101863742 82
20 3300005981 Ga0081538_10058162 Ga0081538_100581623 82
21 3300006028 Ga0070717_10133109 Ga0070717_101331092 82
22 3300006852 Ga0075433_10296171 Ga0075433_102961713 82
23 3300006871 Ga0075434_100009519 Ga0075434_1000095194 82
24 3300007076 Ga0075435_100802216 Ga0075435_1008022162 82
25 3300009098 Ga0105245_10771881 Ga0105245_107718811 82
26 3300009147 Ga0114129_12029904 Ga0114129_120299042 82
27 3300009176 Ga0105242_10647697 Ga0105242_106476972 82
28 3300010375 Ga0105239_10803578 Ga0105239_108035782 82
29 3300012490 Ga0157322_1012827 Ga0157322_10128272 82
30 3300025906 Ga0207699_10289867 Ga0207699_102898672 82
31 3300025910 Ga0207684_10831640 Ga0207684_108316401 82
32 3300025916 Ga0207663_11244926 Ga0207663_112449261 82
33 3300025922 Ga0207646_10040720 Ga0207646_100407203 82
34 3300025934 Ga0207686_10242079 Ga0207686_102420792 82
35 3300032002 Ga0307416_102282044 Ga0307416_1022820442 82
36 3300034819 Ga0373958_0185450 Ga0373958_0185450_130_435 82
37 3300037312 Ga0395899_0183731 Ga0395899_0183731_230_535 82
38 3300037418 Ga0395900_0228700 Ga0395900_0228700_1078_1383 82
39 3300037418 Ga0395900_1255829 Ga0395900_1255829_187_492 82
40 3300037466 Ga0395898_0178667 Ga0395898_0178667_1582_1887 82
41 3300037471 Ga0395905_0229878 Ga0395905_0229878_965_1270 82
42 3300037471 Ga0395905_0845381 Ga0395905_0845381_294_599 82
43 3300038443 Ga0395901_0176171 Ga0395901_0176171_1624_1929 82
44 3300038443 Ga0395901_0376898 Ga0395901_0376898_370_675 82
45 3300038443 Ga0395901_1238711 Ga0395901_1238711_83_388 82
46 3300044684 Ga0466966_0336939 Ga0466966_0336939_346_651 82
47 3300044842 Ga0466957_0051735 Ga0466957_0051735_1233_1538 82
48 3300046473 Ga0495582_0036147 Ga0495582_0036147_1930_2235 82
49 3300046473 Ga0495582_0095326 Ga0495582_0095326_871_1176 82
50 3300046473 Ga0495582_0231824 Ga0495582_0231824_60_365 82
51 3300046475 Ga0495639_0558953 Ga0495639_0558953_258_563 82
52 3300046499 Ga0495594_0058692 Ga0495594_0058692_1671_1976 82
53 3300046531 Ga0495665_0409077 Ga0495665_0409077_342_647 82
54 3300046557 Ga0495622_0193164 Ga0495622_0193164_414_719 82
55 3300046690 Ga0495624_0270191 Ga0495624_0270191_329_634 82
56 3300047315 Ga0495581_0815074 Ga0495581_0815074_119_424 82
57 3300047321 Ga0495676_0147592 Ga0495676_0147592_273_578 82
58 3300048089 Ga0495614_0072198 Ga0495614_0072198_869_1174 82
59 3300049592 Ga0501076_1769809 Ga0501076_1769809_92_397 82
60 3300050511 nmdc:mga08y16_218293_c1 nmdc:mga08y16_218293_c1_1654_1959 82
61 3300050512 nmdc:mga0n895_164125_c1 nmdc:mga0n895_164125_c1_38_343 82
62 3300050513 nmdc:mga0rr50_213005_c1 nmdc:mga0rr50_213005_c1_968_1273 82
63 3300050515 nmdc:mga0a205_300588_c1 nmdc:mga0a205_300588_c1_108_413 82
64 3300005435 Ga0070714_101036858 Ga0070714_1010368582 83
65 3300005981 Ga0081538_10039817 Ga0081538_100398177 83
66 3300006844 Ga0075428_100002031 Ga0075428_10000203125 83
67 3300009147 Ga0114129_10000663 Ga0114129_100006636 83
68 3300025929 Ga0207664_11312895 Ga0207664_113128951 83
69 3300050507 nmdc:mga05p37_39439_c1 nmdc:mga05p37_39439_c1_1905_2213 83
70 3300005937 Ga0081455_10005292 Ga0081455_100052928 84
71 3300035725 Ga0373947_0122855 Ga0373947_0122855_598_882 84
72 3300046477 Ga0495664_0318602 Ga0495664_0318602_562_846 84
73 3300046533 Ga0495640_0891658 Ga0495640_0891658_130_414 84
74 3300046559 Ga0495667_0651563 Ga0495667_0651563_126_410 84
75 3300053077 Ga0495601_0026332 Ga0495601_0026332_771_1055 84
76 3300053085 Ga0495619_0118221 Ga0495619_0118221_129_413 84
77 3300045049 Ga0466959_0034372 Ga0466959_0034372_3432_3737 85
78 3300031251 Ga0265327_10020771 Ga0265327_100207717 87
79 3300039438 Ga0436360_1187886 Ga0436360_1187886_1130_1423 87
80 3300039450 Ga0436363_1297278 Ga0436363_1297278_143_445 87
81 3300048915 Ga0496112_0110513 Ga0496112_0110513_885_1178 87
82 3300059627 Ga0587117_067999 Ga0587117_067999_292_600 87
83 3300060346 Ga0587111_0083332 Ga0587111_0083332_322_615 87
84 3300046477 Ga0495664_0325591 Ga0495664_0325591_156_461 89
85 3300005365 Ga0070688_101003803 Ga0070688_1010038031 90
86 3300005435 Ga0070714_100051876 Ga0070714_1000518766 90
87 3300009098 Ga0105245_12068663 Ga0105245_120686632 90
88 3300014968 Ga0157379_10370007 Ga0157379_103700072 90
89 3300025929 Ga0207664_10098342 Ga0207664_100983423 90
90 3300036401 Ga0373937_0837980 Ga0373937_0837980_489_791 90
91 3300037312 Ga0395899_0186005 Ga0395899_0186005_701_1003 90
92 3300005327 Ga0070658_10022933 Ga0070658_100229333 91
93 3300005327 Ga0070658_10165010 Ga0070658_101650103 91
94 3300005327 Ga0070658_10192112 Ga0070658_101921123 91
95 3300005327 Ga0070658_10908344 Ga0070658_109083442 91
96 3300005329 Ga0070683_100001951 Ga0070683_10000195113 91
97 3300005329 Ga0070683_100101284 Ga0070683_1001012843 91
98 3300005329 Ga0070683_100208837 Ga0070683_1002088372 91
99 3300005329 Ga0070683_100229770 Ga0070683_1002297702 91
100 3300005336 Ga0070680_100007887 Ga0070680_1000078878 91
101 3300005336 Ga0070680_100075245 Ga0070680_1000752452 91
102 3300005336 Ga0070680_100744660 Ga0070680_1007446602 91
103 3300005337 Ga0070682_100063342 Ga0070682_1000633423 91
104 3300005339 Ga0070660_100021867 Ga0070660_1000218677 91
105 3300005339 Ga0070660_100685952 Ga0070660_1006859521 91
106 3300005339 Ga0070660_100866411 Ga0070660_1008664112 91
107 3300005339 Ga0070660_100960001 Ga0070660_1009600011 91
108 3300005341 Ga0070691_10387246 Ga0070691_103872462 91
109 3300005344 Ga0070661_100039193 Ga0070661_1000391937 91
110 3300005344 Ga0070661_100094101 Ga0070661_1000941012 91
111 3300005366 Ga0070659_100208823 Ga0070659_1002088233 91
112 3300005434 Ga0070709_10037054 Ga0070709_100370543 91
113 3300005435 Ga0070714_100045084 Ga0070714_1000450842 91
114 3300005435 Ga0070714_100091757 Ga0070714_1000917573 91
115 3300005435 Ga0070714_100950241 Ga0070714_1009502411 91
116 3300005435 Ga0070714_101127741 Ga0070714_1011277412 91
117 3300005436 Ga0070713_100026902 Ga0070713_1000269028 91
118 3300005436 Ga0070713_100821402 Ga0070713_1008214023 91
119 3300005436 Ga0070713_101186487 Ga0070713_1011864871 91
120 3300005437 Ga0070710_11371456 Ga0070710_113714561 91
121 3300005439 Ga0070711_100022262 Ga0070711_1000222625 91
122 3300005444 Ga0070694_100014705 Ga0070694_1000147058 91
123 3300005445 Ga0070708_100414201 Ga0070708_1004142013 91
124 3300005456 Ga0070678_100206979 Ga0070678_1002069794 91
125 3300005458 Ga0070681_10002352 Ga0070681_1000235221 91
126 3300005458 Ga0070681_10002582 Ga0070681_1000258223 91
127 3300005458 Ga0070681_10010574 Ga0070681_1001057412 91
128 3300005467 Ga0070706_100529015 Ga0070706_1005290152 91
129 3300005468 Ga0070707_100897528 Ga0070707_1008975281 91
130 3300005471 Ga0070698_100158682 Ga0070698_1001586822 91
131 3300005471 Ga0070698_100833407 Ga0070698_1008334073 91
132 3300005530 Ga0070679_100007912 Ga0070679_10000791214 91
133 3300005530 Ga0070679_100072281 Ga0070679_1000722814 91
134 3300005535 Ga0070684_100016458 Ga0070684_1000164584 91
135 3300005535 Ga0070684_100036184 Ga0070684_1000361842 91
136 3300005535 Ga0070684_100971745 Ga0070684_1009717452 91
137 3300005535 Ga0070684_101109502 Ga0070684_1011095022 91
138 3300005539 Ga0068853_100204687 Ga0068853_1002046872 91
139 3300005545 Ga0070695_100000007 Ga0070695_10000000776 91
140 3300005545 Ga0070695_100632017 Ga0070695_1006320172 91
141 3300005546 Ga0070696_101412861 Ga0070696_1014128612 91
142 3300005563 Ga0068855_100030809 Ga0068855_1000308094 91
143 3300005563 Ga0068855_101023735 Ga0068855_1010237351 91
144 3300005563 Ga0068855_101070103 Ga0068855_1010701031 91
145 3300005563 Ga0068855_101102168 Ga0068855_1011021682 91
146 3300005577 Ga0068857_100024780 Ga0068857_1000247802 91
147 3300005577 Ga0068857_100097777 Ga0068857_1000977774 91
148 3300005578 Ga0068854_100288704 Ga0068854_1002887042 91
149 3300005614 Ga0068856_100249630 Ga0068856_1002496302 91
150 3300005614 Ga0068856_100810267 Ga0068856_1008102672 91
151 3300005616 Ga0068852_101194313 Ga0068852_1011943132 91
152 3300005937 Ga0081455_10031254 Ga0081455_100312543 91
153 3300005985 Ga0081539_10166670 Ga0081539_101666702 91
154 3300006028 Ga0070717_10043162 Ga0070717_100431622 91
155 3300006028 Ga0070717_10266039 Ga0070717_102660393 91
156 3300006163 Ga0070715_10032441 Ga0070715_100324413 91
157 3300006163 Ga0070715_10186187 Ga0070715_101861872 91
158 3300006173 Ga0070716_100169941 Ga0070716_1001699412 91
159 3300006173 Ga0070716_101194086 Ga0070716_1011940862 91
160 3300006175 Ga0070712_101113233 Ga0070712_1011132332 91
161 3300006852 Ga0075433_10018360 Ga0075433_100183601 91
162 3300006852 Ga0075433_10116012 Ga0075433_101160123 91
163 3300006871 Ga0075434_100054617 Ga0075434_1000546177 91
164 3300006871 Ga0075434_100770360 Ga0075434_1007703602 91
165 3300006880 Ga0075429_100256518 Ga0075429_1002565183 91
166 3300007076 Ga0075435_100370177 Ga0075435_1003701772 91
167 3300007076 Ga0075435_101626497 Ga0075435_1016264971 91
168 3300009093 Ga0105240_10030751 Ga0105240_100307515 91
169 3300009093 Ga0105240_10097231 Ga0105240_100972317 91
170 3300009093 Ga0105240_10236909 Ga0105240_102369092 91
171 3300009093 Ga0105240_10334080 Ga0105240_103340803 91
172 3300009098 Ga0105245_10023444 Ga0105245_100234449 91
173 3300009148 Ga0105243_10069693 Ga0105243_100696933 91
174 3300009545 Ga0105237_10189280 Ga0105237_101892804 91
175 3300009551 Ga0105238_10170715 Ga0105238_101707154 91
176 3300012483 Ga0157337_1006084 Ga0157337_10060841 91
177 3300012488 Ga0157343_1000717 Ga0157343_10007171 91
178 3300012500 Ga0157314_1015485 Ga0157314_10154852 91
179 3300013102 Ga0157371_10861010 Ga0157371_108610102 91
180 3300013104 Ga0157370_10011210 Ga0157370_1001121013 91
181 3300013104 Ga0157370_10018219 Ga0157370_100182192 91
182 3300013104 Ga0157370_10747666 Ga0157370_107476662 91
183 3300013104 Ga0157370_11328543 Ga0157370_113285432 91
184 3300013105 Ga0157369_10002883 Ga0157369_100028834 91
185 3300013105 Ga0157369_10182179 Ga0157369_101821792 91
186 3300013296 Ga0157374_10629473 Ga0157374_106294732 91
187 3300013296 Ga0157374_10656399 Ga0157374_106563991 91
188 3300013306 Ga0163162_10838063 Ga0163162_108380632 91
189 3300013306 Ga0163162_11082479 Ga0163162_110824792 91
190 3300013307 Ga0157372_10029039 Ga0157372_100290393 91
191 3300013307 Ga0157372_10391346 Ga0157372_103913464 91
192 3300013307 Ga0157372_10437965 Ga0157372_104379652 91
193 3300013307 Ga0157372_11832215 Ga0157372_118322152 91
194 3300013308 Ga0157375_11220789 Ga0157375_112207893 91
195 3300014326 Ga0157380_11278662 Ga0157380_112786622 91
196 3300014497 Ga0182008_10002753 Ga0182008_100027537 91
197 3300014497 Ga0182008_10024953 Ga0182008_100249532 91
198 3300014497 Ga0182008_10265433 Ga0182008_102654332 91
199 3300015261 Ga0182006_1143170 Ga0182006_11431701 91
200 3300015261 Ga0182006_1162713 Ga0182006_11627132 91
201 3300015262 Ga0182007_10117022 Ga0182007_101170222 91
202 3300015265 Ga0182005_1133303 Ga0182005_11333032 91
203 3300020070 Ga0206356_10280546 Ga0206356_102805461 91
204 3300020070 Ga0206356_11617167 Ga0206356_116171673 91
205 3300020075 Ga0206349_1900966 Ga0206349_19009661 91
206 3300020080 Ga0206350_10482534 Ga0206350_104825342 91
207 3300020081 Ga0206354_10133384 Ga0206354_101333842 91
208 3300020081 Ga0206354_10432702 Ga0206354_104327022 91
209 3300020081 Ga0206354_11071589 Ga0206354_110715892 91
210 3300020082 Ga0206353_10004980 Ga0206353_100049809 91
211 3300020082 Ga0206353_10866168 Ga0206353_108661689 91
212 3300020082 Ga0206353_11626609 Ga0206353_116266092 91
213 3300020610 Ga0154015_1165229 Ga0154015_11652292 91
214 3300020610 Ga0154015_1211618 Ga0154015_12116182 91
215 3300020610 Ga0154015_1354810 Ga0154015_13548102 91
216 3300022467 Ga0224712_10125102 Ga0224712_101251022 91
217 3300025905 Ga0207685_10156599 Ga0207685_101565991 91
218 3300025906 Ga0207699_10029387 Ga0207699_100293875 91
219 3300025906 Ga0207699_11343937 Ga0207699_113439372 91
220 3300025909 Ga0207705_10003887 Ga0207705_100038876 91
221 3300025909 Ga0207705_10017397 Ga0207705_100173973 91
222 3300025909 Ga0207705_10055106 Ga0207705_100551063 91
223 3300025910 Ga0207684_11530231 Ga0207684_115302311 91
224 3300025912 Ga0207707_10004063 Ga0207707_1000406319 91
225 3300025912 Ga0207707_10008618 Ga0207707_1000861813 91
226 3300025912 Ga0207707_10085336 Ga0207707_100853365 91
227 3300025913 Ga0207695_10182090 Ga0207695_101820902 91
228 3300025913 Ga0207695_10244492 Ga0207695_102444922 91
229 3300025913 Ga0207695_10394645 Ga0207695_103946452 91
230 3300025913 Ga0207695_10418696 Ga0207695_104186962 91
231 3300025914 Ga0207671_10126668 Ga0207671_101266682 91
232 3300025916 Ga0207663_10033597 Ga0207663_100335974 91
233 3300025917 Ga0207660_10018636 Ga0207660_100186367 91
234 3300025917 Ga0207660_10061836 Ga0207660_100618362 91
235 3300025917 Ga0207660_10196183 Ga0207660_101961832 91
236 3300025917 Ga0207660_10234096 Ga0207660_102340962 91
237 3300025919 Ga0207657_10002690 Ga0207657_100026909 91
238 3300025920 Ga0207649_10063761 Ga0207649_100637615 91
239 3300025921 Ga0207652_10019328 Ga0207652_100193289 91
240 3300025921 Ga0207652_10022742 Ga0207652_100227427 91
241 3300025921 Ga0207652_10025683 Ga0207652_100256837 91
242 3300025921 Ga0207652_10422723 Ga0207652_104227232 91
243 3300025922 Ga0207646_10783910 Ga0207646_107839102 91
244 3300025922 Ga0207646_11215303 Ga0207646_112153032 91
245 3300025924 Ga0207694_10451089 Ga0207694_104510892 91
246 3300025924 Ga0207694_10931816 Ga0207694_109318162 91
247 3300025927 Ga0207687_10838302 Ga0207687_108383022 91
248 3300025928 Ga0207700_10000002 Ga0207700_10000002603 91
249 3300025928 Ga0207700_10353708 Ga0207700_103537083 91
250 3300025928 Ga0207700_10371224 Ga0207700_103712242 91
251 3300025928 Ga0207700_11058666 Ga0207700_110586662 91
252 3300025929 Ga0207664_10031085 Ga0207664_100310852 91
253 3300025929 Ga0207664_10130990 Ga0207664_101309902 91
254 3300025929 Ga0207664_10176988 Ga0207664_101769884 91
255 3300025929 Ga0207664_10794695 Ga0207664_107946952 91
256 3300025931 Ga0207644_10957269 Ga0207644_109572692 91
257 3300025932 Ga0207690_11726752 Ga0207690_117267522 91
258 3300025934 Ga0207686_10059516 Ga0207686_100595164 91
259 3300025934 Ga0207686_10207491 Ga0207686_102074913 91
260 3300025935 Ga0207709_10057868 Ga0207709_100578684 91
261 3300025938 Ga0207704_10380929 Ga0207704_103809291 91
262 3300025939 Ga0207665_10002200 Ga0207665_1000220017 91
263 3300025939 Ga0207665_10181167 Ga0207665_101811673 91
264 3300025939 Ga0207665_10212723 Ga0207665_102127234 91
265 3300025939 Ga0207665_10379502 Ga0207665_103795023 91
266 3300025940 Ga0207691_11053773 Ga0207691_110537732 91
267 3300025941 Ga0207711_10656114 Ga0207711_106561142 91
268 3300025941 Ga0207711_11344590 Ga0207711_113445901 91
269 3300025944 Ga0207661_10003839 Ga0207661_100038394 91
270 3300025944 Ga0207661_10025797 Ga0207661_100257977 91
271 3300025944 Ga0207661_10060022 Ga0207661_100600222 91
272 3300025944 Ga0207661_10276732 Ga0207661_102767323 91
273 3300025944 Ga0207661_11221473 Ga0207661_112214731 91
274 3300025949 Ga0207667_10050181 Ga0207667_100501817 91
275 3300025981 Ga0207640_11459578 Ga0207640_114595781 91
276 3300026023 Ga0207677_10799876 Ga0207677_107998762 91
277 3300026041 Ga0207639_10606341 Ga0207639_106063412 91
278 3300026067 Ga0207678_11874223 Ga0207678_118742231 91
279 3300026078 Ga0207702_10152300 Ga0207702_101523004 91
280 3300026078 Ga0207702_11249466 Ga0207702_112494662 91
281 3300026095 Ga0207676_12359693 Ga0207676_123596931 91
282 3300026116 Ga0207674_10016181 Ga0207674_1001618110 91
283 3300026116 Ga0207674_10100393 Ga0207674_101003935 91
284 3300026121 Ga0207683_10172724 Ga0207683_101727244 91
285 3300028558 Ga0265326_10009205 Ga0265326_100092054 91
286 3300028558 Ga0265326_10031889 Ga0265326_100318892 91
287 3300028563 Ga0265319_1005903 Ga0265319_10059033 91
288 3300028563 Ga0265319_1078233 Ga0265319_10782332 91
289 3300028573 Ga0265334_10006308 Ga0265334_100063086 91
290 3300028573 Ga0265334_10017490 Ga0265334_100174903 91
291 3300028577 Ga0265318_10001217 Ga0265318_1000121718 91
292 3300028653 Ga0265323_10069259 Ga0265323_100692593 91
293 3300028654 Ga0265322_10005028 Ga0265322_100050286 91
294 3300028666 Ga0265336_10021950 Ga0265336_100219503 91
295 3300028800 Ga0265338_10002936 Ga0265338_1000293621 91
296 3300028800 Ga0265338_10004663 Ga0265338_1000466311 91
297 3300028800 Ga0265338_10011028 Ga0265338_100110289 91
298 3300028800 Ga0265338_10023362 Ga0265338_1002336211 91
299 3300029957 Ga0265324_10023833 Ga0265324_100238333 91
300 3300031235 Ga0265330_10001984 Ga0265330_100019845 91
301 3300031238 Ga0265332_10001963 Ga0265332_100019639 91
302 3300031239 Ga0265328_10007996 Ga0265328_100079964 91
303 3300031240 Ga0265320_10010508 Ga0265320_100105089 91
304 3300031241 Ga0265325_10001625 Ga0265325_1000162515 91
305 3300031242 Ga0265329_10004462 Ga0265329_100044629 91
306 3300031247 Ga0265340_10074233 Ga0265340_100742333 91
307 3300031250 Ga0265331_10004771 Ga0265331_100047716 91
308 3300031251 Ga0265327_10010871 Ga0265327_1001087110 91
309 3300031344 Ga0265316_10077706 Ga0265316_100777065 91
310 3300031344 Ga0265316_10372808 Ga0265316_103728082 91
311 3300031595 Ga0265313_10009457 Ga0265313_100094574 91
312 3300031595 Ga0265313_10052738 Ga0265313_100527383 91
313 3300031711 Ga0265314_10039580 Ga0265314_100395803 91
314 3300031712 Ga0265342_10012474 Ga0265342_100124749 91
315 3300031995 Ga0307409_100595419 Ga0307409_1005954191 91
316 3300032133 Ga0316583_10026733 Ga0316583_100267332 91
317 3300032133 Ga0316583_10044736 Ga0316583_100447363 91
318 3300035089 Ga0373944_0065864 Ga0373944_0065864_164_469 91
319 3300035111 Ga0373923_0378572 Ga0373923_0378572_349_654 91
320 3300035113 Ga0373936_0019904 Ga0373936_0019904_840_1145 91
321 3300035113 Ga0373936_0071391 Ga0373936_0071391_765_1070 91
322 3300035116 Ga0373945_0006065 Ga0373945_0006065_3441_3746 91
323 3300035119 Ga0373956_0456669 Ga0373956_0456669_197_511 91
324 3300035120 Ga0373957_0557154 Ga0373957_0557154_109_414 91
325 3300035170 Ga0373943_0000628 Ga0373943_0000628_5354_5659 91
326 3300035410 Ga0373924_0113029 Ga0373924_0113029_600_905 91
327 3300035692 Ga0373935_0015369 Ga0373935_0015369_3776_4081 91
328 3300035695 Ga0373927_0049940 Ga0373927_0049940_472_777 91
329 3300035725 Ga0373947_0004063 Ga0373947_0004063_451_756 91
330 3300037068 Ga0373925_0002950 Ga0373925_0002950_10985_11290 91
331 3300037312 Ga0395899_0730590 Ga0395899_0730590_79_384 91
332 3300037418 Ga0395900_0687282 Ga0395900_0687282_314_619 91
333 3300037418 Ga0395900_1189210 Ga0395900_1189210_30_335 91
334 3300037471 Ga0395905_1103584 Ga0395905_1103584_135_440 91
335 3300038443 Ga0395901_0218834 Ga0395901_0218834_546_851 91
336 3300038443 Ga0395901_0254299 Ga0395901_0254299_740_1045 91
337 3300038443 Ga0395901_0775274 Ga0395901_0775274_393_698 91
338 3300039437 Ga0436365_1158022 Ga0436365_1158022_95_400 91
339 3300039438 Ga0436360_1211651 Ga0436360_1211651_4011_4316 91
340 3300039447 Ga0436361_1157274 Ga0436361_1157274_145_450 91
341 3300039453 Ga0436362_0404353 Ga0436362_0404353_158_463 91
342 3300041408 Ga0439453_0001773 Ga0439453_0001773_1172_1477 91
343 3300041463 Ga0451804_1120031 Ga0451804_1120031_535_840 91
344 3300042011 Ga0439454_003880 Ga0439454_003880_798_1103 91
345 3300044656 Ga0466969_0003769 Ga0466969_0003769_2172_2477 91
346 3300044683 Ga0466965_0154088 Ga0466965_0154088_341_646 91
347 3300044683 Ga0466965_0347836 Ga0466965_0347836_477_782 91
348 3300044683 Ga0466965_0382883 Ga0466965_0382883_150_455 91
349 3300044684 Ga0466966_0039151 Ga0466966_0039151_989_1294 91
350 3300044684 Ga0466966_0113754 Ga0466966_0113754_426_731 91
351 3300044684 Ga0466966_0178062 Ga0466966_0178062_200_505 91
352 3300044693 Ga0466961_0288470 Ga0466961_0288470_343_648 91
353 3300044693 Ga0466961_0316943 Ga0466961_0316943_137_442 91
354 3300044693 Ga0466961_0389319 Ga0466961_0389319_202_507 91
355 3300044694 Ga0466963_0000137 Ga0466963_0000137_22411_22716 91
356 3300044694 Ga0466963_0000276 Ga0466963_0000276_15134_15439 91
357 3300044694 Ga0466963_0000632 Ga0466963_0000632_3922_4227 91
358 3300044694 Ga0466963_0000673 Ga0466963_0000673_12397_12702 91
359 3300044694 Ga0466963_0000741 Ga0466963_0000741_7878_8183 91
360 3300044694 Ga0466963_0002688 Ga0466963_0002688_1963_2268 91
361 3300044694 Ga0466963_0005725 Ga0466963_0005725_6350_6655 91
362 3300044694 Ga0466963_0038983 Ga0466963_0038983_1711_2016 91
363 3300044694 Ga0466963_0042447 Ga0466963_0042447_1456_1761 91
364 3300044694 Ga0466963_0076759 Ga0466963_0076759_454_759 91
365 3300044694 Ga0466963_0280509 Ga0466963_0280509_695_1000 91
366 3300044694 Ga0466963_0291769 Ga0466963_0291769_449_754 91
367 3300044694 Ga0466963_0705761 Ga0466963_0705761_78_383 91
368 3300044706 Ga0466964_0006725 Ga0466964_0006725_3022_3327 91
369 3300044706 Ga0466964_0007832 Ga0466964_0007832_2480_2785 91
370 3300044706 Ga0466964_0013707 Ga0466964_0013707_1823_2128 91
371 3300044706 Ga0466964_0072548 Ga0466964_0072548_901_1206 91
372 3300044706 Ga0466964_0082817 Ga0466964_0082817_666_971 91
373 3300044706 Ga0466964_0145094 Ga0466964_0145094_371_676 91
374 3300044706 Ga0466964_0284728 Ga0466964_0284728_185_490 91
375 3300044719 Ga0466971_0001552 Ga0466971_0001552_7613_7918 91
376 3300044719 Ga0466971_0001914 Ga0466971_0001914_1515_1820 91
377 3300044719 Ga0466971_0037646 Ga0466971_0037646_706_1011 91
378 3300044735 Ga0466968_0004224 Ga0466968_0004224_2723_3028 91
379 3300044735 Ga0466968_0006450 Ga0466968_0006450_765_1070 91
380 3300044735 Ga0466968_0008503 Ga0466968_0008503_1975_2280 91
381 3300044765 Ga0466970_0014456 Ga0466970_0014456_3365_3670 91
382 3300044842 Ga0466957_0001689 Ga0466957_0001689_8880_9185 91
383 3300044842 Ga0466957_0003049 Ga0466957_0003049_5339_5644 91
384 3300044842 Ga0466957_0003662 Ga0466957_0003662_4786_5091 91
385 3300044842 Ga0466957_0022017 Ga0466957_0022017_2370_2675 91
386 3300044842 Ga0466957_0039136 Ga0466957_0039136_2460_2765 91
387 3300044842 Ga0466957_0160392 Ga0466957_0160392_712_1017 91
388 3300044842 Ga0466957_0208452 Ga0466957_0208452_301_606 91
389 3300044842 Ga0466957_0671945 Ga0466957_0671945_73_378 91
390 3300044842 Ga0466957_0942087 Ga0466957_0942087_232_537 91
391 3300044901 Ga0466960_0004958 Ga0466960_0004958_4632_4937 91
392 3300044901 Ga0466960_0101262 Ga0466960_0101262_691_996 91
393 3300044901 Ga0466960_0193673 Ga0466960_0193673_314_619 91
394 3300044901 Ga0466960_0367764 Ga0466960_0367764_329_634 91
395 3300045049 Ga0466959_0010806 Ga0466959_0010806_2682_2987 91
396 3300045049 Ga0466959_0013103 Ga0466959_0013103_4688_4993 91
397 3300045049 Ga0466959_0151365 Ga0466959_0151365_1080_1385 91
398 3300045049 Ga0466959_0662311 Ga0466959_0662311_10_315 91
399 3300045836 Ga0466958_0002075 Ga0466958_0002075_7187_7492 91
400 3300045836 Ga0466958_0004062 Ga0466958_0004062_3906_4211 91
401 3300045836 Ga0466958_0005483 Ga0466958_0005483_2082_2387 91
402 3300045836 Ga0466958_0007875 Ga0466958_0007875_1499_1804 91
403 3300045836 Ga0466958_0010034 Ga0466958_0010034_1525_1830 91
404 3300045836 Ga0466958_0030937 Ga0466958_0030937_1907_2212 91
405 3300045836 Ga0466958_0038614 Ga0466958_0038614_484_789 91
406 3300045836 Ga0466958_0116393 Ga0466958_0116393_645_950 91
407 3300045836 Ga0466958_0178992 Ga0466958_0178992_736_1041 91
408 3300045836 Ga0466958_0299619 Ga0466958_0299619_85_390 91
409 3300045836 Ga0466958_0490985 Ga0466958_0490985_136_441 91
410 3300045836 Ga0466958_1010761 Ga0466958_1010761_102_407 91
411 3300045976 Ga0466967_0000300 Ga0466967_0000300_6746_7051 91
412 3300045976 Ga0466967_0002201 Ga0466967_0002201_3570_3875 91
413 3300045976 Ga0466967_0003956 Ga0466967_0003956_1046_1351 91
414 3300045976 Ga0466967_0043133 Ga0466967_0043133_2737_3042 91
415 3300045976 Ga0466967_0044979 Ga0466967_0044979_948_1253 91
416 3300045976 Ga0466967_0058202 Ga0466967_0058202_2828_3133 91
417 3300045976 Ga0466967_0079604 Ga0466967_0079604_1630_1935 91
418 3300045976 Ga0466967_0104505 Ga0466967_0104505_892_1197 91
419 3300045976 Ga0466967_0134110 Ga0466967_0134110_795_1100 91
420 3300045976 Ga0466967_0179243 Ga0466967_0179243_367_672 91
421 3300045976 Ga0466967_0189071 Ga0466967_0189071_674_979 91
422 3300045976 Ga0466967_0207017 Ga0466967_0207017_1399_1704 91
423 3300045976 Ga0466967_0284491 Ga0466967_0284491_619_924 91
424 3300045976 Ga0466967_0425213 Ga0466967_0425213_523_828 91
425 3300045976 Ga0466967_0508189 Ga0466967_0508189_306_611 91
426 3300045976 Ga0466967_0766082 Ga0466967_0766082_22_327 91
427 3300045976 Ga0466967_1030558 Ga0466967_1030558_426_731 91
428 3300045976 Ga0466967_2305337 Ga0466967_2305337_98_403 91
429 3300045976 Ga0466967_2386858 Ga0466967_2386858_204_509 91
430 3300046454 Ga0495592_0163026 Ga0495592_0163026_596_901 91
431 3300046454 Ga0495592_0825576 Ga0495592_0825576_208_513 91
432 3300046459 Ga0495629_0014949 Ga0495629_0014949_3076_3381 91
433 3300046459 Ga0495629_0018947 Ga0495629_0018947_2780_3085 91
434 3300046459 Ga0495629_0184357 Ga0495629_0184357_353_658 91
435 3300046461 Ga0495641_0003398 Ga0495641_0003398_4264_4569 91
436 3300046462 Ga0495651_0054488 Ga0495651_0054488_2474_2779 91
437 3300046462 Ga0495651_0271049 Ga0495651_0271049_445_750 91
438 3300046463 Ga0495653_0005518 Ga0495653_0005518_9162_9467 91
439 3300046463 Ga0495653_0351210 Ga0495653_0351210_246_551 91
440 3300046472 Ga0495580_0006348 Ga0495580_0006348_676_981 91
441 3300046473 Ga0495582_0007435 Ga0495582_0007435_3564_3869 91
442 3300046475 Ga0495639_0000291 Ga0495639_0000291_14962_15267 91
443 3300046476 Ga0495662_0006357 Ga0495662_0006357_2068_2373 91
444 3300046477 Ga0495664_0007586 Ga0495664_0007586_3659_3964 91
445 3300046477 Ga0495664_0371177 Ga0495664_0371177_319_624 91
446 3300046511 Ga0495608_0363750 Ga0495608_0363750_527_832 91
447 3300046511 Ga0495608_0714352 Ga0495608_0714352_133_438 91
448 3300046514 Ga0495618_0006267 Ga0495618_0006267_4596_4901 91
449 3300046514 Ga0495618_0242156 Ga0495618_0242156_57_362 91
450 3300046516 Ga0495628_0056803 Ga0495628_0056803_465_770 91
451 3300046517 Ga0495630_0000631 Ga0495630_0000631_12456_12761 91
452 3300046517 Ga0495630_0029216 Ga0495630_0029216_2261_2566 91
453 3300046517 Ga0495630_0177662 Ga0495630_0177662_232_537 91
454 3300046526 Ga0495666_0000270 Ga0495666_0000270_18440_18745 91
455 3300046529 Ga0495652_0004378 Ga0495652_0004378_12456_12761 91
456 3300046531 Ga0495665_0001487 Ga0495665_0001487_4136_4441 91
457 3300046533 Ga0495640_0019213 Ga0495640_0019213_4551_4856 91
458 3300046533 Ga0495640_0048828 Ga0495640_0048828_549_854 91
459 3300046535 Ga0495586_0004266 Ga0495586_0004266_3659_3964 91
460 3300046535 Ga0495586_0040895 Ga0495586_0040895_17_322 91
461 3300046543 Ga0495645_0035797 Ga0495645_0035797_3227_3532 91
462 3300046543 Ga0495645_0759221 Ga0495645_0759221_207_512 91
463 3300046559 Ga0495667_0015940 Ga0495667_0015940_4468_4773 91
464 3300046642 Ga0495634_0004560 Ga0495634_0004560_6860_7165 91
465 3300046642 Ga0495634_0546683 Ga0495634_0546683_11_316 91
466 3300046663 Ga0495635_0006305 Ga0495635_0006305_3541_3846 91
467 3300046663 Ga0495635_0013922 Ga0495635_0013922_1132_1437 91
468 3300046680 Ga0495646_0185283 Ga0495646_0185283_496_801 91
469 3300046681 Ga0495647_0000243 Ga0495647_0000243_3531_3836 91
470 3300046683 Ga0495658_0000970 Ga0495658_0000970_10500_10805 91
471 3300046689 Ga0495613_0008628 Ga0495613_0008628_2196_2501 91
472 3300046689 Ga0495613_0292129 Ga0495613_0292129_370_675 91
473 3300046690 Ga0495624_0001273 Ga0495624_0001273_12362_12667 91
474 3300046809 Ga0495600_0534694 Ga0495600_0534694_357_662 91
475 3300047315 Ga0495581_0000258 Ga0495581_0000258_16735_17040 91
476 3300047317 Ga0495604_0788061 Ga0495604_0788061_243_548 91
477 3300047319 Ga0495674_0004337 Ga0495674_0004337_4666_4971 91
478 3300047319 Ga0495674_0036575 Ga0495674_0036575_3717_4022 91
479 3300047321 Ga0495676_0007780 Ga0495676_0007780_2196_2501 91
480 3300047322 Ga0495680_0001263 Ga0495680_0001263_13326_13631 91
481 3300047322 Ga0495680_0581729 Ga0495680_0581729_249_554 91
482 3300047471 Ga0495684_0007604 Ga0495684_0007604_3531_3836 91
483 3300047471 Ga0495684_0030087 Ga0495684_0030087_397_702 91
484 3300047673 Ga0495593_0000732 Ga0495593_0000732_4136_4441 91
485 3300048089 Ga0495614_0000557 Ga0495614_0000557_10559_10864 91
486 3300048903 Ga0496100_0030261 Ga0496100_0030261_1486_1791 91
487 3300048903 Ga0496100_1226679 Ga0496100_1226679_211_516 91
488 3300048904 Ga0496101_0006366 Ga0496101_0006366_6392_6697 91
489 3300048904 Ga0496101_0095023 Ga0496101_0095023_1116_1421 91
490 3300048904 Ga0496101_0954084 Ga0496101_0954084_58_363 91
491 3300048905 Ga0496102_0108541 Ga0496102_0108541_725_1030 91
492 3300048905 Ga0496102_0484871 Ga0496102_0484871_705_1010 91
493 3300048905 Ga0496102_1601388 Ga0496102_1601388_192_497 91
494 3300048906 Ga0496103_0160847 Ga0496103_0160847_961_1311 91
495 3300048909 Ga0496106_0110837 Ga0496106_0110837_1212_1517 91
496 3300048910 Ga0496107_0010564 Ga0496107_0010564_833_1138 91
497 3300048911 Ga0496108_0007700 Ga0496108_0007700_7874_8179 91
498 3300048912 Ga0496109_0001934 Ga0496109_0001934_11551_11856 91
499 3300048913 Ga0496110_0032858 Ga0496110_0032858_1476_1781 91
500 3300048913 Ga0496110_0073039 Ga0496110_0073039_796_1101 91
501 3300048914 Ga0496111_0014931 Ga0496111_0014931_1695_2000 91
502 3300048914 Ga0496111_0160277 Ga0496111_0160277_386_691 91
503 3300048915 Ga0496112_0039823 Ga0496112_0039823_4257_4562 91
504 3300048915 Ga0496112_0588131 Ga0496112_0588131_706_1011 91
505 3300048915 Ga0496112_1035491 Ga0496112_1035491_305_610 91
506 3300048916 Ga0496113_0097567 Ga0496113_0097567_958_1263 91
507 3300048916 Ga0496113_0259431 Ga0496113_0259431_378_683 91
508 3300048916 Ga0496113_0922535 Ga0496113_0922535_113_418 91
509 3300048916 Ga0496113_1507849 Ga0496113_1507849_43_348 91
510 3300048917 Ga0496114_0140685 Ga0496114_0140685_392_697 91
511 3300048917 Ga0496114_0267734 Ga0496114_0267734_375_680 91
512 3300049571 Ga0501034_0266654 Ga0501034_0266654_820_1125 91
513 3300049581 Ga0501047_0021100 Ga0501047_0021100_3626_3931 91
514 3300049581 Ga0501047_0127973 Ga0501047_0127973_709_1014 91
515 3300049583 Ga0501067_0061749 Ga0501067_0061749_117_422 91
516 3300049586 Ga0501070_0009671 Ga0501070_0009671_1754_2059 91
517 3300049586 Ga0501070_0010356 Ga0501070_0010356_2607_2912 91
518 3300049586 Ga0501070_0014314 Ga0501070_0014314_180_485 91
519 3300049588 Ga0501072_0012822 Ga0501072_0012822_1777_2082 91
520 3300049590 Ga0501074_0035771 Ga0501074_0035771_1227_1532 91
521 3300049590 Ga0501074_0072379 Ga0501074_0072379_981_1286 91
522 3300049590 Ga0501074_0342879 Ga0501074_0342879_107_412 91
523 3300049741 Ga0501079_0009230 Ga0501079_0009230_3474_3779 91
524 3300049742 Ga0501080_0005101 Ga0501080_0005101_751_1056 91
525 3300049744 Ga0501083_0001297 Ga0501083_0001297_14760_15065 91
526 3300049822 Ga0501035_0306938 Ga0501035_0306938_594_899 91
527 3300049823 Ga0501044_0428119 Ga0501044_0428119_841_1146 91
528 3300050512 nmdc:mga0n895_1006599_c1 nmdc:mga0n895_1006599_c1_496_801 91
529 3300050512 nmdc:mga0n895_47778_c1 nmdc:mga0n895_47778_c1_2558_2863 91
530 3300050513 nmdc:mga0rr50_250507_c1 nmdc:mga0rr50_250507_c1_441_746 91
531 3300050515 nmdc:mga0a205_287569_c1 nmdc:mga0a205_287569_c1_1196_1501 91
532 3300053077 Ga0495601_0005063 Ga0495601_0005063_2196_2501 91
533 3300053077 Ga0495601_0006407 Ga0495601_0006407_1909_2214 91
534 3300053078 Ga0495612_0007992 Ga0495612_0007992_2254_2559 91
535 3300053083 Ga0495655_0328558 Ga0495655_0328558_66_371 91
536 3300053085 Ga0495619_0001368 Ga0495619_0001368_14030_14335 91
537 3300053094 Ga0500566_0004146 Ga0500566_0004146_956_1261 91
538 3300054114 Ga0501084_1429245 Ga0501084_1429245_116_421 91
539 3300059490 Ga0587066_148541 Ga0587066_148541_229_534 91
540 3300059491 Ga0587070_170407 Ga0587070_170407_182_487 91
541 3300059505 Ga0587083_0164829 Ga0587083_0164829_34_378 91
542 3300059508 Ga0587088_150452 Ga0587088_150452_173_478 91
543 3300059511 Ga0587091_211672 Ga0587091_211672_52_357 91
544 3300059513 Ga0587094_115285 Ga0587094_115285_149_454 91
545 3300059604 Ga0587098_092447 Ga0587098_092447_16_321 91
546 3300059605 Ga0587106_083299 Ga0587106_083299_260_565 91
547 3300059625 Ga0587113_040616 Ga0587113_040616_186_491 91
548 3300059626 Ga0587115_109514 Ga0587115_109514_17_322 91
549 3300059627 Ga0587117_100780 Ga0587117_100780_192_497 91
550 3300059630 Ga0587128_081156 Ga0587128_081156_195_500 91
551 3300059642 Ga0587069_071279 Ga0587069_071279_101_406 91
552 3300059645 Ga0587076_061076 Ga0587076_061076_182_487 91
553 3300059647 Ga0587079_205117 Ga0587079_205117_42_347 91
554 3300059647 Ga0587079_210684 Ga0587079_210684_127_432 91
555 3300059652 Ga0587107_061295 Ga0587107_061295_164_469 91
556 3300060346 Ga0587111_0082839 Ga0587111_0082839_86_391 91
557 3300061719 Ga0466962_0010761 Ga0466962_0010761_2175_2480 91
558 3300061719 Ga0466962_0728864 Ga0466962_0728864_180_485 91
559 3300061734 Ga0530510_0670244 Ga0530510_0670244_410_715 91
560 3300005355 Ga0070671_100655714 Ga0070671_1006557142 92
561 3300006175 Ga0070712_100822352 Ga0070712_1008223522 92
562 3300009551 Ga0105238_12259277 Ga0105238_122592771 92
563 3300025915 Ga0207693_11292262 Ga0207693_112922622 92
564 3300025931 Ga0207644_10564790 Ga0207644_105647902 92
565 3300044842 Ga0466957_0091504 Ga0466957_0091504_1406_1714 92
566 3300044901 Ga0466960_0066119 Ga0466960_0066119_553_861 92
567 3300045976 Ga0466967_0290513 Ga0466967_0290513_655_963 92
568 3300046473 Ga0495582_0844511 Ga0495582_0844511_186_503 92
569 3300046514 Ga0495618_0409009 Ga0495618_0409009_173_490 92
570 3300046663 Ga0495635_0491252 Ga0495635_0491252_87_395 92
571 3300047317 Ga0495604_0245697 Ga0495604_0245697_249_557 92
572 3300048904 Ga0496101_0319407 Ga0496101_0319407_103_411 92
573 3300048907 Ga0496104_0119244 Ga0496104_0119244_636_944 92
574 3300048908 Ga0496105_0187197 Ga0496105_0187197_1271_1579 92
575 3300048911 Ga0496108_0006645 Ga0496108_0006645_3507_3815 92
576 3300048912 Ga0496109_0081876 Ga0496109_0081876_932_1240 92
577 3300048912 Ga0496109_0125107 Ga0496109_0125107_1910_2218 92
578 3300048913 Ga0496110_0218420 Ga0496110_0218420_401_709 92
579 3300048914 Ga0496111_0123737 Ga0496111_0123737_857_1165 92
580 3300048915 Ga0496112_0007079 Ga0496112_0007079_3215_3523 92
581 3300048917 Ga0496114_0063742 Ga0496114_0063742_1494_1802 92
582 3300049583 Ga0501067_0013960 Ga0501067_0013960_3553_3861 92
583 3300049585 Ga0501069_0059726 Ga0501069_0059726_216_524 92
584 3300003373 JGI25407J50210_10084025 JGI25407J50210_100840252 93
585 3300005336 Ga0070680_100577082 Ga0070680_1005770823 93
586 3300005337 Ga0070682_101215812 Ga0070682_1012158121 93
587 3300005339 Ga0070660_100052730 Ga0070660_1000527305 93
588 3300005366 Ga0070659_100336249 Ga0070659_1003362493 93
589 3300005434 Ga0070709_11331947 Ga0070709_113319471 93
590 3300005435 Ga0070714_100021544 Ga0070714_1000215448 93
591 3300005435 Ga0070714_100383323 Ga0070714_1003833232 93
592 3300005435 Ga0070714_101236672 Ga0070714_1012366722 93
593 3300005530 Ga0070679_101399899 Ga0070679_1013998992 93
594 3300005981 Ga0081538_10003303 Ga0081538_100033037 93
595 3300007788 Ga0099795_10171099 Ga0099795_101710992 93
596 3300009093 Ga0105240_11041553 Ga0105240_110415532 93
597 3300009094 Ga0111539_12157614 Ga0111539_121576142 93
598 3300013100 Ga0157373_10107685 Ga0157373_101076853 93
599 3300013102 Ga0157371_10262758 Ga0157371_102627582 93
600 3300013104 Ga0157370_10747274 Ga0157370_107472743 93
601 3300014326 Ga0157380_10545104 Ga0157380_105451042 93
602 3300025912 Ga0207707_10084317 Ga0207707_100843174 93
603 3300025913 Ga0207695_10129279 Ga0207695_101292793 93
604 3300025917 Ga0207660_11309995 Ga0207660_113099952 93
605 3300025919 Ga0207657_10011803 Ga0207657_1001180310 93
606 3300025921 Ga0207652_10063037 Ga0207652_100630374 93
607 3300025921 Ga0207652_11294252 Ga0207652_112942522 93
608 3300025929 Ga0207664_10269729 Ga0207664_102697294 93
609 3300025929 Ga0207664_10432326 Ga0207664_104323262 93
610 3300025929 Ga0207664_11472715 Ga0207664_114727151 93
611 3300025932 Ga0207690_10660376 Ga0207690_106603761 93
612 3300025944 Ga0207661_10335228 Ga0207661_103352283 93
613 3300026067 Ga0207678_10529584 Ga0207678_105295842 93
614 3300027907 Ga0207428_11242980 Ga0207428_112429801 93
615 3300037466 Ga0395898_0263849 Ga0395898_0263849_335_646 93
616 3300037471 Ga0395905_0992280 Ga0395905_0992280_408_719 93
617 3300044693 Ga0466961_0376196 Ga0466961_0376196_286_597 93
618 3300044693 Ga0466961_0456284 Ga0466961_0456284_428_748 93
619 3300044694 Ga0466963_0455271 Ga0466963_0455271_373_684 93
620 3300044694 Ga0466963_0900440 Ga0466963_0900440_40_360 93
621 3300044706 Ga0466964_0012342 Ga0466964_0012342_1706_2026 93
622 3300044706 Ga0466964_0259981 Ga0466964_0259981_206_517 93
623 3300044719 Ga0466971_0029827 Ga0466971_0029827_1522_1842 93
624 3300044719 Ga0466971_0160720 Ga0466971_0160720_548_859 93
625 3300044735 Ga0466968_0216570 Ga0466968_0216570_559_879 93
626 3300045836 Ga0466958_0087483 Ga0466958_0087483_415_726 93
627 3300045836 Ga0466958_0172170 Ga0466958_0172170_390_710 93
628 3300045976 Ga0466967_0000047 Ga0466967_0000047_19770_20081 93
629 3300045976 Ga0466967_0344547 Ga0466967_0344547_381_692 93
630 3300046543 Ga0495645_0394003 Ga0495645_0394003_118_429 93
631 3300046675 Ga0495657_0358762 Ga0495657_0358762_300_611 93
632 3300048918 Ga0496115_0591165 Ga0496115_0591165_49_360 93
633 3300049576 Ga0501040_0311879 Ga0501040_0311879_730_1041 93
634 3300049576 Ga0501040_0385919 Ga0501040_0385919_316_627 93
635 3300049580 Ga0501046_0827389 Ga0501046_0827389_44_355 93
636 3300049587 Ga0501071_0064023 Ga0501071_0064023_517_828 93
637 3300049587 Ga0501071_0314695 Ga0501071_0314695_853_1164 93
638 3300049588 Ga0501072_0489856 Ga0501072_0489856_198_509 93
639 3300049591 Ga0501075_0294822 Ga0501075_0294822_469_780 93
640 3300049591 Ga0501075_0430212 Ga0501075_0430212_46_357 93
641 3300049592 Ga0501076_0283778 Ga0501076_0283778_381_692 93
642 3300049741 Ga0501079_0149033 Ga0501079_0149033_824_1135 93
643 3300049741 Ga0501079_0150533 Ga0501079_0150533_1160_1471 93
644 3300049742 Ga0501080_1469891 Ga0501080_1469891_158_469 93
645 3300049743 Ga0501081_0263738 Ga0501081_0263738_442_753 93
646 3300049822 Ga0501035_0600197 Ga0501035_0600197_180_491 93
647 3300049824 Ga0501045_0086269 Ga0501045_0086269_741_1052 93
648 3300050511 nmdc:mga08y16_1480483_c1 nmdc:mga08y16_1480483_c1_268_579 93
649 3300053078 Ga0495612_0441465 Ga0495612_0441465_148_459 93
650 3300059505 Ga0587083_0206411 Ga0587083_0206411_106_417 93
651 3300059647 Ga0587079_193845 Ga0587079_193845_165_476 93
652 3300060353 Ga0501082_0227616 Ga0501082_0227616_643_954 93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2zvs-assembly1.cif.gz_A crystal structure of the 2[4fe-4s] ferredoxin from escherichia coli 0.8224 17 43
1h98-assembly1.cif.gz_A new insights into thermostability of bacterial ferredoxins: high resolution crystal structure of the seven-iron ferredoxin from thermus thermophilus 0.7259 7 62
3or1-assembly1.cif.gz_D crystal structure of dissimilatory sulfite reductase i (dsri) 0.7076 18 45
2xsj-assembly1.cif.gz_D structure of desulforubidin from desulfomicrobium norvegicum 0.6987 11 45
1fdn-assembly1.cif.gz_A refined crystal structure of the 2[4fe-4s] ferredoxin from clostridium acidurici at 1.84 angstroms resolution 0.6893 15 52
ID Description Score Start End Superfamily
1h98A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7259 7 62 3.30.70.20
1fcaA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.6876 16 52 3.30.70.20
2v4jA04 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.6851 18 45 3.30.70.20
af_O50433_2_106_3.30.70.20 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.6734 2 62 3.30.70.20
1bd6A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.6642 3 65 3.30.70.20
ID Description Score Start End GO Terms
AF-A0A7W1JHG4-F1-model_v4 Ferredoxin 0.9004 16 92 GO:0009055
GO:0046872
GO:0051538
GO:0051539
AF-A0A2N1UPJ6-F1-model_v4 Ferredoxin 0.825 17 45 GO:0046872
GO:0051536
AF-A0A7G9WBM1-F1-model_v4 Aldo/keto reductase 0.7924 17 45 GO:0005829
GO:0016491
GO:0046872
GO:0051536
AF-A0A645G770-F1-model_v4 4Fe-4S ferredoxin-type domain-containing protein 0.7855 16 45
AF-A0A7W1JHG4-F1-model_v4 Ferredoxin 0.7849 16 92 GO:0009055
GO:0046872
GO:0051538
GO:0051539

Feature Viewer

pLDDT pTM Quality
67.3 0.59 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map