F472682
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 652 | 315 | 617 | 402 |
Family's Representative Sequence
| Representative Sequence | 3300009147|Ga0114129_10183624|Ga0114129_101836243 |
| Length | 454 |
| Sequence | MAIHSRAFRTLADCAFRGKPGTAKAGRPPVRRRFLEAIRRMPFLTANDRYIGKLVLVPMLGTFVLAASLLILDKMLRLFDFVASEGGPVGVVFRMLANLIPEYAGLAIPIGLMLGILLAFRKLATSSELDVMRAVGLSYTRLLRVPYIFALILAGLNLVNVFYLQPLSHYYYEALQYELRSGALGAAIKVGEFTTLKDKVALRIEESAENGRKLSGIFARVANDKGQVLAISARQGQFLANKDSPDTIILRLTDGQIVQDGPKLATPRVLTFSSHDLPIDLPKIEEFRQRGGKEKEYILPELLKLGWNKASPAALRNETQASFSYRMVEVVMMLLLPLMAVALAIPPKRSTSALGVFVSIIMVVAYHKVNQYASDVAALGRLDPILALWVPFAVFAALIVWMYWRVAYVPGGQAIGGLERGFAKLSATFRKLFGRKRLPDEPELDEFEGQPVAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2599185354 | Sphingomonas sp. NFR15 | Isolate | Rhizoplane |
| 3 | 2643221563 | Sphingopyxis sp. Root154 | Isolate | Unclassified |
| 4 | 2643221588 | Altererythrobacter sp. Root672 | Isolate | Unclassified |
| 5 | 2643221608 | Sphingopyxis sp. Root214 | Isolate | Unclassified |
| 6 | 2738541275 | Novosphingobium sp. GV027 | Isolate | Unclassified |
| 7 | 2738541301 | Novosphingobium sp. GV079 | Isolate | Unclassified |
| 8 | 2738541304 | Novosphingobium sp. GV061 | Isolate | Unclassified |
| 9 | 2738543022 | Novosphingobium sp. GV055 | Isolate | Unclassified |
| 10 | 2738543033 | Novosphingobium sp. GV064 | Isolate | Unclassified |
| 11 | 2739367664 | Novosphingobium sp. GV002 | Isolate | Unclassified |
| 12 | 2739367865 | Novosphingobium sp. GV013 | Isolate | Unclassified |
| 13 | 2751185897 | Sphingomonas panacis DCY99 | Isolate | Unclassified |
| 14 | 2818991438 | Novosphingobium barchaimii 1192 | Isolate | Unclassified |
| 15 | 2830075706 | Sphingomonas jinjuensis DSM 21457 | Isolate | Rhizosphere |
| 16 | 2848297114 | Croceibacterium ferulae EGI 63111 | Isolate | Unclassified |
| 17 | 2852653556 | Sphingopyxis sp. JAI108 | Isolate | Rhizosphere |
| 18 | 2852680915 | Sphingopyxis sp. JAI128 | Isolate | Rhizosphere |
| 19 | 2882806704 | Pelagerythrobacter rhizovicinus AY-3R | Isolate | Rhizosphere |
| 20 | 2885429604 | Sphingomonas sp. WZY 27 | Isolate | Rhizosphere |
| 21 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 22 | 2896184354 | Aurantiacibacter suaedae GH3-15 | Isolate | Rhizosphere |
| 23 | 2896253425 | Aurantiacibacter rhizosphaerae GH3-10 | Isolate | Rhizosphere |
| 24 | 2919138771 | Novosphingobium sp. 1748 | Isolate | Rhizosphere |
| 25 | 2928027323 | Sphingomonas sp. 1185 | Isolate | Unclassified |
| 26 | 2928100450 | Novosphingobium sp. 1529 | Isolate | Rhizosphere |
| 27 | 2928959182 | Novosphingobium capsulatum 1057 | Isolate | Unclassified |
| 28 | 2946787523 | Sphingomonas faeni W4I17 | Isolate | Rhizosphere |
| 29 | 2984555340 | Sphingomonas sp. SORGH_AS789 | Isolate | Aerial Root |
| 30 | 2984564862 | Sphingomonas sp. SORGH_AS870 | Isolate | Aerial Root |
| 31 | 2990265787 | Sphingomonas sp. SORGH_AS802 | Isolate | Aerial Root |
| 32 | 2993356040 | Sphingomonas sp. SORGH_AS742 | Isolate | Aerial Root |
| 33 | 2993693658 | Sphingomonas sp. SORGH_AS438 | Isolate | Aerial Root |
| 34 | 3000865235 | Altericroceibacterium indicum DSM 18604 | Isolate | Rhizosphere |
| 35 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 36 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 37 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 38 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 39 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 40 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 41 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 42 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 43 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 44 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 45 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 46 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 47 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 48 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 49 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 52 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 54 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 68 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 69 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 70 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 71 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 72 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 75 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 77 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 78 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 79 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 80 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 81 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 82 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 83 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 84 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 85 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 86 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 87 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 88 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 89 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 90 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 91 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 92 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 93 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 94 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 95 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 97 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 98 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 99 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 101 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 115 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 131 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 186 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 187 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 188 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 189 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 190 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 191 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 192 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 193 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 194 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 195 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 196 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 197 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 198 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 199 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 200 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 201 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 202 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 203 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 204 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 205 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 206 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 207 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 208 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 209 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 243 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 244 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 245 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 246 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 247 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 248 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 249 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 250 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 251 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 252 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 253 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 254 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 255 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 256 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 257 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 258 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 259 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 260 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 261 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 262 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 263 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 264 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 265 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 266 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 267 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 276 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 277 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 278 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 279 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 282 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 283 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 284 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 285 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 286 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 287 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 288 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 289 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 290 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 291 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 292 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 293 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 294 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 295 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 296 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 297 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 298 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 299 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 300 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 301 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 302 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 303 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 304 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 305 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 306 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 307 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 308 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 309 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 310 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 311 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 312 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 313 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 314 | 8054302542 | Novosphingobium kaempferiae Sx8-5 | Isolate | Rhizosphere |
| 315 | 8057101203 | Sphingomonas lycopersici MMSM20 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.63 |
| Metatranscriptomes | 0 |
| Isolates | 5.37 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.77 |
| Bulb | 0 |
| Endosphere | 14.88 |
| Nodule | 0.15 |
| Rhizoplane | 3.99 |
| Rhizosphere | 69.02 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.2 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_2139679 | 2162886007 | Bacteria | 32324 |
| 2 | JGI24740J21852_10007561 | 3300001979 | Bacteria | 4401 |
| 3 | JGI24739J22299_10008795 | 3300001989 | Bacteria | 3766 |
| 4 | JGI24737J22298_10000905 | 3300001990 | Bacteria | 10542 |
| 5 | JGI24751J29686_10000084 | 3300002459 | Bacteria | 52362 |
| 6 | JGI24751J29686_10000279 | 3300002459 | Bacteria | 19854 |
| 7 | JGI25165J46597_1000012 | 3300003214 | Bacteria | 421074 |
| 8 | Ga0055525_1000012 | 3300003759 | Bacteria | 486564 |
| 9 | Ga0055542_1000355 | 3300003762 | Bacteria | 48043 |
| 10 | Ga0055529_1000045 | 3300003763 | Bacteria | 209617 |
| 11 | Ga0055536_1002179 | 3300003781 | Bacteria | 11164 |
| 12 | Ga0055536_1004597 | 3300003781 | Bacteria | 6995 |
| 13 | Ga0055530_10002097 | 3300003791 | Bacteria | 13320 |
| 14 | Ga0055531_10019563 | 3300003794 | Bacteria | 2732 |
| 15 | Ga0065165_1005037 | 3300005262 | Bacteria | 7720 |
| 16 | Ga0065704_10001580 | 3300005289 | Bacteria | 14798 |
| 17 | Ga0065704_10070184 | 3300005289 | Bacteria | 119655 |
| 18 | Ga0065704_10083691 | 3300005289 | Bacteria | 3431 |
| 19 | Ga0065704_10084596 | 3300005289 | Bacteria | 3318 |
| 20 | Ga0065704_10155604 | 3300005289 | Bacteria | 1393 |
| 21 | Ga0065707_10084966 | 3300005295 | Bacteria | 6594 |
| 22 | Ga0065707_10096660 | 3300005295 | Bacteria | 3247 |
| 23 | Ga0070658_10000144 | 3300005327 | Bacteria | 63113 |
| 24 | Ga0070658_10001571 | 3300005327 | Bacteria | 19350 |
| 25 | Ga0070658_10010285 | 3300005327 | Bacteria | 7504 |
| 26 | Ga0070658_10014487 | 3300005327 | Bacteria | 6327 |
| 27 | Ga0070658_10016667 | 3300005327 | Bacteria | 5881 |
| 28 | Ga0070658_10108164 | 3300005327 | Bacteria | 2301 |
| 29 | Ga0070683_100003226 | 3300005329 | Bacteria | 13165 |
| 30 | Ga0070690_100045048 | 3300005330 | Bacteria | 2801 |
| 31 | Ga0070670_100054077 | 3300005331 | Bacteria | 3446 |
| 32 | Ga0070670_100079503 | 3300005331 | Bacteria | 2818 |
| 33 | Ga0068869_100084489 | 3300005334 | Bacteria | 2376 |
| 34 | Ga0070680_100007121 | 3300005336 | Bacteria | 8522 |
| 35 | Ga0070680_100010656 | 3300005336 | Bacteria | 7092 |
| 36 | Ga0070660_100002160 | 3300005339 | Bacteria | 13552 |
| 37 | Ga0070660_100033442 | 3300005339 | Bacteria | 3876 |
| 38 | Ga0070660_100093279 | 3300005339 | Bacteria | 2377 |
| 39 | Ga0070660_100207781 | 3300005339 | Bacteria | 1589 |
| 40 | Ga0070661_100001061 | 3300005344 | Bacteria | 19494 |
| 41 | Ga0070661_100011035 | 3300005344 | Bacteria | 6294 |
| 42 | Ga0070668_100000650 | 3300005347 | Bacteria | 23492 |
| 43 | Ga0070668_100016290 | 3300005347 | Bacteria | 5559 |
| 44 | Ga0070668_100095230 | 3300005347 | Bacteria | 2352 |
| 45 | Ga0070668_100152206 | 3300005347 | Bacteria | 1871 |
| 46 | Ga0070669_100000139 | 3300005353 | Bacteria | 64859 |
| 47 | Ga0070669_100002049 | 3300005353 | Bacteria | 14579 |
| 48 | Ga0070669_100005390 | 3300005353 | Bacteria | 9227 |
| 49 | Ga0070671_100001672 | 3300005355 | Bacteria | 16786 |
| 50 | Ga0070671_100010917 | 3300005355 | Bacteria | 7295 |
| 51 | Ga0070671_100019173 | 3300005355 | Bacteria | 5565 |
| 52 | Ga0070674_100034152 | 3300005356 | Bacteria | 3394 |
| 53 | Ga0070674_100262863 | 3300005356 | Bacteria | 1360 |
| 54 | Ga0070659_100008276 | 3300005366 | Bacteria | 7594 |
| 55 | Ga0070659_100010584 | 3300005366 | Bacteria | 6792 |
| 56 | Ga0070659_100088796 | 3300005366 | Bacteria | 2476 |
| 57 | Ga0070659_100092449 | 3300005366 | Bacteria | 2426 |
| 58 | Ga0070667_100000281 | 3300005367 | Bacteria | 58155 |
| 59 | Ga0070667_100002441 | 3300005367 | Bacteria | 16246 |
| 60 | Ga0070667_100005899 | 3300005367 | Bacteria | 10197 |
| 61 | Ga0070667_100046664 | 3300005367 | Bacteria | 3645 |
| 62 | Ga0070667_100209069 | 3300005367 | Bacteria | 1734 |
| 63 | Ga0070714_100102887 | 3300005435 | Bacteria | 2519 |
| 64 | Ga0070663_100004975 | 3300005455 | Bacteria | 7848 |
| 65 | Ga0070678_100000495 | 3300005456 | Bacteria | 18911 |
| 66 | Ga0070662_100001696 | 3300005457 | Bacteria | 13542 |
| 67 | Ga0070662_100022716 | 3300005457 | Bacteria | 4298 |
| 68 | Ga0070662_100102594 | 3300005457 | Bacteria | 2168 |
| 69 | Ga0070681_10005920 | 3300005458 | Bacteria | 11833 |
| 70 | Ga0068867_100009199 | 3300005459 | Bacteria | 6974 |
| 71 | Ga0070679_100004469 | 3300005530 | Bacteria | 12915 |
| 72 | Ga0070679_100015815 | 3300005530 | Bacteria | 7259 |
| 73 | Ga0070679_100020119 | 3300005530 | Bacteria | 6504 |
| 74 | Ga0070684_100029316 | 3300005535 | Bacteria | 4662 |
| 75 | Ga0068853_100008054 | 3300005539 | Bacteria | 8451 |
| 76 | Ga0068853_100020273 | 3300005539 | Bacteria | 5528 |
| 77 | Ga0068853_100111428 | 3300005539 | Bacteria | 2431 |
| 78 | Ga0070672_100169697 | 3300005543 | Bacteria | 1814 |
| 79 | Ga0070665_100000101 | 3300005548 | Bacteria | 159353 |
| 80 | Ga0070665_100001723 | 3300005548 | Bacteria | 25051 |
| 81 | Ga0070665_100008606 | 3300005548 | Bacteria | 10325 |
| 82 | Ga0068855_100004017 | 3300005563 | Bacteria | 17971 |
| 83 | Ga0068855_100016252 | 3300005563 | Bacteria | 8949 |
| 84 | Ga0068855_100032690 | 3300005563 | Bacteria | 6211 |
| 85 | Ga0068855_100073414 | 3300005563 | Bacteria | 3974 |
| 86 | Ga0070664_100026441 | 3300005564 | Bacteria | 4813 |
| 87 | Ga0070664_100038836 | 3300005564 | Bacteria | 4009 |
| 88 | Ga0070664_100041761 | 3300005564 | Bacteria | 3871 |
| 89 | Ga0068857_100136768 | 3300005577 | Bacteria | 2212 |
| 90 | Ga0068857_100193542 | 3300005577 | Bacteria | 1852 |
| 91 | Ga0068854_100037775 | 3300005578 | Bacteria | 3391 |
| 92 | Ga0068854_100100749 | 3300005578 | Bacteria | 2165 |
| 93 | Ga0068856_100018169 | 3300005614 | Bacteria | 6819 |
| 94 | Ga0068856_100049867 | 3300005614 | Bacteria | 4127 |
| 95 | Ga0068856_100157129 | 3300005614 | Bacteria | 2284 |
| 96 | Ga0068856_100241157 | 3300005614 | Bacteria | 1823 |
| 97 | Ga0068852_100000273 | 3300005616 | Bacteria | 34348 |
| 98 | Ga0068852_100006730 | 3300005616 | Bacteria | 8337 |
| 99 | Ga0068852_100103788 | 3300005616 | Bacteria | 2572 |
| 100 | Ga0068859_100010880 | 3300005617 | Bacteria | 9156 |
| 101 | Ga0068859_100029459 | 3300005617 | Bacteria | 5507 |
| 102 | Ga0068864_100108208 | 3300005618 | Bacteria | 2474 |
| 103 | Ga0068864_100160020 | 3300005618 | Bacteria | 2046 |
| 104 | Ga0068861_100000299 | 3300005719 | Bacteria | 27750 |
| 105 | Ga0068851_10009573 | 3300005834 | Bacteria | 4511 |
| 106 | Ga0068851_10018458 | 3300005834 | Bacteria | 3360 |
| 107 | Ga0068863_100000090 | 3300005841 | Bacteria | 100887 |
| 108 | Ga0068863_100004231 | 3300005841 | Bacteria | 14171 |
| 109 | Ga0068863_100017402 | 3300005841 | Bacteria | 6891 |
| 110 | Ga0068863_100172959 | 3300005841 | Bacteria | 2072 |
| 111 | Ga0068858_100000472 | 3300005842 | Bacteria | 41922 |
| 112 | Ga0068858_100001618 | 3300005842 | Bacteria | 22973 |
| 113 | Ga0068858_100003262 | 3300005842 | Bacteria | 16173 |
| 114 | Ga0068858_100057331 | 3300005842 | Bacteria | 3600 |
| 115 | Ga0068860_100000089 | 3300005843 | Bacteria | 152667 |
| 116 | Ga0068860_100011153 | 3300005843 | Bacteria | 8857 |
| 117 | Ga0068860_100012804 | 3300005843 | Bacteria | 8247 |
| 118 | Ga0068862_100004597 | 3300005844 | Bacteria | 11629 |
| 119 | Ga0068862_100028918 | 3300005844 | Bacteria | 4668 |
| 120 | Ga0068862_100037541 | 3300005844 | Bacteria | 4106 |
| 121 | Ga0075368_10004412 | 3300006042 | Bacteria | 4769 |
| 122 | Ga0075364_10020007 | 3300006051 | Bacteria | 4208 |
| 123 | Ga0075364_10034149 | 3300006051 | Bacteria | 3280 |
| 124 | Ga0075364_10216796 | 3300006051 | Bacteria | 1298 |
| 125 | Ga0075432_10001768 | 3300006058 | Bacteria | 7115 |
| 126 | Ga0075362_10004550 | 3300006177 | Bacteria | 4997 |
| 127 | Ga0075362_10010458 | 3300006177 | Bacteria | 3624 |
| 128 | Ga0075362_10076030 | 3300006177 | Bacteria | 1541 |
| 129 | Ga0075367_10002649 | 3300006178 | Bacteria | 8240 |
| 130 | Ga0075369_10008054 | 3300006186 | Bacteria | 4040 |
| 131 | Ga0075366_10004768 | 3300006195 | Bacteria | 7313 |
| 132 | Ga0075366_10009143 | 3300006195 | Bacteria | 5525 |
| 133 | Ga0075366_10011463 | 3300006195 | Bacteria | 5007 |
| 134 | Ga0097621_100025030 | 3300006237 | Bacteria | 4666 |
| 135 | Ga0075370_10001111 | 3300006353 | Bacteria | 11259 |
| 136 | Ga0075370_10003188 | 3300006353 | Bacteria | 7764 |
| 137 | Ga0075370_10016709 | 3300006353 | Bacteria | 3951 |
| 138 | Ga0075370_10017832 | 3300006353 | Bacteria | 3841 |
| 139 | Ga0075370_10028082 | 3300006353 | Bacteria | 3126 |
| 140 | Ga0075370_10099532 | 3300006353 | Bacteria | 1682 |
| 141 | Ga0068871_100088604 | 3300006358 | Bacteria | 2575 |
| 142 | Ga0068865_100108501 | 3300006881 | Bacteria | 2043 |
| 143 | Ga0097620_100010880 | 3300006931 | Bacteria | 9156 |
| 144 | Ga0097620_100029459 | 3300006931 | Bacteria | 5507 |
| 145 | Ga0079104_1014634 | 3300006946 | Bacteria | 2359 |
| 146 | Ga0105251_10001250 | 3300009011 | Bacteria | 22028 |
| 147 | Ga0105240_10001369 | 3300009093 | Bacteria | 41902 |
| 148 | Ga0105240_10001848 | 3300009093 | Bacteria | 35437 |
| 149 | Ga0105240_10248869 | 3300009093 | Bacteria | 2057 |
| 150 | Ga0105245_10001108 | 3300009098 | Bacteria | 24360 |
| 151 | Ga0105247_10010323 | 3300009101 | Bacteria | 5649 |
| 152 | Ga0105247_10035453 | 3300009101 | Bacteria | 3041 |
| 153 | Ga0105247_10045856 | 3300009101 | Bacteria | 2683 |
| 154 | Ga0114129_10183624 | 3300009147 | Bacteria | 2845 |
| 155 | Ga0105243_10000423 | 3300009148 | Bacteria | 44393 |
| 156 | Ga0105243_10013621 | 3300009148 | Bacteria | 6151 |
| 157 | Ga0105243_10150418 | 3300009148 | Bacteria | 1996 |
| 158 | Ga0105241_10069590 | 3300009174 | Bacteria | 2729 |
| 159 | Ga0105248_10001023 | 3300009177 | Bacteria | 30929 |
| 160 | Ga0105248_10013624 | 3300009177 | Bacteria | 8950 |
| 161 | Ga0105248_10184415 | 3300009177 | Bacteria | 2352 |
| 162 | Ga0105237_10002266 | 3300009545 | Bacteria | 23934 |
| 163 | Ga0105238_10084215 | 3300009551 | Bacteria | 3169 |
| 164 | Ga0105238_10183084 | 3300009551 | Bacteria | 2071 |
| 165 | Ga0105249_10022999 | 3300009553 | Bacteria | 5588 |
| 166 | Ga0105249_10163607 | 3300009553 | Bacteria | 2152 |
| 167 | Ga0105239_10009734 | 3300010375 | Bacteria | 10805 |
| 168 | Ga0105239_10059536 | 3300010375 | Bacteria | 4192 |
| 169 | Ga0105239_10135119 | 3300010375 | Bacteria | 2746 |
| 170 | Ga0105246_10000354 | 3300011119 | Bacteria | 24700 |
| 171 | Ga0157326_1001490 | 3300012513 | Bacteria | 2581 |
| 172 | Ga0157373_10005198 | 3300013100 | Bacteria | 9779 |
| 173 | Ga0157373_10009265 | 3300013100 | Bacteria | 7278 |
| 174 | Ga0157371_10000032 | 3300013102 | Bacteria | 230252 |
| 175 | Ga0157371_10001531 | 3300013102 | Bacteria | 23797 |
| 176 | Ga0157371_10033776 | 3300013102 | Bacteria | 3674 |
| 177 | Ga0157370_10004317 | 3300013104 | Bacteria | 16341 |
| 178 | Ga0157370_10163395 | 3300013104 | Bacteria | 2071 |
| 179 | Ga0157369_10002247 | 3300013105 | Bacteria | 23225 |
| 180 | Ga0157369_10065036 | 3300013105 | Bacteria | 3927 |
| 181 | Ga0157374_10015473 | 3300013296 | Bacteria | 6691 |
| 182 | Ga0157374_10062137 | 3300013296 | Bacteria | 3500 |
| 183 | Ga0157378_10193513 | 3300013297 | Bacteria | 1920 |
| 184 | Ga0163162_10027215 | 3300013306 | Bacteria | 5654 |
| 185 | Ga0163162_10086963 | 3300013306 | Bacteria | 3204 |
| 186 | Ga0157372_10004467 | 3300013307 | Bacteria | 14925 |
| 187 | Ga0157375_10430563 | 3300013308 | Bacteria | 1485 |
| 188 | Ga0163161_10135562 | 3300017792 | Bacteria | 1861 |
| 189 | Ga0209563_100030 | 3300025230 | Bacteria | 489259 |
| 190 | Ga0209677_107661 | 3300025253 | Bacteria | 2243 |
| 191 | Ga0209148_1000011 | 3300025254 | Bacteria | 1196503 |
| 192 | Ga0209233_1000058 | 3300025261 | Bacteria | 421872 |
| 193 | Ga0209455_1000006 | 3300025272 | Bacteria | 1196503 |
| 194 | Ga0209675_1000075 | 3300025291 | Bacteria | 161623 |
| 195 | Ga0209676_1000081 | 3300025292 | Bacteria | 285297 |
| 196 | Ga0209676_1000769 | 3300025292 | Bacteria | 42909 |
| 197 | Ga0209676_1000949 | 3300025292 | Bacteria | 35497 |
| 198 | Ga0209758_1000001 | 3300025297 | Bacteria | 1981790 |
| 199 | Ga0209050_1000017 | 3300025298 | Bacteria | 728928 |
| 200 | Ga0209050_1000127 | 3300025298 | Bacteria | 187951 |
| 201 | Ga0209050_1003650 | 3300025298 | Bacteria | 11122 |
| 202 | Ga0209257_1000206 | 3300025304 | Bacteria | 142184 |
| 203 | Ga0209257_1001326 | 3300025304 | Bacteria | 30099 |
| 204 | Ga0209257_1001697 | 3300025304 | Bacteria | 24737 |
| 205 | Ga0209257_1009938 | 3300025304 | Bacteria | 4949 |
| 206 | Ga0207656_10000378 | 3300025321 | Bacteria | 14923 |
| 207 | Ga0207696_1002899 | 3300025711 | Bacteria | 8073 |
| 208 | Ga0207713_1003912 | 3300025735 | Bacteria | 9909 |
| 209 | Ga0207713_1005617 | 3300025735 | Bacteria | 7800 |
| 210 | Ga0207710_10015220 | 3300025900 | Bacteria | 3249 |
| 211 | Ga0207688_10085086 | 3300025901 | Bacteria | 1811 |
| 212 | Ga0207680_10136692 | 3300025903 | Bacteria | 1621 |
| 213 | Ga0207647_10013331 | 3300025904 | Bacteria | 5704 |
| 214 | Ga0207647_10051147 | 3300025904 | Bacteria | 2555 |
| 215 | Ga0207705_10000155 | 3300025909 | Bacteria | 73779 |
| 216 | Ga0207705_10000637 | 3300025909 | Bacteria | 29343 |
| 217 | Ga0207705_10006619 | 3300025909 | Bacteria | 8575 |
| 218 | Ga0207705_10009600 | 3300025909 | Bacteria | 7037 |
| 219 | Ga0207705_10011018 | 3300025909 | Bacteria | 6561 |
| 220 | Ga0207654_10005404 | 3300025911 | Bacteria | 6460 |
| 221 | Ga0207707_10065315 | 3300025912 | Bacteria | 3170 |
| 222 | Ga0207695_10000288 | 3300025913 | Bacteria | 125085 |
| 223 | Ga0207695_10015610 | 3300025913 | Bacteria | 8933 |
| 224 | Ga0207695_10052359 | 3300025913 | Bacteria | 4277 |
| 225 | Ga0207671_10002453 | 3300025914 | Bacteria | 19840 |
| 226 | Ga0207671_10008049 | 3300025914 | Bacteria | 9011 |
| 227 | Ga0207660_10005603 | 3300025917 | Bacteria | 8153 |
| 228 | Ga0207657_10001083 | 3300025919 | Bacteria | 28850 |
| 229 | Ga0207657_10007801 | 3300025919 | Bacteria | 10926 |
| 230 | Ga0207657_10016392 | 3300025919 | Bacteria | 7149 |
| 231 | Ga0207657_10095609 | 3300025919 | Bacteria | 2472 |
| 232 | Ga0207657_10142261 | 3300025919 | Bacteria | 1959 |
| 233 | Ga0207649_10000482 | 3300025920 | Bacteria | 28301 |
| 234 | Ga0207652_10002246 | 3300025921 | Bacteria | 16436 |
| 235 | Ga0207652_10005534 | 3300025921 | Bacteria | 10240 |
| 236 | Ga0207652_10026805 | 3300025921 | Bacteria | 4803 |
| 237 | Ga0207652_10241189 | 3300025921 | Bacteria | 1630 |
| 238 | Ga0207681_10000179 | 3300025923 | Bacteria | 52003 |
| 239 | Ga0207681_10000467 | 3300025923 | Bacteria | 28346 |
| 240 | Ga0207681_10002731 | 3300025923 | Bacteria | 11173 |
| 241 | Ga0207681_10038828 | 3300025923 | Bacteria | 3157 |
| 242 | Ga0207694_10024085 | 3300025924 | Bacteria | 4622 |
| 243 | Ga0207694_10038986 | 3300025924 | Bacteria | 3654 |
| 244 | Ga0207687_10000853 | 3300025927 | Bacteria | 20620 |
| 245 | Ga0207644_10000004 | 3300025931 | Bacteria | 566613 |
| 246 | Ga0207644_10001696 | 3300025931 | Bacteria | 14214 |
| 247 | Ga0207644_10009126 | 3300025931 | Bacteria | 6502 |
| 248 | Ga0207644_10093244 | 3300025931 | Bacteria | 2248 |
| 249 | Ga0207690_10000506 | 3300025932 | Bacteria | 25280 |
| 250 | Ga0207690_10000696 | 3300025932 | Bacteria | 21652 |
| 251 | Ga0207690_10078656 | 3300025932 | Bacteria | 2296 |
| 252 | Ga0207690_10094020 | 3300025932 | Bacteria | 2126 |
| 253 | Ga0207706_10002162 | 3300025933 | Bacteria | 19198 |
| 254 | Ga0207709_10000727 | 3300025935 | Bacteria | 26397 |
| 255 | Ga0207709_10046285 | 3300025935 | Bacteria | 2639 |
| 256 | Ga0207669_10000416 | 3300025937 | Bacteria | 18639 |
| 257 | Ga0207711_10000912 | 3300025941 | Bacteria | 28443 |
| 258 | Ga0207711_10004180 | 3300025941 | Bacteria | 12361 |
| 259 | Ga0207711_10008551 | 3300025941 | Bacteria | 8561 |
| 260 | Ga0207711_10100579 | 3300025941 | Bacteria | 2557 |
| 261 | Ga0207689_10075817 | 3300025942 | Bacteria | 2765 |
| 262 | Ga0207661_10004071 | 3300025944 | Bacteria | 10209 |
| 263 | Ga0207661_10124085 | 3300025944 | Bacteria | 2203 |
| 264 | Ga0207679_10026833 | 3300025945 | Bacteria | 3976 |
| 265 | Ga0207679_10055487 | 3300025945 | Bacteria | 2921 |
| 266 | Ga0207679_10057954 | 3300025945 | Bacteria | 2867 |
| 267 | Ga0207667_10000002 | 3300025949 | Bacteria | 895662 |
| 268 | Ga0207667_10005551 | 3300025949 | Bacteria | 15392 |
| 269 | Ga0207667_10009448 | 3300025949 | Bacteria | 11482 |
| 270 | Ga0207667_10087386 | 3300025949 | Bacteria | 3225 |
| 271 | Ga0207667_10293038 | 3300025949 | Bacteria | 1662 |
| 272 | Ga0207712_10031707 | 3300025961 | Bacteria | 3562 |
| 273 | Ga0207668_10000523 | 3300025972 | Bacteria | 24025 |
| 274 | Ga0207668_10062746 | 3300025972 | Bacteria | 2618 |
| 275 | Ga0207640_10000586 | 3300025981 | Bacteria | 21662 |
| 276 | Ga0207640_10040599 | 3300025981 | Bacteria | 2953 |
| 277 | Ga0207640_10049196 | 3300025981 | Bacteria | 2728 |
| 278 | Ga0207640_10142937 | 3300025981 | Bacteria | 1747 |
| 279 | Ga0207658_10000415 | 3300025986 | Bacteria | 40532 |
| 280 | Ga0207658_10002340 | 3300025986 | Bacteria | 13922 |
| 281 | Ga0207658_10004466 | 3300025986 | Bacteria | 9722 |
| 282 | Ga0207658_10027744 | 3300025986 | Bacteria | 3981 |
| 283 | Ga0207703_10000568 | 3300026035 | Bacteria | 37997 |
| 284 | Ga0207703_10001318 | 3300026035 | Bacteria | 22824 |
| 285 | Ga0207639_10001972 | 3300026041 | Bacteria | 13796 |
| 286 | Ga0207639_10004061 | 3300026041 | Bacteria | 9874 |
| 287 | Ga0207639_10006007 | 3300026041 | Bacteria | 8235 |
| 288 | Ga0207678_10020590 | 3300026067 | Bacteria | 5784 |
| 289 | Ga0207678_10030203 | 3300026067 | Bacteria | 4730 |
| 290 | Ga0207678_10045630 | 3300026067 | Bacteria | 3789 |
| 291 | Ga0207678_10163478 | 3300026067 | Bacteria | 1901 |
| 292 | Ga0207702_10013356 | 3300026078 | Bacteria | 6829 |
| 293 | Ga0207702_10017889 | 3300026078 | Bacteria | 5866 |
| 294 | Ga0207702_10045051 | 3300026078 | Bacteria | 3711 |
| 295 | Ga0207702_10076672 | 3300026078 | Bacteria | 2890 |
| 296 | Ga0207702_10273642 | 3300026078 | Bacteria | 1594 |
| 297 | Ga0207641_10000069 | 3300026088 | Bacteria | 154022 |
| 298 | Ga0207641_10011356 | 3300026088 | Bacteria | 7309 |
| 299 | Ga0207641_10017539 | 3300026088 | Bacteria | 5860 |
| 300 | Ga0207648_10010571 | 3300026089 | Bacteria | 8733 |
| 301 | Ga0207676_10013117 | 3300026095 | Bacteria | 5949 |
| 302 | Ga0207674_10004472 | 3300026116 | Bacteria | 16807 |
| 303 | Ga0207674_10013772 | 3300026116 | Bacteria | 8949 |
| 304 | Ga0207674_10031161 | 3300026116 | Bacteria | 5604 |
| 305 | Ga0207674_10041856 | 3300026116 | Bacteria | 4735 |
| 306 | Ga0207674_10049550 | 3300026116 | Bacteria | 4295 |
| 307 | Ga0207674_10085008 | 3300026116 | Bacteria | 3161 |
| 308 | Ga0207675_100000394 | 3300026118 | Bacteria | 41906 |
| 309 | Ga0207675_100188482 | 3300026118 | Bacteria | 1978 |
| 310 | Ga0207683_10033561 | 3300026121 | Bacteria | 4458 |
| 311 | Ga0207698_10000179 | 3300026142 | Bacteria | 38793 |
| 312 | Ga0207698_10005612 | 3300026142 | Bacteria | 7767 |
| 313 | Ga0207698_10011951 | 3300026142 | Bacteria | 5656 |
| 314 | Ga0207698_10035948 | 3300026142 | Bacteria | 3630 |
| 315 | Ga0207698_10255246 | 3300026142 | Bacteria | 1607 |
| 316 | Ga0209999_1004174 | 3300027543 | Bacteria | 2602 |
| 317 | Ga0209813_10000060 | 3300027866 | Bacteria | 44068 |
| 318 | Ga0209974_10001551 | 3300027876 | Bacteria | 8349 |
| 319 | Ga0209974_10004024 | 3300027876 | Bacteria | 5256 |
| 320 | Ga0268266_10000002 | 3300028379 | Bacteria | 3059047 |
| 321 | Ga0268266_10000239 | 3300028379 | Bacteria | 93395 |
| 322 | Ga0268266_10001120 | 3300028379 | Bacteria | 33444 |
| 323 | Ga0268266_10003468 | 3300028379 | Bacteria | 15735 |
| 324 | Ga0268265_10001670 | 3300028380 | Bacteria | 18127 |
| 325 | Ga0268265_10026456 | 3300028380 | Bacteria | 4128 |
| 326 | Ga0268265_10057401 | 3300028380 | Bacteria | 2966 |
| 327 | Ga0268265_10114509 | 3300028380 | Bacteria | 2209 |
| 328 | Ga0268264_10000160 | 3300028381 | Bacteria | 152653 |
| 329 | Ga0268264_10011204 | 3300028381 | Bacteria | 7406 |
| 330 | Ga0307517_10014999 | 3300028786 | Bacteria | 10336 |
| 331 | Ga0307517_10015806 | 3300028786 | Bacteria | 9988 |
| 332 | Ga0265327_10020461 | 3300031251 | Bacteria | 4030 |
| 333 | Ga0307513_10006540 | 3300031456 | Bacteria | 15221 |
| 334 | Ga0307509_10098666 | 3300031507 | Bacteria | 2965 |
| 335 | Ga0307408_100021871 | 3300031548 | Bacteria | 4336 |
| 336 | Ga0307408_100022756 | 3300031548 | Bacteria | 4262 |
| 337 | Ga0307408_100115582 | 3300031548 | Bacteria | 2069 |
| 338 | Ga0307508_10001821 | 3300031616 | Bacteria | 23580 |
| 339 | Ga0307405_10001326 | 3300031731 | Bacteria | 10369 |
| 340 | Ga0307405_10002903 | 3300031731 | Bacteria | 7719 |
| 341 | Ga0307405_10014694 | 3300031731 | Bacteria | 4218 |
| 342 | Ga0307405_10015282 | 3300031731 | Bacteria | 4154 |
| 343 | Ga0307405_10049956 | 3300031731 | Bacteria | 2587 |
| 344 | Ga0307405_10196817 | 3300031731 | Bacteria | 1460 |
| 345 | Ga0307405_10225175 | 3300031731 | Bacteria | 1379 |
| 346 | Ga0307413_10004766 | 3300031824 | Bacteria | 5955 |
| 347 | Ga0307413_10005384 | 3300031824 | Bacteria | 5708 |
| 348 | Ga0307413_10031139 | 3300031824 | Bacteria | 3006 |
| 349 | Ga0307413_10090385 | 3300031824 | Bacteria | 1992 |
| 350 | Ga0307413_10137532 | 3300031824 | Bacteria | 1682 |
| 351 | Ga0307410_10002075 | 3300031852 | Bacteria | 9485 |
| 352 | Ga0307410_10017407 | 3300031852 | Bacteria | 4315 |
| 353 | Ga0307410_10046303 | 3300031852 | Bacteria | 2901 |
| 354 | Ga0307410_10109452 | 3300031852 | Bacteria | 1997 |
| 355 | Ga0307406_10006711 | 3300031901 | Bacteria | 6364 |
| 356 | Ga0307406_10014163 | 3300031901 | Bacteria | 4583 |
| 357 | Ga0307406_10027877 | 3300031901 | Bacteria | 3407 |
| 358 | Ga0307406_10060877 | 3300031901 | Bacteria | 2436 |
| 359 | Ga0307407_10001621 | 3300031903 | Bacteria | 8317 |
| 360 | Ga0307407_10034315 | 3300031903 | Bacteria | 2776 |
| 361 | Ga0307412_10007151 | 3300031911 | Bacteria | 6336 |
| 362 | Ga0307412_10010045 | 3300031911 | Bacteria | 5444 |
| 363 | Ga0307412_10012945 | 3300031911 | Bacteria | 4877 |
| 364 | Ga0307412_10019157 | 3300031911 | Bacteria | 4136 |
| 365 | Ga0307412_10023165 | 3300031911 | Bacteria | 3817 |
| 366 | Ga0307412_10041123 | 3300031911 | Bacteria | 2994 |
| 367 | Ga0307412_10119984 | 3300031911 | Bacteria | 1892 |
| 368 | Ga0307409_100001109 | 3300031995 | Bacteria | 12731 |
| 369 | Ga0307409_100006854 | 3300031995 | Bacteria | 6749 |
| 370 | Ga0307409_100271799 | 3300031995 | Bacteria | 1561 |
| 371 | Ga0307416_100002227 | 3300032002 | Bacteria | 11030 |
| 372 | Ga0307416_100017737 | 3300032002 | Bacteria | 4991 |
| 373 | Ga0307416_100085284 | 3300032002 | Bacteria | 2687 |
| 374 | Ga0307416_100309466 | 3300032002 | Bacteria | 1575 |
| 375 | Ga0307414_10003379 | 3300032004 | Bacteria | 8521 |
| 376 | Ga0307414_10012232 | 3300032004 | Bacteria | 5065 |
| 377 | Ga0307414_10013483 | 3300032004 | Bacteria | 4868 |
| 378 | Ga0307414_10038785 | 3300032004 | Bacteria | 3202 |
| 379 | Ga0307414_10042959 | 3300032004 | Bacteria | 3075 |
| 380 | Ga0307414_10067599 | 3300032004 | Bacteria | 2561 |
| 381 | Ga0307414_10092926 | 3300032004 | Bacteria | 2247 |
| 382 | Ga0307414_10144064 | 3300032004 | Bacteria | 1869 |
| 383 | Ga0307414_10180773 | 3300032004 | Bacteria | 1696 |
| 384 | Ga0307411_10002755 | 3300032005 | Bacteria | 7900 |
| 385 | Ga0307411_10005204 | 3300032005 | Bacteria | 6365 |
| 386 | Ga0307411_10007939 | 3300032005 | Bacteria | 5455 |
| 387 | Ga0307411_10013678 | 3300032005 | Bacteria | 4488 |
| 388 | Ga0307411_10038831 | 3300032005 | Bacteria | 3007 |
| 389 | Ga0307411_10139741 | 3300032005 | Bacteria | 1784 |
| 390 | Ga0307415_100005573 | 3300032126 | Bacteria | 6700 |
| 391 | Ga0307415_100005937 | 3300032126 | Bacteria | 6539 |
| 392 | Ga0307415_100057327 | 3300032126 | Bacteria | 2676 |
| 393 | Ga0307415_100088977 | 3300032126 | Bacteria | 2229 |
| 394 | Ga0316583_10001033 | 3300032133 | Bacteria | 9019 |
| 395 | Ga0316584_0014468 | 3300036712 | Bacteria | 5618 |
| 396 | Ga0316584_0089308 | 3300036712 | Bacteria | 2307 |
| 397 | Ga0395899_0031849 | 3300037312 | Bacteria | 3962 |
| 398 | Ga0395901_0039524 | 3300038443 | Bacteria | 4882 |
| 399 | Ga0395901_0080949 | 3300038443 | Bacteria | 3392 |
| 400 | Ga0395901_0116743 | 3300038443 | Bacteria | 2803 |
| 401 | Ga0439435_0003307 | 3300042436 | Bacteria | 3336 |
| 402 | Ga0466968_0013146 | 3300044735 | Bacteria | 3250 |
| 403 | Ga0451576_0000024 | 3300045051 | Bacteria | 470499 |
| 404 | Ga0451576_0162645 | 3300045051 | Bacteria | 2330 |
| 405 | Ga0495617_014504 | 3300046452 | Bacteria | 2678 |
| 406 | Ga0495627_000278 | 3300046453 | Bacteria | 51546 |
| 407 | Ga0495638_0001145 | 3300046460 | Bacteria | 25617 |
| 408 | Ga0495650_0000158 | 3300046471 | Bacteria | 154681 |
| 409 | Ga0495650_0003474 | 3300046471 | Bacteria | 11459 |
| 410 | Ga0495605_0069596 | 3300046474 | Bacteria | 1666 |
| 411 | Ga0495639_0046696 | 3300046475 | Bacteria | 1961 |
| 412 | Ga0495585_0004856 | 3300046492 | Bacteria | 8628 |
| 413 | Ga0495585_0052350 | 3300046492 | Bacteria | 2260 |
| 414 | Ga0495596_0000006 | 3300046500 | Bacteria | 161501 |
| 415 | Ga0495596_0000830 | 3300046500 | Bacteria | 18689 |
| 416 | Ga0495607_0008886 | 3300046501 | Bacteria | 6843 |
| 417 | Ga0495607_0025932 | 3300046501 | Bacteria | 3640 |
| 418 | Ga0495583_0000631 | 3300046506 | Bacteria | 46958 |
| 419 | Ga0495583_0020282 | 3300046506 | Bacteria | 3448 |
| 420 | Ga0495606_0000672 | 3300046507 | Bacteria | 53500 |
| 421 | Ga0495606_0022008 | 3300046507 | Bacteria | 4659 |
| 422 | Ga0495610_0000116 | 3300046512 | Bacteria | 90702 |
| 423 | Ga0495610_0001706 | 3300046512 | Bacteria | 19286 |
| 424 | Ga0495631_0008798 | 3300046518 | Bacteria | 5070 |
| 425 | Ga0495632_0029606 | 3300046519 | Bacteria | 2849 |
| 426 | Ga0495637_0015883 | 3300046520 | Bacteria | 3524 |
| 427 | Ga0495643_0003727 | 3300046522 | Bacteria | 11036 |
| 428 | Ga0495643_0011201 | 3300046522 | Bacteria | 5479 |
| 429 | Ga0495643_0017045 | 3300046522 | Bacteria | 4255 |
| 430 | Ga0495643_0020288 | 3300046522 | Bacteria | 3834 |
| 431 | Ga0495643_0021086 | 3300046522 | Bacteria | 3744 |
| 432 | Ga0495643_0037814 | 3300046522 | Bacteria | 2645 |
| 433 | Ga0495648_0000143 | 3300046524 | Bacteria | 85539 |
| 434 | Ga0495663_0001342 | 3300046525 | Bacteria | 7775 |
| 435 | Ga0495642_0009263 | 3300046528 | Bacteria | 3770 |
| 436 | Ga0495654_0020341 | 3300046530 | Bacteria | 3460 |
| 437 | Ga0495654_0082184 | 3300046530 | Bacteria | 1508 |
| 438 | Ga0495609_0032441 | 3300046538 | Bacteria | 2372 |
| 439 | Ga0495633_0004678 | 3300046558 | Bacteria | 8611 |
| 440 | Ga0495633_0026130 | 3300046558 | Bacteria | 2867 |
| 441 | Ga0495668_0000016 | 3300046616 | Bacteria | 438197 |
| 442 | Ga0495668_0000076 | 3300046616 | Bacteria | 161826 |
| 443 | Ga0495668_0016858 | 3300046616 | Bacteria | 4244 |
| 444 | Ga0495668_0051903 | 3300046616 | Bacteria | 2270 |
| 445 | Ga0495668_0077851 | 3300046616 | Bacteria | 1821 |
| 446 | Ga0495625_0000150 | 3300046660 | Bacteria | 106314 |
| 447 | Ga0495625_0000520 | 3300046660 | Bacteria | 56778 |
| 448 | Ga0495625_0027361 | 3300046660 | Bacteria | 4294 |
| 449 | Ga0495625_0036381 | 3300046660 | Bacteria | 3619 |
| 450 | Ga0495625_0054961 | 3300046660 | Bacteria | 2841 |
| 451 | Ga0495661_0040380 | 3300046665 | Bacteria | 2894 |
| 452 | Ga0495661_0072631 | 3300046665 | Bacteria | 2007 |
| 453 | Ga0495669_0000050 | 3300046684 | Bacteria | 80688 |
| 454 | Ga0495660_0029202 | 3300046810 | Bacteria | 3113 |
| 455 | Ga0495683_0000963 | 3300047323 | Bacteria | 20180 |
| 456 | Ga0495683_0009437 | 3300047323 | Bacteria | 5197 |
| 457 | Ga0495687_001845 | 3300047443 | Bacteria | 18538 |
| 458 | Ga0495687_002183 | 3300047443 | Bacteria | 16292 |
| 459 | Ga0495681_0000974 | 3300047470 | Bacteria | 21885 |
| 460 | Ga0495681_0004732 | 3300047470 | Bacteria | 9223 |
| 461 | Ga0495686_0000340 | 3300047472 | Bacteria | 76984 |
| 462 | Ga0495686_0000363 | 3300047472 | Bacteria | 73366 |
| 463 | Ga0495686_0001841 | 3300047472 | Bacteria | 21297 |
| 464 | Ga0495686_0002793 | 3300047472 | Bacteria | 15859 |
| 465 | Ga0495686_0010684 | 3300047472 | Bacteria | 6517 |
| 466 | Ga0495615_0000126 | 3300048090 | Bacteria | 19220 |
| 467 | Ga0495626_0000165 | 3300048091 | Bacteria | 81419 |
| 468 | Ga0496100_0005025 | 3300048903 | Bacteria | 7078 |
| 469 | Ga0496102_0000199 | 3300048905 | Bacteria | 81435 |
| 470 | Ga0496102_0000856 | 3300048905 | Bacteria | 29219 |
| 471 | Ga0496102_0344083 | 3300048905 | Bacteria | 1404 |
| 472 | Ga0496103_0000140 | 3300048906 | Bacteria | 75095 |
| 473 | Ga0496103_0000633 | 3300048906 | Bacteria | 26944 |
| 474 | Ga0496103_0117781 | 3300048906 | Bacteria | 1691 |
| 475 | Ga0496104_0001582 | 3300048907 | Bacteria | 19595 |
| 476 | Ga0496104_0011045 | 3300048907 | Bacteria | 8079 |
| 477 | Ga0496104_0035916 | 3300048907 | Bacteria | 4630 |
| 478 | Ga0496105_0000446 | 3300048908 | Bacteria | 27189 |
| 479 | Ga0496105_0000690 | 3300048908 | Bacteria | 22731 |
| 480 | Ga0496105_0005353 | 3300048908 | Bacteria | 9728 |
| 481 | Ga0496106_0004026 | 3300048909 | Bacteria | 10987 |
| 482 | Ga0496106_0184571 | 3300048909 | Bacteria | 1657 |
| 483 | Ga0496107_0000221 | 3300048910 | Bacteria | 30031 |
| 484 | Ga0496107_0041029 | 3300048910 | Bacteria | 3323 |
| 485 | Ga0496110_0112948 | 3300048913 | Bacteria | 2442 |
| 486 | Ga0496111_0032279 | 3300048914 | Bacteria | 3732 |
| 487 | Ga0496112_0003754 | 3300048915 | Bacteria | 12689 |
| 488 | Ga0496113_0000197 | 3300048916 | Bacteria | 27686 |
| 489 | Ga0496113_0015080 | 3300048916 | Bacteria | 5295 |
| 490 | Ga0496114_0002491 | 3300048917 | Bacteria | 14055 |
| 491 | Ga0496115_0000131 | 3300048918 | Bacteria | 68111 |
| 492 | Ga0496115_0051369 | 3300048918 | Bacteria | 3306 |
| 493 | Ga0496116_0000035 | 3300048919 | Bacteria | 402424 |
| 494 | Ga0496116_0011618 | 3300048919 | Bacteria | 7266 |
| 495 | Ga0496116_0016826 | 3300048919 | Bacteria | 5705 |
| 496 | Ga0496116_0058238 | 3300048919 | Bacteria | 2520 |
| 497 | Ga0496117_0000331 | 3300048920 | Bacteria | 83569 |
| 498 | Ga0496117_0000352 | 3300048920 | Bacteria | 81089 |
| 499 | Ga0496118_0000092 | 3300048921 | Bacteria | 169106 |
| 500 | Ga0496118_0003689 | 3300048921 | Bacteria | 18976 |
| 501 | Ga0496118_0008603 | 3300048921 | Bacteria | 10506 |
| 502 | Ga0496118_0010555 | 3300048921 | Bacteria | 9133 |
| 503 | Ga0496118_0077898 | 3300048921 | Bacteria | 2348 |
| 504 | Ga0496119_0004697 | 3300048922 | Bacteria | 13438 |
| 505 | Ga0496119_0026586 | 3300048922 | Bacteria | 4008 |
| 506 | Ga0496120_0005607 | 3300048923 | Bacteria | 9946 |
| 507 | Ga0496120_0009062 | 3300048923 | Bacteria | 7107 |
| 508 | Ga0496120_0029800 | 3300048923 | Bacteria | 3327 |
| 509 | Ga0496120_0037255 | 3300048923 | Bacteria | 2888 |
| 510 | Ga0496121_0000017 | 3300048924 | Bacteria | 546415 |
| 511 | Ga0496121_0000228 | 3300048924 | Bacteria | 120653 |
| 512 | Ga0496121_0000347 | 3300048924 | Bacteria | 96608 |
| 513 | Ga0496121_0001542 | 3300048924 | Bacteria | 38556 |
| 514 | Ga0496121_0001914 | 3300048924 | Bacteria | 33228 |
| 515 | Ga0496121_0001919 | 3300048924 | Bacteria | 33213 |
| 516 | Ga0496121_0002864 | 3300048924 | Bacteria | 25422 |
| 517 | Ga0496121_0037720 | 3300048924 | Bacteria | 4287 |
| 518 | Ga0496121_0042197 | 3300048924 | Bacteria | 3973 |
| 519 | Ga0496122_0000176 | 3300048925 | Bacteria | 152190 |
| 520 | Ga0496122_0005106 | 3300048925 | Bacteria | 15836 |
| 521 | Ga0496122_0031341 | 3300048925 | Bacteria | 4427 |
| 522 | Ga0496123_0000159 | 3300048926 | Bacteria | 136014 |
| 523 | Ga0496123_0000291 | 3300048926 | Bacteria | 97989 |
| 524 | Ga0496123_0002869 | 3300048926 | Bacteria | 20241 |
| 525 | Ga0496123_0009148 | 3300048926 | Bacteria | 8959 |
| 526 | Ga0496123_0022617 | 3300048926 | Bacteria | 4839 |
| 527 | Ga0496123_0031503 | 3300048926 | Bacteria | 3857 |
| 528 | Ga0496124_0000081 | 3300048927 | Bacteria | 208413 |
| 529 | Ga0496124_0002273 | 3300048927 | Bacteria | 25455 |
| 530 | Ga0496124_0002527 | 3300048927 | Bacteria | 23742 |
| 531 | Ga0496124_0098846 | 3300048927 | Bacteria | 2367 |
| 532 | Ga0496124_0266017 | 3300048927 | Bacteria | 1258 |
| 533 | Ga0496125_0000980 | 3300048928 | Bacteria | 44624 |
| 534 | Ga0496125_0003982 | 3300048928 | Bacteria | 17382 |
| 535 | Ga0496125_0043169 | 3300048928 | Bacteria | 3831 |
| 536 | Ga0496125_0059042 | 3300048928 | Bacteria | 3094 |
| 537 | Ga0496125_0086169 | 3300048928 | Bacteria | 2376 |
| 538 | Ga0496126_0000051 | 3300048929 | Bacteria | 313169 |
| 539 | Ga0496126_0000077 | 3300048929 | Bacteria | 231592 |
| 540 | Ga0496126_0000283 | 3300048929 | Bacteria | 107129 |
| 541 | Ga0496126_0000955 | 3300048929 | Bacteria | 49565 |
| 542 | Ga0496126_0020825 | 3300048929 | Bacteria | 6419 |
| 543 | Ga0496126_0023938 | 3300048929 | Bacteria | 5905 |
| 544 | Ga0496126_0075909 | 3300048929 | Bacteria | 2982 |
| 545 | Ga0501290_001006 | 3300049513 | Bacteria | 4049 |
| 546 | Ga0501032_0094647 | 3300049569 | Bacteria | 1980 |
| 547 | Ga0501033_0005709 | 3300049570 | Bacteria | 9810 |
| 548 | Ga0501033_0110216 | 3300049570 | Bacteria | 2004 |
| 549 | Ga0501034_0408031 | 3300049571 | Bacteria | 1281 |
| 550 | Ga0501036_0010585 | 3300049572 | Bacteria | 7620 |
| 551 | Ga0501036_0043827 | 3300049572 | Bacteria | 3789 |
| 552 | Ga0501038_0040575 | 3300049574 | Bacteria | 4063 |
| 553 | Ga0501039_0064138 | 3300049575 | Bacteria | 2847 |
| 554 | Ga0501047_0103401 | 3300049581 | Bacteria | 2729 |
| 555 | Ga0501047_0194909 | 3300049581 | Bacteria | 1888 |
| 556 | Ga0501071_0047383 | 3300049587 | Bacteria | 3088 |
| 557 | Ga0501235_010311 | 3300049669 | Bacteria | 2043 |
| 558 | Ga0501249_000848 | 3300049679 | Bacteria | 6781 |
| 559 | Ga0501249_015025 | 3300049679 | Bacteria | 1654 |
| 560 | Ga0501257_000001 | 3300049686 | Bacteria | 74809 |
| 561 | Ga0501241_004743 | 3300049758 | Bacteria | 2539 |
| 562 | Ga0501035_0187077 | 3300049822 | Bacteria | 1782 |
| 563 | Ga0501044_0000591 | 3300049823 | Bacteria | 44012 |
| 564 | Ga0501044_0028035 | 3300049823 | Bacteria | 5943 |
| 565 | Ga0501044_0106644 | 3300049823 | Bacteria | 2813 |
| 566 | nmdc:mga03683_24257_c1 | 3300050489 | Bacteria | 2372 |
| 567 | nmdc:mga03683_393_c1 | 3300050489 | Bacteria | 12561 |
| 568 | nmdc:mga03683_45295_c1 | 3300050489 | Bacteria | 1820 |
| 569 | nmdc:mga00v17_1341_c1 | 3300050491 | Bacteria | 12898 |
| 570 | nmdc:mga0k408_10130_c1 | 3300050493 | Bacteria | 5093 |
| 571 | nmdc:mga0k408_1586_c2 | 3300050493 | Bacteria | 5441 |
| 572 | nmdc:mga0k408_89124_c1 | 3300050493 | Bacteria | 1812 |
| 573 | nmdc:mga06z11_388_c1 | 3300050494 | Bacteria | 16612 |
| 574 | nmdc:mga04h51_73_c1 | 3300050495 | Bacteria | 32039 |
| 575 | nmdc:mga07m45_110859_c1 | 3300050496 | Bacteria | 1580 |
| 576 | nmdc:mga07m45_2163_c1 | 3300050496 | Bacteria | 9154 |
| 577 | nmdc:mga07m45_39242_c1 | 3300050496 | Bacteria | 2645 |
| 578 | nmdc:mga07m45_5_c2 | 3300050496 | Bacteria | 297012 |
| 579 | nmdc:mga0sz30_209_c1 | 3300050516 | Bacteria | 21984 |
| 580 | nmdc:mga0sz30_33943_c1 | 3300050516 | Bacteria | 2122 |
| 581 | Ga0500610_0009443 | 3300053079 | Bacteria | 4324 |
| 582 | Ga0500643_000001 | 3300053087 | Bacteria | 1440111 |
| 583 | Ga0500643_028166 | 3300053087 | Bacteria | 1739 |
| 584 | Ga0500641_0065873 | 3300053096 | Bacteria | 1516 |
| 585 | Ga0500556_0000144 | 3300053104 | Bacteria | 59354 |
| 586 | Ga0500592_001926 | 3300053116 | Bacteria | 3338 |
| 587 | Ga0500595_044015 | 3300053119 | Bacteria | 1418 |
| 588 | Ga0500597_008459 | 3300053120 | Bacteria | 3560 |
| 589 | Ga0500607_000009 | 3300053121 | Bacteria | 125590 |
| 590 | Ga0500607_000292 | 3300053121 | Bacteria | 47464 |
| 591 | Ga0500618_000211 | 3300053125 | Bacteria | 46131 |
| 592 | Ga0500642_0000001 | 3300053130 | Bacteria | 1468402 |
| 593 | Ga0500642_0000393 | 3300053130 | Bacteria | 14372 |
| 594 | Ga0500658_0003688 | 3300053134 | Bacteria | 5772 |
| 595 | Ga0500559_0001649 | 3300053136 | Bacteria | 12352 |
| 596 | Ga0500559_0015729 | 3300053136 | Bacteria | 3195 |
| 597 | Ga0500564_001534 | 3300053138 | Bacteria | 8032 |
| 598 | Ga0500568_0064562 | 3300053139 | Bacteria | 1410 |
| 599 | Ga0500573_0000015 | 3300053140 | Bacteria | 192264 |
| 600 | Ga0500573_0055338 | 3300053140 | Bacteria | 2277 |
| 601 | Ga0500588_0038894 | 3300053146 | Bacteria | 1421 |
| 602 | Ga0500590_000367 | 3300053148 | Bacteria | 14913 |
| 603 | Ga0500604_0022012 | 3300053151 | Bacteria | 1807 |
| 604 | Ga0500616_0001216 | 3300053153 | Bacteria | 26011 |
| 605 | Ga0500616_0003363 | 3300053153 | Bacteria | 12295 |
| 606 | Ga0500619_013931 | 3300053154 | Bacteria | 2146 |
| 607 | Ga0500622_0000253 | 3300053156 | Bacteria | 54354 |
| 608 | Ga0500622_0036470 | 3300053156 | Bacteria | 2570 |
| 609 | Ga0500624_000017 | 3300053157 | Bacteria | 132088 |
| 610 | Ga0500624_000023 | 3300053157 | Bacteria | 114997 |
| 611 | Ga0500627_0000100 | 3300053158 | Bacteria | 28817 |
| 612 | Ga0500637_0000013 | 3300053178 | Bacteria | 73168 |
| 613 | Ga0500637_0001397 | 3300053178 | Bacteria | 10269 |
| 614 | Ga0500625_000005 | 3300053729 | Bacteria | 209509 |
| 615 | Ga0500645_000002 | 3300053730 | Bacteria | 388892 |
| 616 | Ga0500645_000414 | 3300053730 | Bacteria | 29750 |
| 617 | Ga0500645_001762 | 3300053730 | Bacteria | 10487 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300026067 | Ga0207678_10163478 | Ga0207678_101634782 | 339 |
| 2 | 3300053120 | Ga0500597_008459 | Ga0500597_008459_513_1634 | 348 |
| 3 | 3300053157 | Ga0500624_000023 | Ga0500624_000023_56398_57519 | 348 |
| 4 | 3300053178 | Ga0500637_0000013 | Ga0500637_0000013_30902_32023 | 348 |
| 5 | 3300046660 | Ga0495625_0036381 | Ga0495625_0036381_14_1138 | 367 |
| 6 | 3300053121 | Ga0500607_000292 | Ga0500607_000292_11811_13013 | 368 |
| 7 | 3300027543 | Ga0209999_1004174 | Ga0209999_10041743 | 370 |
| 8 | 3300027876 | Ga0209974_10004024 | Ga0209974_100040244 | 370 |
| 9 | 3300031548 | Ga0307408_100022756 | Ga0307408_1000227562 | 370 |
| 10 | 3300031731 | Ga0307405_10049956 | Ga0307405_100499563 | 370 |
| 11 | 3300031824 | Ga0307413_10005384 | Ga0307413_100053844 | 370 |
| 12 | 3300031852 | Ga0307410_10002075 | Ga0307410_100020756 | 370 |
| 13 | 3300031901 | Ga0307406_10006711 | Ga0307406_100067113 | 370 |
| 14 | 3300031903 | Ga0307407_10001621 | Ga0307407_100016217 | 370 |
| 15 | 3300031911 | Ga0307412_10007151 | Ga0307412_100071515 | 370 |
| 16 | 3300031995 | Ga0307409_100006854 | Ga0307409_1000068546 | 370 |
| 17 | 3300032002 | Ga0307416_100085284 | Ga0307416_1000852843 | 370 |
| 18 | 3300032004 | Ga0307414_10003379 | Ga0307414_100033796 | 370 |
| 19 | 3300032005 | Ga0307411_10005204 | Ga0307411_100052042 | 370 |
| 20 | 3300032126 | Ga0307415_100005937 | Ga0307415_1000059374 | 370 |
| 21 | 3300049669 | Ga0501235_010311 | Ga0501235_010311_131_1339 | 370 |
| 22 | 3300049679 | Ga0501249_000848 | Ga0501249_000848_3953_5161 | 370 |
| 23 | 3300053146 | Ga0500588_0038894 | Ga0500588_0038894_144_1382 | 372 |
| 24 | 3300005618 | Ga0068864_100108208 | Ga0068864_1001082082 | 373 |
| 25 | 3300005618 | Ga0068864_100160020 | Ga0068864_1001600202 | 374 |
| 26 | 3300025304 | Ga0209257_1001326 | Ga0209257_100132610 | 375 |
| 27 | 3300031731 | Ga0307405_10014694 | Ga0307405_100146943 | 375 |
| 28 | 3300031824 | Ga0307413_10090385 | Ga0307413_100903851 | 375 |
| 29 | 3300031852 | Ga0307410_10046303 | Ga0307410_100463033 | 375 |
| 30 | 3300031901 | Ga0307406_10027877 | Ga0307406_100278773 | 375 |
| 31 | 3300031911 | Ga0307412_10019157 | Ga0307412_100191573 | 375 |
| 32 | 3300032004 | Ga0307414_10012232 | Ga0307414_100122323 | 375 |
| 33 | 3300032004 | Ga0307414_10067599 | Ga0307414_100675992 | 375 |
| 34 | 3300032004 | Ga0307414_10092926 | Ga0307414_100929262 | 375 |
| 35 | 3300032005 | Ga0307411_10038831 | Ga0307411_100388313 | 375 |
| 36 | 3300032126 | Ga0307415_100005573 | Ga0307415_1000055732 | 375 |
| 37 | 3300049679 | Ga0501249_015025 | Ga0501249_015025_17_1177 | 375 |
| 38 | 3300053139 | Ga0500568_0064562 | Ga0500568_0064562_225_1379 | 375 |
| 39 | 3300053153 | Ga0500616_0001216 | Ga0500616_0001216_11002_12210 | 375 |
| 40 | 3300053156 | Ga0500622_0036470 | Ga0500622_0036470_1151_2359 | 375 |
| 41 | 3300031731 | Ga0307405_10225175 | Ga0307405_102251752 | 376 |
| 42 | 3300006353 | Ga0075370_10099532 | Ga0075370_100995322 | 377 |
| 43 | 3300026116 | Ga0207674_10041856 | Ga0207674_100418566 | 377 |
| 44 | 3300031731 | Ga0307405_10001326 | Ga0307405_1000132611 | 377 |
| 45 | 3300031911 | Ga0307412_10012945 | Ga0307412_100129456 | 377 |
| 46 | 3300005336 | Ga0070680_100007121 | Ga0070680_1000071217 | 378 |
| 47 | 3300005339 | Ga0070660_100093279 | Ga0070660_1000932792 | 378 |
| 48 | 3300025919 | Ga0207657_10095609 | Ga0207657_100956092 | 378 |
| 49 | 3300031901 | Ga0307406_10060877 | Ga0307406_100608773 | 378 |
| 50 | 3300031995 | Ga0307409_100271799 | Ga0307409_1002717992 | 378 |
| 51 | 3300032004 | Ga0307414_10038785 | Ga0307414_100387852 | 378 |
| 52 | 3300050496 | nmdc:mga07m45_39242_c1 | nmdc:mga07m45_39242_c1_334_1530 | 378 |
| 53 | 3300053157 | Ga0500624_000017 | Ga0500624_000017_16467_17678 | 378 |
| 54 | 3300003214 | JGI25165J46597_1000012 | JGI25165J46597_1000012101 | 379 |
| 55 | 3300005334 | Ga0068869_100084489 | Ga0068869_1000844892 | 379 |
| 56 | 3300005842 | Ga0068858_100000472 | Ga0068858_10000047211 | 379 |
| 57 | 3300009098 | Ga0105245_10001108 | Ga0105245_1000110822 | 379 |
| 58 | 3300009551 | Ga0105238_10084215 | Ga0105238_100842152 | 379 |
| 59 | 3300013296 | Ga0157374_10015473 | Ga0157374_100154732 | 379 |
| 60 | 3300013297 | Ga0157378_10193513 | Ga0157378_101935132 | 379 |
| 61 | 3300025261 | Ga0209233_1000058 | Ga0209233_1000058318 | 379 |
| 62 | 3300025921 | Ga0207652_10241189 | Ga0207652_102411892 | 379 |
| 63 | 3300025927 | Ga0207687_10000853 | Ga0207687_100008539 | 379 |
| 64 | 3300025942 | Ga0207689_10075817 | Ga0207689_100758172 | 379 |
| 65 | 3300026035 | Ga0207703_10000568 | Ga0207703_1000056830 | 379 |
| 66 | 3300031507 | Ga0307509_10098666 | Ga0307509_100986662 | 379 |
| 67 | 3300031616 | Ga0307508_10001821 | Ga0307508_100018217 | 379 |
| 68 | 3300031731 | Ga0307405_10015282 | Ga0307405_100152823 | 379 |
| 69 | 3300031824 | Ga0307413_10004766 | Ga0307413_100047664 | 379 |
| 70 | 3300031852 | Ga0307410_10017407 | Ga0307410_100174072 | 379 |
| 71 | 3300031901 | Ga0307406_10014163 | Ga0307406_100141634 | 379 |
| 72 | 3300031903 | Ga0307407_10034315 | Ga0307407_100343153 | 379 |
| 73 | 3300031911 | Ga0307412_10023165 | Ga0307412_100231654 | 379 |
| 74 | 3300032002 | Ga0307416_100002227 | Ga0307416_1000022277 | 379 |
| 75 | 3300032004 | Ga0307414_10013483 | Ga0307414_100134833 | 379 |
| 76 | 3300032005 | Ga0307411_10002755 | Ga0307411_100027558 | 379 |
| 77 | 3300032126 | Ga0307415_100057327 | Ga0307415_1000573271 | 379 |
| 78 | 3300006051 | Ga0075364_10216796 | Ga0075364_102167961 | 381 |
| 79 | 3300046522 | Ga0495643_0037814 | Ga0495643_0037814_99_1328 | 382 |
| 80 | 3300009093 | Ga0105240_10001848 | Ga0105240_1000184812 | 383 |
| 81 | 3300009545 | Ga0105237_10002266 | Ga0105237_100022664 | 383 |
| 82 | 3300010375 | Ga0105239_10009734 | Ga0105239_100097347 | 383 |
| 83 | 3300025913 | Ga0207695_10000288 | Ga0207695_1000028827 | 383 |
| 84 | 3300025981 | Ga0207640_10142937 | Ga0207640_101429372 | 383 |
| 85 | 3300048924 | Ga0496121_0001914 | Ga0496121_0001914_7345_8514 | 383 |
| 86 | 3300048924 | Ga0496121_0001919 | Ga0496121_0001919_22632_23801 | 383 |
| 87 | 3300048929 | Ga0496126_0023938 | Ga0496126_0023938_2117_3286 | 383 |
| 88 | 3300005367 | Ga0070667_100000281 | Ga0070667_10000028150 | 384 |
| 89 | 3300005841 | Ga0068863_100004231 | Ga0068863_1000042315 | 384 |
| 90 | 3300009148 | Ga0105243_10150418 | Ga0105243_101504182 | 384 |
| 91 | 3300025986 | Ga0207658_10000415 | Ga0207658_1000041534 | 384 |
| 92 | 3300026088 | Ga0207641_10011356 | Ga0207641_100113566 | 384 |
| 93 | 3300047472 | Ga0495686_0001841 | Ga0495686_0001841_15656_16870 | 384 |
| 94 | 3300005289 | Ga0065704_10083691 | Ga0065704_100836912 | 385 |
| 95 | 3300005347 | Ga0070668_100016290 | Ga0070668_1000162904 | 385 |
| 96 | 3300006051 | Ga0075364_10034149 | Ga0075364_100341492 | 385 |
| 97 | 3300025972 | Ga0207668_10062746 | Ga0207668_100627464 | 385 |
| 98 | 3300048905 | Ga0496102_0344083 | Ga0496102_0344083_97_1302 | 385 |
| 99 | 3300048921 | Ga0496118_0010555 | Ga0496118_0010555_7249_8454 | 385 |
| 100 | 3300048924 | Ga0496121_0002864 | Ga0496121_0002864_12036_13241 | 385 |
| 101 | 3300013102 | Ga0157371_10033776 | Ga0157371_100337763 | 386 |
| 102 | 3300038443 | Ga0395901_0039524 | Ga0395901_0039524_2247_3452 | 386 |
| 103 | 3300038443 | Ga0395901_0116743 | Ga0395901_0116743_269_1474 | 386 |
| 104 | 3300047472 | Ga0495686_0002793 | Ga0495686_0002793_3608_4831 | 386 |
| 105 | 3300048927 | Ga0496124_0266017 | Ga0496124_0266017_35_1234 | 386 |
| 106 | 3300053140 | Ga0500573_0000015 | Ga0500573_0000015_45313_46512 | 386 |
| 107 | 3300046501 | Ga0495607_0025932 | Ga0495607_0025932_2234_3439 | 387 |
| 108 | 3300025304 | Ga0209257_1009938 | Ga0209257_10099383 | 388 |
| 109 | 3300048924 | Ga0496121_0000017 | Ga0496121_0000017_482548_483786 | 388 |
| 110 | 3300048928 | Ga0496125_0059042 | Ga0496125_0059042_1743_2948 | 388 |
| 111 | 3300049569 | Ga0501032_0094647 | Ga0501032_0094647_527_1735 | 388 |
| 112 | 3300049570 | Ga0501033_0005709 | Ga0501033_0005709_3472_4680 | 388 |
| 113 | 3300049572 | Ga0501036_0010585 | Ga0501036_0010585_319_1527 | 388 |
| 114 | 3300049574 | Ga0501038_0040575 | Ga0501038_0040575_995_2203 | 388 |
| 115 | 3300049575 | Ga0501039_0064138 | Ga0501039_0064138_1421_2629 | 388 |
| 116 | 3300049823 | Ga0501044_0106644 | Ga0501044_0106644_1585_2793 | 388 |
| 117 | 3300005366 | Ga0070659_100092449 | Ga0070659_1000924492 | 389 |
| 118 | 3300005577 | Ga0068857_100136768 | Ga0068857_1001367682 | 389 |
| 119 | 3300005578 | Ga0068854_100100749 | Ga0068854_1001007492 | 389 |
| 120 | 3300005616 | Ga0068852_100103788 | Ga0068852_1001037883 | 389 |
| 121 | 3300025923 | Ga0207681_10038828 | Ga0207681_100388283 | 389 |
| 122 | 3300025981 | Ga0207640_10049196 | Ga0207640_100491962 | 389 |
| 123 | 3300026116 | Ga0207674_10085008 | Ga0207674_100850082 | 389 |
| 124 | 3300048907 | Ga0496104_0035916 | Ga0496104_0035916_1459_2667 | 389 |
| 125 | 3300048908 | Ga0496105_0000446 | Ga0496105_0000446_18498_19706 | 389 |
| 126 | iso_pu_bacteria | 2990265787 | 2990266438 | 389 |
| 127 | iso_pu_bacteria | 2993693658 | 2993695769 | 389 |
| 128 | 3300005367 | Ga0070667_100005899 | Ga0070667_1000058995 | 390 |
| 129 | 3300005548 | Ga0070665_100008606 | Ga0070665_1000086065 | 390 |
| 130 | 3300005841 | Ga0068863_100000090 | Ga0068863_10000009010 | 390 |
| 131 | 3300005842 | Ga0068858_100003262 | Ga0068858_1000032625 | 390 |
| 132 | 3300005843 | Ga0068860_100000089 | Ga0068860_100000089138 | 390 |
| 133 | 3300005844 | Ga0068862_100037541 | Ga0068862_1000375413 | 390 |
| 134 | 3300025986 | Ga0207658_10004466 | Ga0207658_100044667 | 390 |
| 135 | 3300026088 | Ga0207641_10000069 | Ga0207641_1000006911 | 390 |
| 136 | 3300026095 | Ga0207676_10013117 | Ga0207676_100131172 | 390 |
| 137 | 3300028379 | Ga0268266_10003468 | Ga0268266_100034684 | 390 |
| 138 | 3300028380 | Ga0268265_10026456 | Ga0268265_100264563 | 390 |
| 139 | 3300028381 | Ga0268264_10000160 | Ga0268264_1000016010 | 390 |
| 140 | 3300031548 | Ga0307408_100115582 | Ga0307408_1001155822 | 390 |
| 141 | 3300031995 | Ga0307409_100001109 | Ga0307409_10000110911 | 390 |
| 142 | 3300032005 | Ga0307411_10007939 | Ga0307411_100079394 | 390 |
| 143 | 3300032133 | Ga0316583_10001033 | Ga0316583_100010336 | 390 |
| 144 | 3300036712 | Ga0316584_0089308 | Ga0316584_0089308_369_1595 | 390 |
| 145 | 3300047472 | Ga0495686_0000363 | Ga0495686_0000363_47699_48910 | 390 |
| 146 | 3300048923 | Ga0496120_0037255 | Ga0496120_0037255_1231_2442 | 390 |
| 147 | 3300048925 | Ga0496122_0000176 | Ga0496122_0000176_125585_126799 | 390 |
| 148 | 3300048926 | Ga0496123_0000291 | Ga0496123_0000291_28645_29859 | 390 |
| 149 | 3300049513 | Ga0501290_001006 | Ga0501290_001006_2196_3398 | 390 |
| 150 | 3300049823 | Ga0501044_0000591 | Ga0501044_0000591_35971_37143 | 390 |
| 151 | 3300049823 | Ga0501044_0028035 | Ga0501044_0028035_2334_3545 | 390 |
| 152 | iso_pu_bacteria | 2599185354 | 2600202946 | 390 |
| 153 | iso_pu_bacteria | 2751185897 | 2753767310 | 390 |
| 154 | 3300009177 | Ga0105248_10013624 | Ga0105248_100136244 | 391 |
| 155 | 3300025941 | Ga0207711_10008551 | Ga0207711_100085516 | 391 |
| 156 | 3300031824 | Ga0307413_10031139 | Ga0307413_100311391 | 391 |
| 157 | 3300042436 | Ga0439435_0003307 | Ga0439435_0003307_1109_2344 | 391 |
| 158 | 3300046616 | Ga0495668_0016858 | Ga0495668_0016858_951_2147 | 391 |
| 159 | 3300048929 | Ga0496126_0020825 | Ga0496126_0020825_1973_3169 | 391 |
| 160 | 3300049758 | Ga0501241_004743 | Ga0501241_004743_68_1264 | 391 |
| 161 | 3300050496 | nmdc:mga07m45_110859_c1 | nmdc:mga07m45_110859_c1_331_1527 | 391 |
| 162 | 3300053087 | Ga0500643_028166 | Ga0500643_028166_258_1454 | 391 |
| 163 | 3300053104 | Ga0500556_0000144 | Ga0500556_0000144_31192_32388 | 391 |
| 164 | 3300053130 | Ga0500642_0000001 | Ga0500642_0000001_332880_334076 | 391 |
| 165 | 3300053730 | Ga0500645_000414 | Ga0500645_000414_920_2116 | 391 |
| 166 | iso_pu_bacteria | 2928027323 | 2928030576 | 391 |
| 167 | iso_pu_bacteria | 2946787523 | 2946791065 | 391 |
| 168 | iso_pu_bacteria | 2984555340 | 2984555646 | 391 |
| 169 | iso_pu_bacteria | 2984564862 | 2984566243 | 391 |
| 170 | iso_pu_bacteria | 2993356040 | 2993357256 | 391 |
| 171 | 3300005289 | Ga0065704_10155604 | Ga0065704_101556041 | 392 |
| 172 | 3300005295 | Ga0065707_10084966 | Ga0065707_100849665 | 392 |
| 173 | 3300005563 | Ga0068855_100032690 | Ga0068855_1000326904 | 392 |
| 174 | 3300011119 | Ga0105246_10000354 | Ga0105246_1000035419 | 392 |
| 175 | 3300013100 | Ga0157373_10009265 | Ga0157373_100092654 | 392 |
| 176 | 3300025949 | Ga0207667_10009448 | Ga0207667_100094484 | 392 |
| 177 | 3300032004 | Ga0307414_10042959 | Ga0307414_100429593 | 392 |
| 178 | 3300049822 | Ga0501035_0187077 | Ga0501035_0187077_128_1354 | 392 |
| 179 | iso_pu_bacteria | 2830075706 | 2830078119 | 392 |
| 180 | iso_pu_bacteria | 2885429604 | 2885430185 | 392 |
| 181 | iso_pu_bacteria | 8057101203 | 8057102862 | 392 |
| 182 | 3300003781 | Ga0055536_1002179 | Ga0055536_10021792 | 393 |
| 183 | 3300005367 | Ga0070667_100209069 | Ga0070667_1002090691 | 393 |
| 184 | 3300005539 | Ga0068853_100020273 | Ga0068853_1000202732 | 393 |
| 185 | 3300005834 | Ga0068851_10018458 | Ga0068851_100184582 | 393 |
| 186 | 3300025292 | Ga0209676_1000081 | Ga0209676_1000081121 | 393 |
| 187 | 3300025292 | Ga0209676_1000769 | Ga0209676_100076934 | 393 |
| 188 | 3300026041 | Ga0207639_10004061 | Ga0207639_100040612 | 393 |
| 189 | 3300026078 | Ga0207702_10045051 | Ga0207702_100450512 | 393 |
| 190 | 3300026116 | Ga0207674_10004472 | Ga0207674_1000447212 | 393 |
| 191 | 3300049686 | Ga0501257_000001 | Ga0501257_000001_60811_62022 | 393 |
| 192 | 3300005295 | Ga0065707_10096660 | Ga0065707_100966602 | 394 |
| 193 | 3300005356 | Ga0070674_100262863 | Ga0070674_1002628631 | 395 |
| 194 | 3300005456 | Ga0070678_100000495 | Ga0070678_1000004952 | 395 |
| 195 | 3300005459 | Ga0068867_100009199 | Ga0068867_1000091997 | 395 |
| 196 | 3300005543 | Ga0070672_100169697 | Ga0070672_1001696972 | 395 |
| 197 | 3300005563 | Ga0068855_100073414 | Ga0068855_1000734144 | 395 |
| 198 | 3300006237 | Ga0097621_100025030 | Ga0097621_1000250305 | 395 |
| 199 | 3300006358 | Ga0068871_100088604 | Ga0068871_1000886042 | 395 |
| 200 | 3300009148 | Ga0105243_10000423 | Ga0105243_1000042311 | 395 |
| 201 | 3300013296 | Ga0157374_10062137 | Ga0157374_100621373 | 395 |
| 202 | 3300025935 | Ga0207709_10000727 | Ga0207709_100007273 | 395 |
| 203 | 3300025937 | Ga0207669_10000416 | Ga0207669_100004162 | 395 |
| 204 | 3300025949 | Ga0207667_10087386 | Ga0207667_100873862 | 395 |
| 205 | 3300026089 | Ga0207648_10010571 | Ga0207648_100105713 | 395 |
| 206 | 3300026121 | Ga0207683_10033561 | Ga0207683_100335611 | 395 |
| 207 | 3300026142 | Ga0207698_10035948 | Ga0207698_100359482 | 395 |
| 208 | 3300049587 | Ga0501071_0047383 | Ga0501071_0047383_1331_2533 | 395 |
| 209 | 3300053119 | Ga0500595_044015 | Ga0500595_044015_95_1294 | 395 |
| 210 | iso_pu_bacteria | 2852653556 | 2852654413 | 395 |
| 211 | iso_pu_bacteria | 2882806704 | 2882808898 | 395 |
| 212 | 3300003781 | Ga0055536_1004597 | Ga0055536_10045972 | 396 |
| 213 | 3300003791 | Ga0055530_10002097 | Ga0055530_100020972 | 396 |
| 214 | 3300003794 | Ga0055531_10019563 | Ga0055531_100195631 | 396 |
| 215 | 3300005339 | Ga0070660_100207781 | Ga0070660_1002077812 | 396 |
| 216 | 3300005347 | Ga0070668_100152206 | Ga0070668_1001522061 | 396 |
| 217 | 3300005353 | Ga0070669_100005390 | Ga0070669_1000053906 | 396 |
| 218 | 3300005355 | Ga0070671_100010917 | Ga0070671_1000109174 | 396 |
| 219 | 3300005355 | Ga0070671_100019173 | Ga0070671_1000191734 | 396 |
| 220 | 3300005366 | Ga0070659_100010584 | Ga0070659_1000105846 | 396 |
| 221 | 3300005435 | Ga0070714_100102887 | Ga0070714_1001028872 | 396 |
| 222 | 3300005455 | Ga0070663_100004975 | Ga0070663_1000049754 | 396 |
| 223 | 3300005457 | Ga0070662_100022716 | Ga0070662_1000227163 | 396 |
| 224 | 3300005564 | Ga0070664_100041761 | Ga0070664_1000417614 | 396 |
| 225 | 3300005617 | Ga0068859_100029459 | Ga0068859_1000294594 | 396 |
| 226 | 3300005842 | Ga0068858_100001618 | Ga0068858_10000161810 | 396 |
| 227 | 3300006931 | Ga0097620_100029459 | Ga0097620_1000294594 | 396 |
| 228 | 3300009101 | Ga0105247_10045856 | Ga0105247_100458563 | 396 |
| 229 | 3300025291 | Ga0209675_1000075 | Ga0209675_100007577 | 396 |
| 230 | 3300025292 | Ga0209676_1000949 | Ga0209676_10009495 | 396 |
| 231 | 3300025298 | Ga0209050_1000017 | Ga0209050_1000017157 | 396 |
| 232 | 3300025298 | Ga0209050_1003650 | Ga0209050_10036505 | 396 |
| 233 | 3300025304 | Ga0209257_1000206 | Ga0209257_100020633 | 396 |
| 234 | 3300025304 | Ga0209257_1001697 | Ga0209257_100169710 | 396 |
| 235 | 3300025903 | Ga0207680_10136692 | Ga0207680_101366921 | 396 |
| 236 | 3300025919 | Ga0207657_10142261 | Ga0207657_101422612 | 396 |
| 237 | 3300025923 | Ga0207681_10002731 | Ga0207681_100027315 | 396 |
| 238 | 3300025931 | Ga0207644_10000004 | Ga0207644_100000045 | 396 |
| 239 | 3300025931 | Ga0207644_10093244 | Ga0207644_100932442 | 396 |
| 240 | 3300025941 | Ga0207711_10100579 | Ga0207711_101005792 | 396 |
| 241 | 3300025945 | Ga0207679_10055487 | Ga0207679_100554872 | 396 |
| 242 | 3300026035 | Ga0207703_10001318 | Ga0207703_1000131816 | 396 |
| 243 | 3300026067 | Ga0207678_10045630 | Ga0207678_100456302 | 396 |
| 244 | 3300028380 | Ga0268265_10114509 | Ga0268265_101145092 | 396 |
| 245 | 3300031731 | Ga0307405_10196817 | Ga0307405_101968171 | 396 |
| 246 | 3300031824 | Ga0307413_10137532 | Ga0307413_101375322 | 396 |
| 247 | 3300031911 | Ga0307412_10041123 | Ga0307412_100411232 | 396 |
| 248 | 3300032002 | Ga0307416_100309466 | Ga0307416_1003094661 | 396 |
| 249 | 3300032005 | Ga0307411_10139741 | Ga0307411_101397412 | 396 |
| 250 | 3300046522 | Ga0495643_0017045 | Ga0495643_0017045_2982_4202 | 396 |
| 251 | 3300046616 | Ga0495668_0000076 | Ga0495668_0000076_51293_52513 | 396 |
| 252 | 3300046660 | Ga0495625_0000520 | Ga0495625_0000520_46172_47392 | 396 |
| 253 | 3300048903 | Ga0496100_0005025 | Ga0496100_0005025_4127_5353 | 396 |
| 254 | 3300048906 | Ga0496103_0117781 | Ga0496103_0117781_335_1561 | 396 |
| 255 | 3300048909 | Ga0496106_0004026 | Ga0496106_0004026_5410_6636 | 396 |
| 256 | 3300048910 | Ga0496107_0000221 | Ga0496107_0000221_14023_15249 | 396 |
| 257 | 3300048916 | Ga0496113_0015080 | Ga0496113_0015080_3263_4489 | 396 |
| 258 | 3300048924 | Ga0496121_0042197 | Ga0496121_0042197_1159_2361 | 396 |
| 259 | 3300048929 | Ga0496126_0000955 | Ga0496126_0000955_12091_13317 | 396 |
| 260 | 3300053116 | Ga0500592_001926 | Ga0500592_001926_551_1771 | 396 |
| 261 | 3300053151 | Ga0500604_0022012 | Ga0500604_0022012_20_1240 | 396 |
| 262 | 3300053158 | Ga0500627_0000100 | Ga0500627_0000100_20845_22065 | 396 |
| 263 | 3300005262 | Ga0065165_1005037 | Ga0065165_10050375 | 397 |
| 264 | 3300025913 | Ga0207695_10052359 | Ga0207695_100523595 | 397 |
| 265 | 3300025914 | Ga0207671_10002453 | Ga0207671_100024534 | 397 |
| 266 | 3300031456 | Ga0307513_10006540 | Ga0307513_100065408 | 397 |
| 267 | 3300046452 | Ga0495617_014504 | Ga0495617_014504_839_2071 | 397 |
| 268 | 3300046460 | Ga0495638_0001145 | Ga0495638_0001145_17069_18283 | 397 |
| 269 | 3300046471 | Ga0495650_0000158 | Ga0495650_0000158_55635_56867 | 397 |
| 270 | 3300046500 | Ga0495596_0000006 | Ga0495596_0000006_57134_58360 | 397 |
| 271 | 3300046501 | Ga0495607_0008886 | Ga0495607_0008886_4072_5298 | 397 |
| 272 | 3300046506 | Ga0495583_0000631 | Ga0495583_0000631_9824_11056 | 397 |
| 273 | 3300046507 | Ga0495606_0022008 | Ga0495606_0022008_2848_4074 | 397 |
| 274 | 3300046519 | Ga0495632_0029606 | Ga0495632_0029606_1030_2256 | 397 |
| 275 | 3300046522 | Ga0495643_0011201 | Ga0495643_0011201_60_1286 | 397 |
| 276 | 3300046558 | Ga0495633_0026130 | Ga0495633_0026130_1399_2631 | 397 |
| 277 | 3300046616 | Ga0495668_0077851 | Ga0495668_0077851_140_1366 | 397 |
| 278 | 3300046660 | Ga0495625_0027361 | Ga0495625_0027361_1294_2520 | 397 |
| 279 | 3300046665 | Ga0495661_0040380 | Ga0495661_0040380_1375_2607 | 397 |
| 280 | 3300046665 | Ga0495661_0072631 | Ga0495661_0072631_367_1593 | 397 |
| 281 | 3300047472 | Ga0495686_0010684 | Ga0495686_0010684_1688_2899 | 397 |
| 282 | 3300053134 | Ga0500658_0003688 | Ga0500658_0003688_3499_4713 | 397 |
| 283 | iso_pu_bacteria | 2643221563 | 2643834238 | 397 |
| 284 | iso_pu_bacteria | 2643221608 | 2644055163 | 397 |
| 285 | iso_pu_bacteria | 2852680915 | 2852684325 | 397 |
| 286 | iso_pu_bacteria | 3000865235 | 3000866873 | 397 |
| 287 | 3300005617 | Ga0068859_100010880 | Ga0068859_1000108802 | 398 |
| 288 | 3300005719 | Ga0068861_100000299 | Ga0068861_10000029921 | 398 |
| 289 | 3300006353 | Ga0075370_10003188 | Ga0075370_100031883 | 398 |
| 290 | 3300006881 | Ga0068865_100108501 | Ga0068865_1001085012 | 398 |
| 291 | 3300006931 | Ga0097620_100010880 | Ga0097620_1000108802 | 398 |
| 292 | 3300009177 | Ga0105248_10001023 | Ga0105248_1000102322 | 398 |
| 293 | 3300025941 | Ga0207711_10000912 | Ga0207711_100009128 | 398 |
| 294 | 3300026118 | Ga0207675_100000394 | Ga0207675_10000039422 | 398 |
| 295 | 3300028786 | Ga0307517_10014999 | Ga0307517_1001499910 | 398 |
| 296 | 3300032004 | Ga0307414_10180773 | Ga0307414_101807732 | 398 |
| 297 | 3300046453 | Ga0495627_000278 | Ga0495627_000278_40594_41853 | 398 |
| 298 | 3300046471 | Ga0495650_0003474 | Ga0495650_0003474_5959_7218 | 398 |
| 299 | 3300047470 | Ga0495681_0000974 | Ga0495681_0000974_11344_12603 | 398 |
| 300 | 3300047472 | Ga0495686_0000340 | Ga0495686_0000340_9743_10969 | 398 |
| 301 | 3300048924 | Ga0496121_0000347 | Ga0496121_0000347_70530_71741 | 398 |
| 302 | 3300053121 | Ga0500607_000009 | Ga0500607_000009_25401_26603 | 398 |
| 303 | 3300053136 | Ga0500559_0001649 | Ga0500559_0001649_8802_10004 | 398 |
| 304 | 3300053136 | Ga0500559_0015729 | Ga0500559_0015729_1731_2933 | 398 |
| 305 | 3300053178 | Ga0500637_0001397 | Ga0500637_0001397_4377_5579 | 398 |
| 306 | 3300053730 | Ga0500645_001762 | Ga0500645_001762_786_1988 | 398 |
| 307 | iso_pu_bacteria | 2919138771 | 2919143104 | 398 |
| 308 | 3300006042 | Ga0075368_10004412 | Ga0075368_100044121 | 399 |
| 309 | 3300006177 | Ga0075362_10004550 | Ga0075362_100045504 | 399 |
| 310 | 3300006178 | Ga0075367_10002649 | Ga0075367_1000264910 | 399 |
| 311 | 3300006195 | Ga0075366_10009143 | Ga0075366_100091435 | 399 |
| 312 | 3300006353 | Ga0075370_10016709 | Ga0075370_100167094 | 399 |
| 313 | 3300027866 | Ga0209813_10000060 | Ga0209813_1000006022 | 399 |
| 314 | 3300031731 | Ga0307405_10002903 | Ga0307405_100029034 | 399 |
| 315 | 3300031911 | Ga0307412_10010045 | Ga0307412_100100454 | 399 |
| 316 | 3300038443 | Ga0395901_0080949 | Ga0395901_0080949_331_1560 | 399 |
| 317 | 3300050489 | nmdc:mga03683_393_c1 | nmdc:mga03683_393_c1_8403_9605 | 399 |
| 318 | 3300050493 | nmdc:mga0k408_89124_c1 | nmdc:mga0k408_89124_c1_401_1603 | 399 |
| 319 | 3300050494 | nmdc:mga06z11_388_c1 | nmdc:mga06z11_388_c1_10465_11667 | 399 |
| 320 | 3300050495 | nmdc:mga04h51_73_c1 | nmdc:mga04h51_73_c1_21484_22686 | 399 |
| 321 | 3300050496 | nmdc:mga07m45_5_c2 | nmdc:mga07m45_5_c2_236827_238029 | 399 |
| 322 | 3300050516 | nmdc:mga0sz30_209_c1 | nmdc:mga0sz30_209_c1_7461_8663 | 399 |
| 323 | iso_pu_bacteria | 2738541275 | 2738710734 | 399 |
| 324 | iso_pu_bacteria | 2738541301 | 2738849159 | 399 |
| 325 | iso_pu_bacteria | 2738541304 | 2738864888 | 399 |
| 326 | iso_pu_bacteria | 2738543022 | 2739297406 | 399 |
| 327 | iso_pu_bacteria | 2738543033 | 2739359084 | 399 |
| 328 | iso_pu_bacteria | 2928100450 | 2928100837 | 399 |
| 329 | iso_pu_bacteria | 2928959182 | 2928960902 | 399 |
| 330 | 3300001979 | JGI24740J21852_10007561 | JGI24740J21852_100075615 | 400 |
| 331 | 3300001989 | JGI24739J22299_10008795 | JGI24739J22299_100087952 | 400 |
| 332 | 3300001990 | JGI24737J22298_10000905 | JGI24737J22298_100009052 | 400 |
| 333 | 3300003759 | Ga0055525_1000012 | Ga0055525_1000012325 | 400 |
| 334 | 3300003762 | Ga0055542_1000355 | Ga0055542_100035533 | 400 |
| 335 | 3300003763 | Ga0055529_1000045 | Ga0055529_1000045163 | 400 |
| 336 | 3300005327 | Ga0070658_10001571 | Ga0070658_1000157113 | 400 |
| 337 | 3300005330 | Ga0070690_100045048 | Ga0070690_1000450482 | 400 |
| 338 | 3300005331 | Ga0070670_100079503 | Ga0070670_1000795031 | 400 |
| 339 | 3300005339 | Ga0070660_100033442 | Ga0070660_1000334421 | 400 |
| 340 | 3300005344 | Ga0070661_100011035 | Ga0070661_1000110352 | 400 |
| 341 | 3300005347 | Ga0070668_100095230 | Ga0070668_1000952302 | 400 |
| 342 | 3300005356 | Ga0070674_100034152 | Ga0070674_1000341521 | 400 |
| 343 | 3300005367 | Ga0070667_100046664 | Ga0070667_1000466643 | 400 |
| 344 | 3300005457 | Ga0070662_100102594 | Ga0070662_1001025942 | 400 |
| 345 | 3300005539 | Ga0068853_100111428 | Ga0068853_1001114282 | 400 |
| 346 | 3300005563 | Ga0068855_100016252 | Ga0068855_1000162522 | 400 |
| 347 | 3300005564 | Ga0070664_100026441 | Ga0070664_1000264413 | 400 |
| 348 | 3300005614 | Ga0068856_100157129 | Ga0068856_1001571292 | 400 |
| 349 | 3300005834 | Ga0068851_10009573 | Ga0068851_100095735 | 400 |
| 350 | 3300006058 | Ga0075432_10001768 | Ga0075432_100017682 | 400 |
| 351 | 3300006186 | Ga0075369_10008054 | Ga0075369_100080542 | 400 |
| 352 | 3300006195 | Ga0075366_10011463 | Ga0075366_100114632 | 400 |
| 353 | 3300006353 | Ga0075370_10001111 | Ga0075370_100011114 | 400 |
| 354 | 3300006353 | Ga0075370_10028082 | Ga0075370_100280823 | 400 |
| 355 | 3300006946 | Ga0079104_1014634 | Ga0079104_10146342 | 400 |
| 356 | 3300009174 | Ga0105241_10069590 | Ga0105241_100695902 | 400 |
| 357 | 3300009551 | Ga0105238_10183084 | Ga0105238_101830842 | 400 |
| 358 | 3300010375 | Ga0105239_10135119 | Ga0105239_101351192 | 400 |
| 359 | 3300012513 | Ga0157326_1001490 | Ga0157326_10014902 | 400 |
| 360 | 3300013102 | Ga0157371_10000032 | Ga0157371_1000003282 | 400 |
| 361 | 3300013104 | Ga0157370_10163395 | Ga0157370_101633952 | 400 |
| 362 | 3300013105 | Ga0157369_10065036 | Ga0157369_100650363 | 400 |
| 363 | 3300017792 | Ga0163161_10135562 | Ga0163161_101355622 | 400 |
| 364 | 3300025230 | Ga0209563_100030 | Ga0209563_100030125 | 400 |
| 365 | 3300025253 | Ga0209677_107661 | Ga0209677_1076612 | 400 |
| 366 | 3300025254 | Ga0209148_1000011 | Ga0209148_1000011602 | 400 |
| 367 | 3300025272 | Ga0209455_1000006 | Ga0209455_1000006592 | 400 |
| 368 | 3300025297 | Ga0209758_1000001 | Ga0209758_1000001276 | 400 |
| 369 | 3300025321 | Ga0207656_10000378 | Ga0207656_100003788 | 400 |
| 370 | 3300025901 | Ga0207688_10085086 | Ga0207688_100850862 | 400 |
| 371 | 3300025904 | Ga0207647_10051147 | Ga0207647_100511472 | 400 |
| 372 | 3300025909 | Ga0207705_10006619 | Ga0207705_1000661910 | 400 |
| 373 | 3300025911 | Ga0207654_10005404 | Ga0207654_100054046 | 400 |
| 374 | 3300025913 | Ga0207695_10015610 | Ga0207695_100156102 | 400 |
| 375 | 3300025914 | Ga0207671_10008049 | Ga0207671_100080496 | 400 |
| 376 | 3300025919 | Ga0207657_10007801 | Ga0207657_100078019 | 400 |
| 377 | 3300025920 | Ga0207649_10000482 | Ga0207649_1000048212 | 400 |
| 378 | 3300025924 | Ga0207694_10038986 | Ga0207694_100389862 | 400 |
| 379 | 3300025932 | Ga0207690_10000696 | Ga0207690_1000069616 | 400 |
| 380 | 3300025945 | Ga0207679_10057954 | Ga0207679_100579543 | 400 |
| 381 | 3300025949 | Ga0207667_10000002 | Ga0207667_10000002332 | 400 |
| 382 | 3300025981 | Ga0207640_10000586 | Ga0207640_1000058614 | 400 |
| 383 | 3300026041 | Ga0207639_10006007 | Ga0207639_100060072 | 400 |
| 384 | 3300026067 | Ga0207678_10020590 | Ga0207678_100205907 | 400 |
| 385 | 3300026078 | Ga0207702_10076672 | Ga0207702_100766722 | 400 |
| 386 | 3300026116 | Ga0207674_10013772 | Ga0207674_100137729 | 400 |
| 387 | 3300026118 | Ga0207675_100188482 | Ga0207675_1001884822 | 400 |
| 388 | 3300026142 | Ga0207698_10005612 | Ga0207698_100056122 | 400 |
| 389 | 3300028379 | Ga0268266_10000002 | Ga0268266_100000021693 | 400 |
| 390 | 3300028786 | Ga0307517_10015806 | Ga0307517_100158067 | 400 |
| 391 | 3300031251 | Ga0265327_10020461 | Ga0265327_100204614 | 400 |
| 392 | 3300037312 | Ga0395899_0031849 | Ga0395899_0031849_588_1817 | 400 |
| 393 | 3300046474 | Ga0495605_0069596 | Ga0495605_0069596_71_1300 | 400 |
| 394 | 3300046492 | Ga0495585_0004856 | Ga0495585_0004856_6767_7996 | 400 |
| 395 | 3300046492 | Ga0495585_0052350 | Ga0495585_0052350_893_2122 | 400 |
| 396 | 3300046506 | Ga0495583_0020282 | Ga0495583_0020282_1403_2632 | 400 |
| 397 | 3300046507 | Ga0495606_0000672 | Ga0495606_0000672_21340_22569 | 400 |
| 398 | 3300046518 | Ga0495631_0008798 | Ga0495631_0008798_1026_2255 | 400 |
| 399 | 3300046520 | Ga0495637_0015883 | Ga0495637_0015883_1629_2858 | 400 |
| 400 | 3300046522 | Ga0495643_0003727 | Ga0495643_0003727_7759_8988 | 400 |
| 401 | 3300046522 | Ga0495643_0020288 | Ga0495643_0020288_1368_2597 | 400 |
| 402 | 3300046522 | Ga0495643_0021086 | Ga0495643_0021086_1972_3201 | 400 |
| 403 | 3300046524 | Ga0495648_0000143 | Ga0495648_0000143_43238_44467 | 400 |
| 404 | 3300046525 | Ga0495663_0001342 | Ga0495663_0001342_1427_2656 | 400 |
| 405 | 3300046528 | Ga0495642_0009263 | Ga0495642_0009263_1714_2943 | 400 |
| 406 | 3300046530 | Ga0495654_0020341 | Ga0495654_0020341_458_1666 | 400 |
| 407 | 3300046538 | Ga0495609_0032441 | Ga0495609_0032441_14_1243 | 400 |
| 408 | 3300046558 | Ga0495633_0004678 | Ga0495633_0004678_3661_4890 | 400 |
| 409 | 3300046616 | Ga0495668_0000016 | Ga0495668_0000016_298191_299420 | 400 |
| 410 | 3300046616 | Ga0495668_0051903 | Ga0495668_0051903_411_1613 | 400 |
| 411 | 3300046660 | Ga0495625_0000150 | Ga0495625_0000150_43285_44514 | 400 |
| 412 | 3300046660 | Ga0495625_0054961 | Ga0495625_0054961_1545_2774 | 400 |
| 413 | 3300046684 | Ga0495669_0000050 | Ga0495669_0000050_12846_14075 | 400 |
| 414 | 3300046810 | Ga0495660_0029202 | Ga0495660_0029202_227_1456 | 400 |
| 415 | 3300047323 | Ga0495683_0000963 | Ga0495683_0000963_9127_10356 | 400 |
| 416 | 3300047323 | Ga0495683_0009437 | Ga0495683_0009437_1140_2369 | 400 |
| 417 | 3300047443 | Ga0495687_001845 | Ga0495687_001845_11177_12406 | 400 |
| 418 | 3300047443 | Ga0495687_002183 | Ga0495687_002183_8917_10146 | 400 |
| 419 | 3300047470 | Ga0495681_0004732 | Ga0495681_0004732_4300_5529 | 400 |
| 420 | 3300048905 | Ga0496102_0000199 | Ga0496102_0000199_16832_18061 | 400 |
| 421 | 3300048906 | Ga0496103_0000633 | Ga0496103_0000633_9013_10242 | 400 |
| 422 | 3300048907 | Ga0496104_0011045 | Ga0496104_0011045_4141_5370 | 400 |
| 423 | 3300048908 | Ga0496105_0000690 | Ga0496105_0000690_16951_18180 | 400 |
| 424 | 3300048909 | Ga0496106_0184571 | Ga0496106_0184571_127_1356 | 400 |
| 425 | 3300048913 | Ga0496110_0112948 | Ga0496110_0112948_778_2007 | 400 |
| 426 | 3300048914 | Ga0496111_0032279 | Ga0496111_0032279_1428_2657 | 400 |
| 427 | 3300048917 | Ga0496114_0002491 | Ga0496114_0002491_7008_8237 | 400 |
| 428 | 3300048918 | Ga0496115_0000131 | Ga0496115_0000131_55048_56277 | 400 |
| 429 | 3300048919 | Ga0496116_0011618 | Ga0496116_0011618_2361_3590 | 400 |
| 430 | 3300048920 | Ga0496117_0000352 | Ga0496117_0000352_63303_64532 | 400 |
| 431 | 3300048921 | Ga0496118_0000092 | Ga0496118_0000092_151136_152365 | 400 |
| 432 | 3300048922 | Ga0496119_0004697 | Ga0496119_0004697_2471_3700 | 400 |
| 433 | 3300048923 | Ga0496120_0009062 | Ga0496120_0009062_182_1411 | 400 |
| 434 | 3300048924 | Ga0496121_0000228 | Ga0496121_0000228_55085_56314 | 400 |
| 435 | 3300048926 | Ga0496123_0022617 | Ga0496123_0022617_2984_4213 | 400 |
| 436 | 3300048927 | Ga0496124_0000081 | Ga0496124_0000081_55977_57206 | 400 |
| 437 | 3300048928 | Ga0496125_0000980 | Ga0496125_0000980_17687_18916 | 400 |
| 438 | 3300048929 | Ga0496126_0000283 | Ga0496126_0000283_16750_17979 | 400 |
| 439 | 3300049571 | Ga0501034_0408031 | Ga0501034_0408031_48_1271 | 400 |
| 440 | 3300050493 | nmdc:mga0k408_10130_c1 | nmdc:mga0k408_10130_c1_3077_4306 | 400 |
| 441 | 3300050516 | nmdc:mga0sz30_33943_c1 | nmdc:mga0sz30_33943_c1_354_1583 | 400 |
| 442 | 3300053079 | Ga0500610_0009443 | Ga0500610_0009443_1679_2908 | 400 |
| 443 | 3300053130 | Ga0500642_0000393 | Ga0500642_0000393_9897_11126 | 400 |
| 444 | 3300053153 | Ga0500616_0003363 | Ga0500616_0003363_4918_6144 | 400 |
| 445 | 3300053154 | Ga0500619_013931 | Ga0500619_013931_674_1915 | 400 |
| 446 | 3300053156 | Ga0500622_0000253 | Ga0500622_0000253_28971_30173 | 400 |
| 447 | 3300053730 | Ga0500645_000002 | Ga0500645_000002_20018_21247 | 400 |
| 448 | iso_pu_bacteria | 2643221588 | 2643948371 | 400 |
| 449 | iso_pu_bacteria | 2739367664 | 2739651271 | 400 |
| 450 | iso_pu_bacteria | 2739367865 | 2740029744 | 400 |
| 451 | 3300006195 | Ga0075366_10004768 | Ga0075366_100047686 | 401 |
| 452 | 3300044735 | Ga0466968_0013146 | Ga0466968_0013146_1341_2564 | 401 |
| 453 | 3300050493 | nmdc:mga0k408_1586_c2 | nmdc:mga0k408_1586_c2_927_2135 | 401 |
| 454 | 3300050496 | nmdc:mga07m45_2163_c1 | nmdc:mga07m45_2163_c1_4386_5600 | 401 |
| 455 | 3300053087 | Ga0500643_000001 | Ga0500643_000001_361055_362284 | 401 |
| 456 | 3300053096 | Ga0500641_0065873 | Ga0500641_0065873_177_1412 | 401 |
| 457 | 3300053140 | Ga0500573_0055338 | Ga0500573_0055338_637_1866 | 401 |
| 458 | iso_pu_bacteria | 2896184354 | 2896186614 | 401 |
| 459 | iso_pu_bacteria | 2896253425 | 2896254382 | 401 |
| 460 | 3300005289 | Ga0065704_10084596 | Ga0065704_100845962 | 402 |
| 461 | 3300005331 | Ga0070670_100054077 | Ga0070670_1000540773 | 402 |
| 462 | 3300005353 | Ga0070669_100000139 | Ga0070669_10000013947 | 402 |
| 463 | 3300005548 | Ga0070665_100000101 | Ga0070665_100000101153 | 402 |
| 464 | 3300005841 | Ga0068863_100017402 | Ga0068863_1000174022 | 402 |
| 465 | 3300005842 | Ga0068858_100057331 | Ga0068858_1000573312 | 402 |
| 466 | 3300005844 | Ga0068862_100028918 | Ga0068862_1000289182 | 402 |
| 467 | 3300009011 | Ga0105251_10001250 | Ga0105251_1000125023 | 402 |
| 468 | 3300009101 | Ga0105247_10010323 | Ga0105247_100103235 | 402 |
| 469 | 3300009177 | Ga0105248_10184415 | Ga0105248_101844152 | 402 |
| 470 | 3300009553 | Ga0105249_10163607 | Ga0105249_101636072 | 402 |
| 471 | 3300025735 | Ga0207713_1003912 | Ga0207713_10039125 | 402 |
| 472 | 3300025923 | Ga0207681_10000179 | Ga0207681_100001795 | 402 |
| 473 | 3300025931 | Ga0207644_10001696 | Ga0207644_100016966 | 402 |
| 474 | 3300025941 | Ga0207711_10004180 | Ga0207711_100041802 | 402 |
| 475 | 3300025986 | Ga0207658_10027744 | Ga0207658_100277442 | 402 |
| 476 | 3300026088 | Ga0207641_10017539 | Ga0207641_100175392 | 402 |
| 477 | 3300028379 | Ga0268266_10000239 | Ga0268266_1000023947 | 402 |
| 478 | 3300031852 | Ga0307410_10109452 | Ga0307410_101094522 | 402 |
| 479 | 3300048919 | Ga0496116_0016826 | Ga0496116_0016826_880_2127 | 402 |
| 480 | 3300048921 | Ga0496118_0077898 | Ga0496118_0077898_201_1448 | 402 |
| 481 | 3300048922 | Ga0496119_0026586 | Ga0496119_0026586_2241_3488 | 402 |
| 482 | 3300048923 | Ga0496120_0029800 | Ga0496120_0029800_640_1887 | 402 |
| 483 | 3300048926 | Ga0496123_0031503 | Ga0496123_0031503_1773_3020 | 402 |
| 484 | 3300048928 | Ga0496125_0086169 | Ga0496125_0086169_232_1479 | 402 |
| 485 | iso_pu_bacteria | 2895880812 | 2895884788 | 402 |
| 486 | 3300005327 | Ga0070658_10010285 | Ga0070658_100102855 | 403 |
| 487 | 3300005327 | Ga0070658_10014487 | Ga0070658_100144874 | 403 |
| 488 | 3300005327 | Ga0070658_10108164 | Ga0070658_101081642 | 403 |
| 489 | 3300005329 | Ga0070683_100003226 | Ga0070683_10000322614 | 403 |
| 490 | 3300005336 | Ga0070680_100010656 | Ga0070680_1000106562 | 403 |
| 491 | 3300005339 | Ga0070660_100002160 | Ga0070660_1000021606 | 403 |
| 492 | 3300005344 | Ga0070661_100001061 | Ga0070661_10000106112 | 403 |
| 493 | 3300005366 | Ga0070659_100008276 | Ga0070659_1000082764 | 403 |
| 494 | 3300005457 | Ga0070662_100001696 | Ga0070662_1000016962 | 403 |
| 495 | 3300005458 | Ga0070681_10005920 | Ga0070681_1000592011 | 403 |
| 496 | 3300005530 | Ga0070679_100004469 | Ga0070679_1000044696 | 403 |
| 497 | 3300005530 | Ga0070679_100015815 | Ga0070679_1000158154 | 403 |
| 498 | 3300005530 | Ga0070679_100020119 | Ga0070679_1000201193 | 403 |
| 499 | 3300005535 | Ga0070684_100029316 | Ga0070684_1000293162 | 403 |
| 500 | 3300005539 | Ga0068853_100008054 | Ga0068853_1000080544 | 403 |
| 501 | 3300005563 | Ga0068855_100004017 | Ga0068855_10000401714 | 403 |
| 502 | 3300005564 | Ga0070664_100038836 | Ga0070664_1000388362 | 403 |
| 503 | 3300005577 | Ga0068857_100193542 | Ga0068857_1001935422 | 403 |
| 504 | 3300005578 | Ga0068854_100037775 | Ga0068854_1000377752 | 403 |
| 505 | 3300005614 | Ga0068856_100049867 | Ga0068856_1000498672 | 403 |
| 506 | 3300010375 | Ga0105239_10059536 | Ga0105239_100595362 | 403 |
| 507 | 3300013100 | Ga0157373_10005198 | Ga0157373_100051984 | 403 |
| 508 | 3300013102 | Ga0157371_10001531 | Ga0157371_100015319 | 403 |
| 509 | 3300013104 | Ga0157370_10004317 | Ga0157370_1000431711 | 403 |
| 510 | 3300013105 | Ga0157369_10002247 | Ga0157369_1000224714 | 403 |
| 511 | 3300013307 | Ga0157372_10004467 | Ga0157372_100044676 | 403 |
| 512 | 3300025909 | Ga0207705_10000637 | Ga0207705_1000063726 | 403 |
| 513 | 3300025909 | Ga0207705_10009600 | Ga0207705_100096004 | 403 |
| 514 | 3300025909 | Ga0207705_10011018 | Ga0207705_100110184 | 403 |
| 515 | 3300025912 | Ga0207707_10065315 | Ga0207707_100653153 | 403 |
| 516 | 3300025917 | Ga0207660_10005603 | Ga0207660_100056034 | 403 |
| 517 | 3300025919 | Ga0207657_10001083 | Ga0207657_1000108319 | 403 |
| 518 | 3300025919 | Ga0207657_10016392 | Ga0207657_100163924 | 403 |
| 519 | 3300025921 | Ga0207652_10002246 | Ga0207652_100022466 | 403 |
| 520 | 3300025921 | Ga0207652_10005534 | Ga0207652_100055345 | 403 |
| 521 | 3300025921 | Ga0207652_10026805 | Ga0207652_100268054 | 403 |
| 522 | 3300025932 | Ga0207690_10000506 | Ga0207690_1000050615 | 403 |
| 523 | 3300025932 | Ga0207690_10078656 | Ga0207690_100786562 | 403 |
| 524 | 3300025932 | Ga0207690_10094020 | Ga0207690_100940202 | 403 |
| 525 | 3300025933 | Ga0207706_10002162 | Ga0207706_100021625 | 403 |
| 526 | 3300025944 | Ga0207661_10124085 | Ga0207661_101240852 | 403 |
| 527 | 3300025945 | Ga0207679_10026833 | Ga0207679_100268332 | 403 |
| 528 | 3300025949 | Ga0207667_10005551 | Ga0207667_1000555113 | 403 |
| 529 | 3300025949 | Ga0207667_10293038 | Ga0207667_102930381 | 403 |
| 530 | 3300025981 | Ga0207640_10040599 | Ga0207640_100405993 | 403 |
| 531 | 3300026041 | Ga0207639_10001972 | Ga0207639_100019728 | 403 |
| 532 | 3300026067 | Ga0207678_10030203 | Ga0207678_100302034 | 403 |
| 533 | 3300026078 | Ga0207702_10017889 | Ga0207702_100178892 | 403 |
| 534 | 3300026116 | Ga0207674_10031161 | Ga0207674_100311615 | 403 |
| 535 | 3300026116 | Ga0207674_10049550 | Ga0207674_100495502 | 403 |
| 536 | 3300049570 | Ga0501033_0110216 | Ga0501033_0110216_749_1981 | 403 |
| 537 | 3300049572 | Ga0501036_0043827 | Ga0501036_0043827_762_1994 | 403 |
| 538 | 3300049581 | Ga0501047_0194909 | Ga0501047_0194909_186_1418 | 403 |
| 539 | 3300006353 | Ga0075370_10017832 | Ga0075370_100178322 | 404 |
| 540 | 3300009148 | Ga0105243_10013621 | Ga0105243_100136215 | 404 |
| 541 | 3300013306 | Ga0163162_10086963 | Ga0163162_100869632 | 404 |
| 542 | 3300025935 | Ga0207709_10046285 | Ga0207709_100462852 | 404 |
| 543 | 3300027876 | Ga0209974_10001551 | Ga0209974_100015512 | 404 |
| 544 | 3300031548 | Ga0307408_100021871 | Ga0307408_1000218712 | 404 |
| 545 | 3300032002 | Ga0307416_100017737 | Ga0307416_1000177373 | 404 |
| 546 | 3300032005 | Ga0307411_10013678 | Ga0307411_100136785 | 404 |
| 547 | 3300032126 | Ga0307415_100088977 | Ga0307415_1000889772 | 404 |
| 548 | 3300045051 | Ga0451576_0000024 | Ga0451576_0000024_454093_455334 | 404 |
| 549 | 3300046475 | Ga0495639_0046696 | Ga0495639_0046696_543_1781 | 404 |
| 550 | 3300046530 | Ga0495654_0082184 | Ga0495654_0082184_192_1430 | 404 |
| 551 | 3300053138 | Ga0500564_001534 | Ga0500564_001534_4498_5736 | 404 |
| 552 | 3300053729 | Ga0500625_000005 | Ga0500625_000005_175514_176752 | 404 |
| 553 | iso_pu_bacteria | 2848297114 | 2848298819 | 404 |
| 554 | iso_pu_bacteria | 8054302542 | 8054303122 | 404 |
| 555 | 3300005289 | Ga0065704_10001580 | Ga0065704_1000158013 | 405 |
| 556 | 3300005327 | Ga0070658_10016667 | Ga0070658_100166674 | 405 |
| 557 | 3300005347 | Ga0070668_100000650 | Ga0070668_10000065019 | 405 |
| 558 | 3300005353 | Ga0070669_100002049 | Ga0070669_10000204911 | 405 |
| 559 | 3300005355 | Ga0070671_100001672 | Ga0070671_1000016728 | 405 |
| 560 | 3300005367 | Ga0070667_100002441 | Ga0070667_10000244111 | 405 |
| 561 | 3300005548 | Ga0070665_100001723 | Ga0070665_10000172318 | 405 |
| 562 | 3300005841 | Ga0068863_100172959 | Ga0068863_1001729592 | 405 |
| 563 | 3300005843 | Ga0068860_100011153 | Ga0068860_1000111537 | 405 |
| 564 | 3300006177 | Ga0075362_10010458 | Ga0075362_100104583 | 405 |
| 565 | 3300009553 | Ga0105249_10022999 | Ga0105249_100229994 | 405 |
| 566 | 3300013306 | Ga0163162_10027215 | Ga0163162_100272152 | 405 |
| 567 | 3300025711 | Ga0207696_1002899 | Ga0207696_10028992 | 405 |
| 568 | 3300025735 | Ga0207713_1005617 | Ga0207713_10056177 | 405 |
| 569 | 3300025923 | Ga0207681_10000467 | Ga0207681_1000046718 | 405 |
| 570 | 3300025931 | Ga0207644_10009126 | Ga0207644_100091267 | 405 |
| 571 | 3300025961 | Ga0207712_10031707 | Ga0207712_100317073 | 405 |
| 572 | 3300025972 | Ga0207668_10000523 | Ga0207668_100005236 | 405 |
| 573 | 3300025986 | Ga0207658_10002340 | Ga0207658_100023409 | 405 |
| 574 | 3300028379 | Ga0268266_10001120 | Ga0268266_100011208 | 405 |
| 575 | 3300028380 | Ga0268265_10057401 | Ga0268265_100574013 | 405 |
| 576 | 3300028381 | Ga0268264_10011204 | Ga0268264_100112046 | 405 |
| 577 | 3300031911 | Ga0307412_10119984 | Ga0307412_101199841 | 405 |
| 578 | 3300032004 | Ga0307414_10144064 | Ga0307414_101440641 | 405 |
| 579 | 3300036712 | Ga0316584_0014468 | Ga0316584_0014468_1581_2834 | 405 |
| 580 | 3300048905 | Ga0496102_0000856 | Ga0496102_0000856_11880_13121 | 405 |
| 581 | 3300048906 | Ga0496103_0000140 | Ga0496103_0000140_17240_18481 | 405 |
| 582 | 3300048907 | Ga0496104_0001582 | Ga0496104_0001582_18107_19348 | 405 |
| 583 | 3300048908 | Ga0496105_0005353 | Ga0496105_0005353_7176_8417 | 405 |
| 584 | 3300048910 | Ga0496107_0041029 | Ga0496107_0041029_1186_2427 | 405 |
| 585 | 3300048915 | Ga0496112_0003754 | Ga0496112_0003754_5303_6544 | 405 |
| 586 | 3300048916 | Ga0496113_0000197 | Ga0496113_0000197_17246_18487 | 405 |
| 587 | 3300048918 | Ga0496115_0051369 | Ga0496115_0051369_2051_3292 | 405 |
| 588 | 3300048919 | Ga0496116_0058238 | Ga0496116_0058238_812_2053 | 405 |
| 589 | 3300048920 | Ga0496117_0000331 | Ga0496117_0000331_7032_8273 | 405 |
| 590 | 3300048921 | Ga0496118_0003689 | Ga0496118_0003689_11327_12568 | 405 |
| 591 | 3300048923 | Ga0496120_0005607 | Ga0496120_0005607_8245_9486 | 405 |
| 592 | 3300048924 | Ga0496121_0037720 | Ga0496121_0037720_1684_2925 | 405 |
| 593 | 3300048925 | Ga0496122_0031341 | Ga0496122_0031341_2772_4013 | 405 |
| 594 | 3300048926 | Ga0496123_0009148 | Ga0496123_0009148_543_1784 | 405 |
| 595 | 3300048927 | Ga0496124_0002273 | Ga0496124_0002273_22618_23859 | 405 |
| 596 | 3300048928 | Ga0496125_0003982 | Ga0496125_0003982_13370_14611 | 405 |
| 597 | 3300048929 | Ga0496126_0000051 | Ga0496126_0000051_17271_18512 | 405 |
| 598 | 3300050489 | nmdc:mga03683_24257_c1 | nmdc:mga03683_24257_c1_1044_2288 | 405 |
| 599 | 3300053125 | Ga0500618_000211 | Ga0500618_000211_36126_37349 | 405 |
| 600 | 3300053148 | Ga0500590_000367 | Ga0500590_000367_8364_9701 | 405 |
| 601 | 3300005366 | Ga0070659_100088796 | Ga0070659_1000887963 | 407 |
| 602 | 3300006051 | Ga0075364_10020007 | Ga0075364_100200074 | 407 |
| 603 | 3300006177 | Ga0075362_10076030 | Ga0075362_100760301 | 407 |
| 604 | 3300013308 | Ga0157375_10430563 | Ga0157375_104305632 | 407 |
| 605 | 3300025944 | Ga0207661_10004071 | Ga0207661_100040715 | 407 |
| 606 | 3300045051 | Ga0451576_0162645 | Ga0451576_0162645_308_1558 | 407 |
| 607 | 3300048929 | Ga0496126_0075909 | Ga0496126_0075909_553_1800 | 407 |
| 608 | 3300050489 | nmdc:mga03683_45295_c1 | nmdc:mga03683_45295_c1_65_1291 | 407 |
| 609 | 3300050491 | nmdc:mga00v17_1341_c1 | nmdc:mga00v17_1341_c1_6946_8172 | 407 |
| 610 | 3300002459 | JGI24751J29686_10000084 | JGI24751J29686_100000843 | 408 |
| 611 | 3300002459 | JGI24751J29686_10000279 | JGI24751J29686_1000027918 | 408 |
| 612 | 3300005289 | Ga0065704_10070184 | Ga0065704_1007018411 | 408 |
| 613 | 3300005327 | Ga0070658_10000144 | Ga0070658_1000014424 | 408 |
| 614 | 3300005614 | Ga0068856_100018169 | Ga0068856_1000181694 | 408 |
| 615 | 3300005614 | Ga0068856_100241157 | Ga0068856_1002411572 | 408 |
| 616 | 3300005616 | Ga0068852_100000273 | Ga0068852_10000027328 | 408 |
| 617 | 3300005616 | Ga0068852_100006730 | Ga0068852_1000067304 | 408 |
| 618 | 3300005843 | Ga0068860_100012804 | Ga0068860_1000128045 | 408 |
| 619 | 3300009093 | Ga0105240_10001369 | Ga0105240_100013692 | 408 |
| 620 | 3300009093 | Ga0105240_10248869 | Ga0105240_102488692 | 408 |
| 621 | 3300025904 | Ga0207647_10013331 | Ga0207647_100133312 | 408 |
| 622 | 3300025909 | Ga0207705_10000155 | Ga0207705_1000015538 | 408 |
| 623 | 3300025924 | Ga0207694_10024085 | Ga0207694_100240854 | 408 |
| 624 | 3300026078 | Ga0207702_10013356 | Ga0207702_100133564 | 408 |
| 625 | 3300026078 | Ga0207702_10273642 | Ga0207702_102736421 | 408 |
| 626 | 3300026142 | Ga0207698_10000179 | Ga0207698_1000017928 | 408 |
| 627 | 3300026142 | Ga0207698_10011951 | Ga0207698_100119511 | 408 |
| 628 | 3300026142 | Ga0207698_10255246 | Ga0207698_102552462 | 408 |
| 629 | 3300046500 | Ga0495596_0000830 | Ga0495596_0000830_11696_12922 | 408 |
| 630 | 3300046512 | Ga0495610_0000116 | Ga0495610_0000116_61699_62925 | 408 |
| 631 | 3300046512 | Ga0495610_0001706 | Ga0495610_0001706_949_2175 | 408 |
| 632 | 3300048090 | Ga0495615_0000126 | Ga0495615_0000126_3952_5178 | 408 |
| 633 | 3300048091 | Ga0495626_0000165 | Ga0495626_0000165_24615_25841 | 408 |
| 634 | 3300048919 | Ga0496116_0000035 | Ga0496116_0000035_321272_322498 | 408 |
| 635 | 3300048921 | Ga0496118_0008603 | Ga0496118_0008603_5477_6703 | 408 |
| 636 | 3300048924 | Ga0496121_0001542 | Ga0496121_0001542_23494_24720 | 408 |
| 637 | 3300048925 | Ga0496122_0005106 | Ga0496122_0005106_3841_5067 | 408 |
| 638 | 3300048926 | Ga0496123_0000159 | Ga0496123_0000159_113471_114697 | 408 |
| 639 | 3300048926 | Ga0496123_0002869 | Ga0496123_0002869_15214_16440 | 408 |
| 640 | 3300048927 | Ga0496124_0002527 | Ga0496124_0002527_3708_4934 | 408 |
| 641 | 3300048927 | Ga0496124_0098846 | Ga0496124_0098846_331_1557 | 408 |
| 642 | 3300048928 | Ga0496125_0043169 | Ga0496125_0043169_2526_3752 | 408 |
| 643 | 3300048929 | Ga0496126_0000077 | Ga0496126_0000077_103794_105020 | 408 |
| 644 | 3300005844 | Ga0068862_100004597 | Ga0068862_1000045974 | 409 |
| 645 | 3300009101 | Ga0105247_10035453 | Ga0105247_100354533 | 409 |
| 646 | 3300009147 | Ga0114129_10183624 | Ga0114129_101836243 | 409 |
| 647 | 3300025900 | Ga0207710_10015220 | Ga0207710_100152203 | 409 |
| 648 | 3300028380 | Ga0268265_10001670 | Ga0268265_1000167017 | 409 |
| 649 | 3300049581 | Ga0501047_0103401 | Ga0501047_0103401_254_1519 | 410 |
| 650 | 2162886007 | SwRhRL2b_contig_2139679 | SwRhRL2b_0810.00002100 | 412 |
| 651 | 3300025298 | Ga0209050_1000127 | Ga0209050_10001274 | 412 |
| 652 | iso_pu_bacteria | 2818991438 | 2819552212 | 412 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6s8g-assembly1.cif.gz_F | cryo-em structure of lptb2fgc in complex with amp-pnp | 0.8884 | 10 | 365 |
| 6s8n-assembly1.cif.gz_F | cryo-em structure of lptb2fgc in complex with lipopolysaccharide | 0.8871 | 10 | 365 |
| 6s8g-assembly1.cif.gz_F | cryo-em structure of lptb2fgc in complex with amp-pnp | 0.86 | 10 | 365 |
| 7efo-assembly1.cif.gz_F | lptb2fg-lps from klebsiella pneumoniae in nanodiscs | 0.8583 | 10 | 366 |
| 6s8n-assembly1.cif.gz_F | cryo-em structure of lptb2fgc in complex with lipopolysaccharide | 0.8559 | 10 | 365 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q4D131_41_117_2.30.30.100 | Mainly Beta;Roll;SH3 type barrels.; | 0.5946 | 179 | 242 | 2.30.30.100 |
| af_P32774_58_118_2.30.18.10 | Mainly Beta;Roll;TATA box binding Protein, subunit D; domain 2;Transcription factor IIA (TFIIA), beta-barrel domain | 0.5793 | 193 | 243 | 2.30.18.10 |
| af_Q7K010_1_97_1.20.5.110 | Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; | 0.5334 | 262 | 335 | 1.20.5.110 |
| af_O74483_1_71_2.30.30.100 | Mainly Beta;Roll;SH3 type barrels.; | 0.5109 | 184 | 240 | 2.30.30.100 |
| af_P32774_58_118_2.30.18.10 | Mainly Beta;Roll;TATA box binding Protein, subunit D; domain 2;Transcription factor IIA (TFIIA), beta-barrel domain | 0.4888 | 193 | 243 | 2.30.18.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A522AD52-F1-model_v4 | LptF/LptG family permease | 0.9475 | 10 | 143 |
GO:0015920
GO:0043190 |
| AF-A0A356E3V0-F1-model_v4 | Permease | 0.9468 | 11 | 143 |
GO:0015920
GO:0043190 |
| AF-A0A3C1WIC5-F1-model_v4 | YjgP/YjgQ family permease | 0.9299 | 9 | 130 |
GO:0015920
GO:0043190 |
| AF-A0A651FW52-F1-model_v4 | LptF/LptG family permease | 0.9262 | 12 | 147 |
GO:0015920
GO:0043190 |
| AF-A0A432HXB4-F1-model_v4 | LptF/LptG family permease | 0.917 | 9 | 147 |
GO:0015920
GO:0043190 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar