F472682

General Info

Members Datasets Scaffolds Average Seq Length
652 315 617 402

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10183624|Ga0114129_101836243
Length 454
Sequence MAIHSRAFRTLADCAFRGKPGTAKAGRPPVRRRFLEAIRRMPFLTANDRYIGKLVLVPMLGTFVLAASLLILDKMLRLFDFVASEGGPVGVVFRMLANLIPEYAGLAIPIGLMLGILLAFRKLATSSELDVMRAVGLSYTRLLRVPYIFALILAGLNLVNVFYLQPLSHYYYEALQYELRSGALGAAIKVGEFTTLKDKVALRIEESAENGRKLSGIFARVANDKGQVLAISARQGQFLANKDSPDTIILRLTDGQIVQDGPKLATPRVLTFSSHDLPIDLPKIEEFRQRGGKEKEYILPELLKLGWNKASPAALRNETQASFSYRMVEVVMMLLLPLMAVALAIPPKRSTSALGVFVSIIMVVAYHKVNQYASDVAALGRLDPILALWVPFAVFAALIVWMYWRVAYVPGGQAIGGLERGFAKLSATFRKLFGRKRLPDEPELDEFEGQPVAA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
3 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
4 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
5 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
6 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
7 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
8 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
9 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
10 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
11 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
12 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
13 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
14 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
15 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
16 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
17 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
18 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
19 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
20 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
21 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
22 2896184354 Aurantiacibacter suaedae GH3-15 Isolate Rhizosphere
23 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
24 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
25 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
26 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
27 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
28 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
29 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
30 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
31 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
32 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
33 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
34 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
35 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
36 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
37 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
38 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
39 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
40 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
41 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
42 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
43 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
44 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
45 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
46 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
47 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
48 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
49 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
50 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
51 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
52 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
53 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
54 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
55 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
56 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
57 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
58 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
59 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
60 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
61 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
62 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
63 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
64 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
65 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
66 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
67 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
68 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
69 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
70 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
71 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
72 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
73 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
74 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
75 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
76 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
77 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
78 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
79 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
80 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
81 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
82 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
83 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
84 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
85 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
86 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
87 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
88 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
89 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
90 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
91 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
92 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
93 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
94 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
95 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
97 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
98 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
99 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
100 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
101 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
102 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
103 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
104 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
105 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
107 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
108 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
109 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
110 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
111 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
112 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
113 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
114 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
115 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
116 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
117 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
118 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
119 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
120 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
121 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
122 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
123 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
124 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
125 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
129 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
131 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
133 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
181 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
186 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
187 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
188 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
189 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
190 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
191 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
192 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
193 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
194 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
195 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
196 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
197 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
198 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
199 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
200 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
201 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
202 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
203 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
204 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
205 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
206 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
207 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
208 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
209 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
210 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
211 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
212 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
213 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
214 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
215 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
216 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
217 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
218 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
219 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
220 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
221 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
222 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
223 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
224 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
225 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
226 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
227 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
228 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
229 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
230 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
231 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
232 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
233 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
234 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
235 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
236 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
237 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
238 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
239 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
240 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
241 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
242 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
243 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
244 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
245 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
246 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
247 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
248 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
249 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
250 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
251 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
252 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
253 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
254 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
255 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
256 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
257 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
258 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
259 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
260 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
261 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
262 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
263 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
264 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
265 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
266 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
267 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
275 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
276 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
277 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
278 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
279 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
281 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
282 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
283 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
284 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
285 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
286 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
287 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
288 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
289 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
290 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
291 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
292 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
293 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
294 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
295 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
296 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
297 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
298 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
299 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
300 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
301 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
302 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
303 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
304 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
305 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
306 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
307 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
308 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
309 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
310 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
311 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
312 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
313 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
314 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere
315 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.63
Metatranscriptomes 0
Isolates 5.37

Biome Distribution

Category Percentage (%)
Aerial Root 0.77
Bulb 0
Endosphere 14.88
Nodule 0.15
Rhizoplane 3.99
Rhizosphere 69.02
Stem 0
Stem Tuber 0
Unclassified 11.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2139679 2162886007 Bacteria 32324
2 JGI24740J21852_10007561 3300001979 Bacteria 4401
3 JGI24739J22299_10008795 3300001989 Bacteria 3766
4 JGI24737J22298_10000905 3300001990 Bacteria 10542
5 JGI24751J29686_10000084 3300002459 Bacteria 52362
6 JGI24751J29686_10000279 3300002459 Bacteria 19854
7 JGI25165J46597_1000012 3300003214 Bacteria 421074
8 Ga0055525_1000012 3300003759 Bacteria 486564
9 Ga0055542_1000355 3300003762 Bacteria 48043
10 Ga0055529_1000045 3300003763 Bacteria 209617
11 Ga0055536_1002179 3300003781 Bacteria 11164
12 Ga0055536_1004597 3300003781 Bacteria 6995
13 Ga0055530_10002097 3300003791 Bacteria 13320
14 Ga0055531_10019563 3300003794 Bacteria 2732
15 Ga0065165_1005037 3300005262 Bacteria 7720
16 Ga0065704_10001580 3300005289 Bacteria 14798
17 Ga0065704_10070184 3300005289 Bacteria 119655
18 Ga0065704_10083691 3300005289 Bacteria 3431
19 Ga0065704_10084596 3300005289 Bacteria 3318
20 Ga0065704_10155604 3300005289 Bacteria 1393
21 Ga0065707_10084966 3300005295 Bacteria 6594
22 Ga0065707_10096660 3300005295 Bacteria 3247
23 Ga0070658_10000144 3300005327 Bacteria 63113
24 Ga0070658_10001571 3300005327 Bacteria 19350
25 Ga0070658_10010285 3300005327 Bacteria 7504
26 Ga0070658_10014487 3300005327 Bacteria 6327
27 Ga0070658_10016667 3300005327 Bacteria 5881
28 Ga0070658_10108164 3300005327 Bacteria 2301
29 Ga0070683_100003226 3300005329 Bacteria 13165
30 Ga0070690_100045048 3300005330 Bacteria 2801
31 Ga0070670_100054077 3300005331 Bacteria 3446
32 Ga0070670_100079503 3300005331 Bacteria 2818
33 Ga0068869_100084489 3300005334 Bacteria 2376
34 Ga0070680_100007121 3300005336 Bacteria 8522
35 Ga0070680_100010656 3300005336 Bacteria 7092
36 Ga0070660_100002160 3300005339 Bacteria 13552
37 Ga0070660_100033442 3300005339 Bacteria 3876
38 Ga0070660_100093279 3300005339 Bacteria 2377
39 Ga0070660_100207781 3300005339 Bacteria 1589
40 Ga0070661_100001061 3300005344 Bacteria 19494
41 Ga0070661_100011035 3300005344 Bacteria 6294
42 Ga0070668_100000650 3300005347 Bacteria 23492
43 Ga0070668_100016290 3300005347 Bacteria 5559
44 Ga0070668_100095230 3300005347 Bacteria 2352
45 Ga0070668_100152206 3300005347 Bacteria 1871
46 Ga0070669_100000139 3300005353 Bacteria 64859
47 Ga0070669_100002049 3300005353 Bacteria 14579
48 Ga0070669_100005390 3300005353 Bacteria 9227
49 Ga0070671_100001672 3300005355 Bacteria 16786
50 Ga0070671_100010917 3300005355 Bacteria 7295
51 Ga0070671_100019173 3300005355 Bacteria 5565
52 Ga0070674_100034152 3300005356 Bacteria 3394
53 Ga0070674_100262863 3300005356 Bacteria 1360
54 Ga0070659_100008276 3300005366 Bacteria 7594
55 Ga0070659_100010584 3300005366 Bacteria 6792
56 Ga0070659_100088796 3300005366 Bacteria 2476
57 Ga0070659_100092449 3300005366 Bacteria 2426
58 Ga0070667_100000281 3300005367 Bacteria 58155
59 Ga0070667_100002441 3300005367 Bacteria 16246
60 Ga0070667_100005899 3300005367 Bacteria 10197
61 Ga0070667_100046664 3300005367 Bacteria 3645
62 Ga0070667_100209069 3300005367 Bacteria 1734
63 Ga0070714_100102887 3300005435 Bacteria 2519
64 Ga0070663_100004975 3300005455 Bacteria 7848
65 Ga0070678_100000495 3300005456 Bacteria 18911
66 Ga0070662_100001696 3300005457 Bacteria 13542
67 Ga0070662_100022716 3300005457 Bacteria 4298
68 Ga0070662_100102594 3300005457 Bacteria 2168
69 Ga0070681_10005920 3300005458 Bacteria 11833
70 Ga0068867_100009199 3300005459 Bacteria 6974
71 Ga0070679_100004469 3300005530 Bacteria 12915
72 Ga0070679_100015815 3300005530 Bacteria 7259
73 Ga0070679_100020119 3300005530 Bacteria 6504
74 Ga0070684_100029316 3300005535 Bacteria 4662
75 Ga0068853_100008054 3300005539 Bacteria 8451
76 Ga0068853_100020273 3300005539 Bacteria 5528
77 Ga0068853_100111428 3300005539 Bacteria 2431
78 Ga0070672_100169697 3300005543 Bacteria 1814
79 Ga0070665_100000101 3300005548 Bacteria 159353
80 Ga0070665_100001723 3300005548 Bacteria 25051
81 Ga0070665_100008606 3300005548 Bacteria 10325
82 Ga0068855_100004017 3300005563 Bacteria 17971
83 Ga0068855_100016252 3300005563 Bacteria 8949
84 Ga0068855_100032690 3300005563 Bacteria 6211
85 Ga0068855_100073414 3300005563 Bacteria 3974
86 Ga0070664_100026441 3300005564 Bacteria 4813
87 Ga0070664_100038836 3300005564 Bacteria 4009
88 Ga0070664_100041761 3300005564 Bacteria 3871
89 Ga0068857_100136768 3300005577 Bacteria 2212
90 Ga0068857_100193542 3300005577 Bacteria 1852
91 Ga0068854_100037775 3300005578 Bacteria 3391
92 Ga0068854_100100749 3300005578 Bacteria 2165
93 Ga0068856_100018169 3300005614 Bacteria 6819
94 Ga0068856_100049867 3300005614 Bacteria 4127
95 Ga0068856_100157129 3300005614 Bacteria 2284
96 Ga0068856_100241157 3300005614 Bacteria 1823
97 Ga0068852_100000273 3300005616 Bacteria 34348
98 Ga0068852_100006730 3300005616 Bacteria 8337
99 Ga0068852_100103788 3300005616 Bacteria 2572
100 Ga0068859_100010880 3300005617 Bacteria 9156
101 Ga0068859_100029459 3300005617 Bacteria 5507
102 Ga0068864_100108208 3300005618 Bacteria 2474
103 Ga0068864_100160020 3300005618 Bacteria 2046
104 Ga0068861_100000299 3300005719 Bacteria 27750
105 Ga0068851_10009573 3300005834 Bacteria 4511
106 Ga0068851_10018458 3300005834 Bacteria 3360
107 Ga0068863_100000090 3300005841 Bacteria 100887
108 Ga0068863_100004231 3300005841 Bacteria 14171
109 Ga0068863_100017402 3300005841 Bacteria 6891
110 Ga0068863_100172959 3300005841 Bacteria 2072
111 Ga0068858_100000472 3300005842 Bacteria 41922
112 Ga0068858_100001618 3300005842 Bacteria 22973
113 Ga0068858_100003262 3300005842 Bacteria 16173
114 Ga0068858_100057331 3300005842 Bacteria 3600
115 Ga0068860_100000089 3300005843 Bacteria 152667
116 Ga0068860_100011153 3300005843 Bacteria 8857
117 Ga0068860_100012804 3300005843 Bacteria 8247
118 Ga0068862_100004597 3300005844 Bacteria 11629
119 Ga0068862_100028918 3300005844 Bacteria 4668
120 Ga0068862_100037541 3300005844 Bacteria 4106
121 Ga0075368_10004412 3300006042 Bacteria 4769
122 Ga0075364_10020007 3300006051 Bacteria 4208
123 Ga0075364_10034149 3300006051 Bacteria 3280
124 Ga0075364_10216796 3300006051 Bacteria 1298
125 Ga0075432_10001768 3300006058 Bacteria 7115
126 Ga0075362_10004550 3300006177 Bacteria 4997
127 Ga0075362_10010458 3300006177 Bacteria 3624
128 Ga0075362_10076030 3300006177 Bacteria 1541
129 Ga0075367_10002649 3300006178 Bacteria 8240
130 Ga0075369_10008054 3300006186 Bacteria 4040
131 Ga0075366_10004768 3300006195 Bacteria 7313
132 Ga0075366_10009143 3300006195 Bacteria 5525
133 Ga0075366_10011463 3300006195 Bacteria 5007
134 Ga0097621_100025030 3300006237 Bacteria 4666
135 Ga0075370_10001111 3300006353 Bacteria 11259
136 Ga0075370_10003188 3300006353 Bacteria 7764
137 Ga0075370_10016709 3300006353 Bacteria 3951
138 Ga0075370_10017832 3300006353 Bacteria 3841
139 Ga0075370_10028082 3300006353 Bacteria 3126
140 Ga0075370_10099532 3300006353 Bacteria 1682
141 Ga0068871_100088604 3300006358 Bacteria 2575
142 Ga0068865_100108501 3300006881 Bacteria 2043
143 Ga0097620_100010880 3300006931 Bacteria 9156
144 Ga0097620_100029459 3300006931 Bacteria 5507
145 Ga0079104_1014634 3300006946 Bacteria 2359
146 Ga0105251_10001250 3300009011 Bacteria 22028
147 Ga0105240_10001369 3300009093 Bacteria 41902
148 Ga0105240_10001848 3300009093 Bacteria 35437
149 Ga0105240_10248869 3300009093 Bacteria 2057
150 Ga0105245_10001108 3300009098 Bacteria 24360
151 Ga0105247_10010323 3300009101 Bacteria 5649
152 Ga0105247_10035453 3300009101 Bacteria 3041
153 Ga0105247_10045856 3300009101 Bacteria 2683
154 Ga0114129_10183624 3300009147 Bacteria 2845
155 Ga0105243_10000423 3300009148 Bacteria 44393
156 Ga0105243_10013621 3300009148 Bacteria 6151
157 Ga0105243_10150418 3300009148 Bacteria 1996
158 Ga0105241_10069590 3300009174 Bacteria 2729
159 Ga0105248_10001023 3300009177 Bacteria 30929
160 Ga0105248_10013624 3300009177 Bacteria 8950
161 Ga0105248_10184415 3300009177 Bacteria 2352
162 Ga0105237_10002266 3300009545 Bacteria 23934
163 Ga0105238_10084215 3300009551 Bacteria 3169
164 Ga0105238_10183084 3300009551 Bacteria 2071
165 Ga0105249_10022999 3300009553 Bacteria 5588
166 Ga0105249_10163607 3300009553 Bacteria 2152
167 Ga0105239_10009734 3300010375 Bacteria 10805
168 Ga0105239_10059536 3300010375 Bacteria 4192
169 Ga0105239_10135119 3300010375 Bacteria 2746
170 Ga0105246_10000354 3300011119 Bacteria 24700
171 Ga0157326_1001490 3300012513 Bacteria 2581
172 Ga0157373_10005198 3300013100 Bacteria 9779
173 Ga0157373_10009265 3300013100 Bacteria 7278
174 Ga0157371_10000032 3300013102 Bacteria 230252
175 Ga0157371_10001531 3300013102 Bacteria 23797
176 Ga0157371_10033776 3300013102 Bacteria 3674
177 Ga0157370_10004317 3300013104 Bacteria 16341
178 Ga0157370_10163395 3300013104 Bacteria 2071
179 Ga0157369_10002247 3300013105 Bacteria 23225
180 Ga0157369_10065036 3300013105 Bacteria 3927
181 Ga0157374_10015473 3300013296 Bacteria 6691
182 Ga0157374_10062137 3300013296 Bacteria 3500
183 Ga0157378_10193513 3300013297 Bacteria 1920
184 Ga0163162_10027215 3300013306 Bacteria 5654
185 Ga0163162_10086963 3300013306 Bacteria 3204
186 Ga0157372_10004467 3300013307 Bacteria 14925
187 Ga0157375_10430563 3300013308 Bacteria 1485
188 Ga0163161_10135562 3300017792 Bacteria 1861
189 Ga0209563_100030 3300025230 Bacteria 489259
190 Ga0209677_107661 3300025253 Bacteria 2243
191 Ga0209148_1000011 3300025254 Bacteria 1196503
192 Ga0209233_1000058 3300025261 Bacteria 421872
193 Ga0209455_1000006 3300025272 Bacteria 1196503
194 Ga0209675_1000075 3300025291 Bacteria 161623
195 Ga0209676_1000081 3300025292 Bacteria 285297
196 Ga0209676_1000769 3300025292 Bacteria 42909
197 Ga0209676_1000949 3300025292 Bacteria 35497
198 Ga0209758_1000001 3300025297 Bacteria 1981790
199 Ga0209050_1000017 3300025298 Bacteria 728928
200 Ga0209050_1000127 3300025298 Bacteria 187951
201 Ga0209050_1003650 3300025298 Bacteria 11122
202 Ga0209257_1000206 3300025304 Bacteria 142184
203 Ga0209257_1001326 3300025304 Bacteria 30099
204 Ga0209257_1001697 3300025304 Bacteria 24737
205 Ga0209257_1009938 3300025304 Bacteria 4949
206 Ga0207656_10000378 3300025321 Bacteria 14923
207 Ga0207696_1002899 3300025711 Bacteria 8073
208 Ga0207713_1003912 3300025735 Bacteria 9909
209 Ga0207713_1005617 3300025735 Bacteria 7800
210 Ga0207710_10015220 3300025900 Bacteria 3249
211 Ga0207688_10085086 3300025901 Bacteria 1811
212 Ga0207680_10136692 3300025903 Bacteria 1621
213 Ga0207647_10013331 3300025904 Bacteria 5704
214 Ga0207647_10051147 3300025904 Bacteria 2555
215 Ga0207705_10000155 3300025909 Bacteria 73779
216 Ga0207705_10000637 3300025909 Bacteria 29343
217 Ga0207705_10006619 3300025909 Bacteria 8575
218 Ga0207705_10009600 3300025909 Bacteria 7037
219 Ga0207705_10011018 3300025909 Bacteria 6561
220 Ga0207654_10005404 3300025911 Bacteria 6460
221 Ga0207707_10065315 3300025912 Bacteria 3170
222 Ga0207695_10000288 3300025913 Bacteria 125085
223 Ga0207695_10015610 3300025913 Bacteria 8933
224 Ga0207695_10052359 3300025913 Bacteria 4277
225 Ga0207671_10002453 3300025914 Bacteria 19840
226 Ga0207671_10008049 3300025914 Bacteria 9011
227 Ga0207660_10005603 3300025917 Bacteria 8153
228 Ga0207657_10001083 3300025919 Bacteria 28850
229 Ga0207657_10007801 3300025919 Bacteria 10926
230 Ga0207657_10016392 3300025919 Bacteria 7149
231 Ga0207657_10095609 3300025919 Bacteria 2472
232 Ga0207657_10142261 3300025919 Bacteria 1959
233 Ga0207649_10000482 3300025920 Bacteria 28301
234 Ga0207652_10002246 3300025921 Bacteria 16436
235 Ga0207652_10005534 3300025921 Bacteria 10240
236 Ga0207652_10026805 3300025921 Bacteria 4803
237 Ga0207652_10241189 3300025921 Bacteria 1630
238 Ga0207681_10000179 3300025923 Bacteria 52003
239 Ga0207681_10000467 3300025923 Bacteria 28346
240 Ga0207681_10002731 3300025923 Bacteria 11173
241 Ga0207681_10038828 3300025923 Bacteria 3157
242 Ga0207694_10024085 3300025924 Bacteria 4622
243 Ga0207694_10038986 3300025924 Bacteria 3654
244 Ga0207687_10000853 3300025927 Bacteria 20620
245 Ga0207644_10000004 3300025931 Bacteria 566613
246 Ga0207644_10001696 3300025931 Bacteria 14214
247 Ga0207644_10009126 3300025931 Bacteria 6502
248 Ga0207644_10093244 3300025931 Bacteria 2248
249 Ga0207690_10000506 3300025932 Bacteria 25280
250 Ga0207690_10000696 3300025932 Bacteria 21652
251 Ga0207690_10078656 3300025932 Bacteria 2296
252 Ga0207690_10094020 3300025932 Bacteria 2126
253 Ga0207706_10002162 3300025933 Bacteria 19198
254 Ga0207709_10000727 3300025935 Bacteria 26397
255 Ga0207709_10046285 3300025935 Bacteria 2639
256 Ga0207669_10000416 3300025937 Bacteria 18639
257 Ga0207711_10000912 3300025941 Bacteria 28443
258 Ga0207711_10004180 3300025941 Bacteria 12361
259 Ga0207711_10008551 3300025941 Bacteria 8561
260 Ga0207711_10100579 3300025941 Bacteria 2557
261 Ga0207689_10075817 3300025942 Bacteria 2765
262 Ga0207661_10004071 3300025944 Bacteria 10209
263 Ga0207661_10124085 3300025944 Bacteria 2203
264 Ga0207679_10026833 3300025945 Bacteria 3976
265 Ga0207679_10055487 3300025945 Bacteria 2921
266 Ga0207679_10057954 3300025945 Bacteria 2867
267 Ga0207667_10000002 3300025949 Bacteria 895662
268 Ga0207667_10005551 3300025949 Bacteria 15392
269 Ga0207667_10009448 3300025949 Bacteria 11482
270 Ga0207667_10087386 3300025949 Bacteria 3225
271 Ga0207667_10293038 3300025949 Bacteria 1662
272 Ga0207712_10031707 3300025961 Bacteria 3562
273 Ga0207668_10000523 3300025972 Bacteria 24025
274 Ga0207668_10062746 3300025972 Bacteria 2618
275 Ga0207640_10000586 3300025981 Bacteria 21662
276 Ga0207640_10040599 3300025981 Bacteria 2953
277 Ga0207640_10049196 3300025981 Bacteria 2728
278 Ga0207640_10142937 3300025981 Bacteria 1747
279 Ga0207658_10000415 3300025986 Bacteria 40532
280 Ga0207658_10002340 3300025986 Bacteria 13922
281 Ga0207658_10004466 3300025986 Bacteria 9722
282 Ga0207658_10027744 3300025986 Bacteria 3981
283 Ga0207703_10000568 3300026035 Bacteria 37997
284 Ga0207703_10001318 3300026035 Bacteria 22824
285 Ga0207639_10001972 3300026041 Bacteria 13796
286 Ga0207639_10004061 3300026041 Bacteria 9874
287 Ga0207639_10006007 3300026041 Bacteria 8235
288 Ga0207678_10020590 3300026067 Bacteria 5784
289 Ga0207678_10030203 3300026067 Bacteria 4730
290 Ga0207678_10045630 3300026067 Bacteria 3789
291 Ga0207678_10163478 3300026067 Bacteria 1901
292 Ga0207702_10013356 3300026078 Bacteria 6829
293 Ga0207702_10017889 3300026078 Bacteria 5866
294 Ga0207702_10045051 3300026078 Bacteria 3711
295 Ga0207702_10076672 3300026078 Bacteria 2890
296 Ga0207702_10273642 3300026078 Bacteria 1594
297 Ga0207641_10000069 3300026088 Bacteria 154022
298 Ga0207641_10011356 3300026088 Bacteria 7309
299 Ga0207641_10017539 3300026088 Bacteria 5860
300 Ga0207648_10010571 3300026089 Bacteria 8733
301 Ga0207676_10013117 3300026095 Bacteria 5949
302 Ga0207674_10004472 3300026116 Bacteria 16807
303 Ga0207674_10013772 3300026116 Bacteria 8949
304 Ga0207674_10031161 3300026116 Bacteria 5604
305 Ga0207674_10041856 3300026116 Bacteria 4735
306 Ga0207674_10049550 3300026116 Bacteria 4295
307 Ga0207674_10085008 3300026116 Bacteria 3161
308 Ga0207675_100000394 3300026118 Bacteria 41906
309 Ga0207675_100188482 3300026118 Bacteria 1978
310 Ga0207683_10033561 3300026121 Bacteria 4458
311 Ga0207698_10000179 3300026142 Bacteria 38793
312 Ga0207698_10005612 3300026142 Bacteria 7767
313 Ga0207698_10011951 3300026142 Bacteria 5656
314 Ga0207698_10035948 3300026142 Bacteria 3630
315 Ga0207698_10255246 3300026142 Bacteria 1607
316 Ga0209999_1004174 3300027543 Bacteria 2602
317 Ga0209813_10000060 3300027866 Bacteria 44068
318 Ga0209974_10001551 3300027876 Bacteria 8349
319 Ga0209974_10004024 3300027876 Bacteria 5256
320 Ga0268266_10000002 3300028379 Bacteria 3059047
321 Ga0268266_10000239 3300028379 Bacteria 93395
322 Ga0268266_10001120 3300028379 Bacteria 33444
323 Ga0268266_10003468 3300028379 Bacteria 15735
324 Ga0268265_10001670 3300028380 Bacteria 18127
325 Ga0268265_10026456 3300028380 Bacteria 4128
326 Ga0268265_10057401 3300028380 Bacteria 2966
327 Ga0268265_10114509 3300028380 Bacteria 2209
328 Ga0268264_10000160 3300028381 Bacteria 152653
329 Ga0268264_10011204 3300028381 Bacteria 7406
330 Ga0307517_10014999 3300028786 Bacteria 10336
331 Ga0307517_10015806 3300028786 Bacteria 9988
332 Ga0265327_10020461 3300031251 Bacteria 4030
333 Ga0307513_10006540 3300031456 Bacteria 15221
334 Ga0307509_10098666 3300031507 Bacteria 2965
335 Ga0307408_100021871 3300031548 Bacteria 4336
336 Ga0307408_100022756 3300031548 Bacteria 4262
337 Ga0307408_100115582 3300031548 Bacteria 2069
338 Ga0307508_10001821 3300031616 Bacteria 23580
339 Ga0307405_10001326 3300031731 Bacteria 10369
340 Ga0307405_10002903 3300031731 Bacteria 7719
341 Ga0307405_10014694 3300031731 Bacteria 4218
342 Ga0307405_10015282 3300031731 Bacteria 4154
343 Ga0307405_10049956 3300031731 Bacteria 2587
344 Ga0307405_10196817 3300031731 Bacteria 1460
345 Ga0307405_10225175 3300031731 Bacteria 1379
346 Ga0307413_10004766 3300031824 Bacteria 5955
347 Ga0307413_10005384 3300031824 Bacteria 5708
348 Ga0307413_10031139 3300031824 Bacteria 3006
349 Ga0307413_10090385 3300031824 Bacteria 1992
350 Ga0307413_10137532 3300031824 Bacteria 1682
351 Ga0307410_10002075 3300031852 Bacteria 9485
352 Ga0307410_10017407 3300031852 Bacteria 4315
353 Ga0307410_10046303 3300031852 Bacteria 2901
354 Ga0307410_10109452 3300031852 Bacteria 1997
355 Ga0307406_10006711 3300031901 Bacteria 6364
356 Ga0307406_10014163 3300031901 Bacteria 4583
357 Ga0307406_10027877 3300031901 Bacteria 3407
358 Ga0307406_10060877 3300031901 Bacteria 2436
359 Ga0307407_10001621 3300031903 Bacteria 8317
360 Ga0307407_10034315 3300031903 Bacteria 2776
361 Ga0307412_10007151 3300031911 Bacteria 6336
362 Ga0307412_10010045 3300031911 Bacteria 5444
363 Ga0307412_10012945 3300031911 Bacteria 4877
364 Ga0307412_10019157 3300031911 Bacteria 4136
365 Ga0307412_10023165 3300031911 Bacteria 3817
366 Ga0307412_10041123 3300031911 Bacteria 2994
367 Ga0307412_10119984 3300031911 Bacteria 1892
368 Ga0307409_100001109 3300031995 Bacteria 12731
369 Ga0307409_100006854 3300031995 Bacteria 6749
370 Ga0307409_100271799 3300031995 Bacteria 1561
371 Ga0307416_100002227 3300032002 Bacteria 11030
372 Ga0307416_100017737 3300032002 Bacteria 4991
373 Ga0307416_100085284 3300032002 Bacteria 2687
374 Ga0307416_100309466 3300032002 Bacteria 1575
375 Ga0307414_10003379 3300032004 Bacteria 8521
376 Ga0307414_10012232 3300032004 Bacteria 5065
377 Ga0307414_10013483 3300032004 Bacteria 4868
378 Ga0307414_10038785 3300032004 Bacteria 3202
379 Ga0307414_10042959 3300032004 Bacteria 3075
380 Ga0307414_10067599 3300032004 Bacteria 2561
381 Ga0307414_10092926 3300032004 Bacteria 2247
382 Ga0307414_10144064 3300032004 Bacteria 1869
383 Ga0307414_10180773 3300032004 Bacteria 1696
384 Ga0307411_10002755 3300032005 Bacteria 7900
385 Ga0307411_10005204 3300032005 Bacteria 6365
386 Ga0307411_10007939 3300032005 Bacteria 5455
387 Ga0307411_10013678 3300032005 Bacteria 4488
388 Ga0307411_10038831 3300032005 Bacteria 3007
389 Ga0307411_10139741 3300032005 Bacteria 1784
390 Ga0307415_100005573 3300032126 Bacteria 6700
391 Ga0307415_100005937 3300032126 Bacteria 6539
392 Ga0307415_100057327 3300032126 Bacteria 2676
393 Ga0307415_100088977 3300032126 Bacteria 2229
394 Ga0316583_10001033 3300032133 Bacteria 9019
395 Ga0316584_0014468 3300036712 Bacteria 5618
396 Ga0316584_0089308 3300036712 Bacteria 2307
397 Ga0395899_0031849 3300037312 Bacteria 3962
398 Ga0395901_0039524 3300038443 Bacteria 4882
399 Ga0395901_0080949 3300038443 Bacteria 3392
400 Ga0395901_0116743 3300038443 Bacteria 2803
401 Ga0439435_0003307 3300042436 Bacteria 3336
402 Ga0466968_0013146 3300044735 Bacteria 3250
403 Ga0451576_0000024 3300045051 Bacteria 470499
404 Ga0451576_0162645 3300045051 Bacteria 2330
405 Ga0495617_014504 3300046452 Bacteria 2678
406 Ga0495627_000278 3300046453 Bacteria 51546
407 Ga0495638_0001145 3300046460 Bacteria 25617
408 Ga0495650_0000158 3300046471 Bacteria 154681
409 Ga0495650_0003474 3300046471 Bacteria 11459
410 Ga0495605_0069596 3300046474 Bacteria 1666
411 Ga0495639_0046696 3300046475 Bacteria 1961
412 Ga0495585_0004856 3300046492 Bacteria 8628
413 Ga0495585_0052350 3300046492 Bacteria 2260
414 Ga0495596_0000006 3300046500 Bacteria 161501
415 Ga0495596_0000830 3300046500 Bacteria 18689
416 Ga0495607_0008886 3300046501 Bacteria 6843
417 Ga0495607_0025932 3300046501 Bacteria 3640
418 Ga0495583_0000631 3300046506 Bacteria 46958
419 Ga0495583_0020282 3300046506 Bacteria 3448
420 Ga0495606_0000672 3300046507 Bacteria 53500
421 Ga0495606_0022008 3300046507 Bacteria 4659
422 Ga0495610_0000116 3300046512 Bacteria 90702
423 Ga0495610_0001706 3300046512 Bacteria 19286
424 Ga0495631_0008798 3300046518 Bacteria 5070
425 Ga0495632_0029606 3300046519 Bacteria 2849
426 Ga0495637_0015883 3300046520 Bacteria 3524
427 Ga0495643_0003727 3300046522 Bacteria 11036
428 Ga0495643_0011201 3300046522 Bacteria 5479
429 Ga0495643_0017045 3300046522 Bacteria 4255
430 Ga0495643_0020288 3300046522 Bacteria 3834
431 Ga0495643_0021086 3300046522 Bacteria 3744
432 Ga0495643_0037814 3300046522 Bacteria 2645
433 Ga0495648_0000143 3300046524 Bacteria 85539
434 Ga0495663_0001342 3300046525 Bacteria 7775
435 Ga0495642_0009263 3300046528 Bacteria 3770
436 Ga0495654_0020341 3300046530 Bacteria 3460
437 Ga0495654_0082184 3300046530 Bacteria 1508
438 Ga0495609_0032441 3300046538 Bacteria 2372
439 Ga0495633_0004678 3300046558 Bacteria 8611
440 Ga0495633_0026130 3300046558 Bacteria 2867
441 Ga0495668_0000016 3300046616 Bacteria 438197
442 Ga0495668_0000076 3300046616 Bacteria 161826
443 Ga0495668_0016858 3300046616 Bacteria 4244
444 Ga0495668_0051903 3300046616 Bacteria 2270
445 Ga0495668_0077851 3300046616 Bacteria 1821
446 Ga0495625_0000150 3300046660 Bacteria 106314
447 Ga0495625_0000520 3300046660 Bacteria 56778
448 Ga0495625_0027361 3300046660 Bacteria 4294
449 Ga0495625_0036381 3300046660 Bacteria 3619
450 Ga0495625_0054961 3300046660 Bacteria 2841
451 Ga0495661_0040380 3300046665 Bacteria 2894
452 Ga0495661_0072631 3300046665 Bacteria 2007
453 Ga0495669_0000050 3300046684 Bacteria 80688
454 Ga0495660_0029202 3300046810 Bacteria 3113
455 Ga0495683_0000963 3300047323 Bacteria 20180
456 Ga0495683_0009437 3300047323 Bacteria 5197
457 Ga0495687_001845 3300047443 Bacteria 18538
458 Ga0495687_002183 3300047443 Bacteria 16292
459 Ga0495681_0000974 3300047470 Bacteria 21885
460 Ga0495681_0004732 3300047470 Bacteria 9223
461 Ga0495686_0000340 3300047472 Bacteria 76984
462 Ga0495686_0000363 3300047472 Bacteria 73366
463 Ga0495686_0001841 3300047472 Bacteria 21297
464 Ga0495686_0002793 3300047472 Bacteria 15859
465 Ga0495686_0010684 3300047472 Bacteria 6517
466 Ga0495615_0000126 3300048090 Bacteria 19220
467 Ga0495626_0000165 3300048091 Bacteria 81419
468 Ga0496100_0005025 3300048903 Bacteria 7078
469 Ga0496102_0000199 3300048905 Bacteria 81435
470 Ga0496102_0000856 3300048905 Bacteria 29219
471 Ga0496102_0344083 3300048905 Bacteria 1404
472 Ga0496103_0000140 3300048906 Bacteria 75095
473 Ga0496103_0000633 3300048906 Bacteria 26944
474 Ga0496103_0117781 3300048906 Bacteria 1691
475 Ga0496104_0001582 3300048907 Bacteria 19595
476 Ga0496104_0011045 3300048907 Bacteria 8079
477 Ga0496104_0035916 3300048907 Bacteria 4630
478 Ga0496105_0000446 3300048908 Bacteria 27189
479 Ga0496105_0000690 3300048908 Bacteria 22731
480 Ga0496105_0005353 3300048908 Bacteria 9728
481 Ga0496106_0004026 3300048909 Bacteria 10987
482 Ga0496106_0184571 3300048909 Bacteria 1657
483 Ga0496107_0000221 3300048910 Bacteria 30031
484 Ga0496107_0041029 3300048910 Bacteria 3323
485 Ga0496110_0112948 3300048913 Bacteria 2442
486 Ga0496111_0032279 3300048914 Bacteria 3732
487 Ga0496112_0003754 3300048915 Bacteria 12689
488 Ga0496113_0000197 3300048916 Bacteria 27686
489 Ga0496113_0015080 3300048916 Bacteria 5295
490 Ga0496114_0002491 3300048917 Bacteria 14055
491 Ga0496115_0000131 3300048918 Bacteria 68111
492 Ga0496115_0051369 3300048918 Bacteria 3306
493 Ga0496116_0000035 3300048919 Bacteria 402424
494 Ga0496116_0011618 3300048919 Bacteria 7266
495 Ga0496116_0016826 3300048919 Bacteria 5705
496 Ga0496116_0058238 3300048919 Bacteria 2520
497 Ga0496117_0000331 3300048920 Bacteria 83569
498 Ga0496117_0000352 3300048920 Bacteria 81089
499 Ga0496118_0000092 3300048921 Bacteria 169106
500 Ga0496118_0003689 3300048921 Bacteria 18976
501 Ga0496118_0008603 3300048921 Bacteria 10506
502 Ga0496118_0010555 3300048921 Bacteria 9133
503 Ga0496118_0077898 3300048921 Bacteria 2348
504 Ga0496119_0004697 3300048922 Bacteria 13438
505 Ga0496119_0026586 3300048922 Bacteria 4008
506 Ga0496120_0005607 3300048923 Bacteria 9946
507 Ga0496120_0009062 3300048923 Bacteria 7107
508 Ga0496120_0029800 3300048923 Bacteria 3327
509 Ga0496120_0037255 3300048923 Bacteria 2888
510 Ga0496121_0000017 3300048924 Bacteria 546415
511 Ga0496121_0000228 3300048924 Bacteria 120653
512 Ga0496121_0000347 3300048924 Bacteria 96608
513 Ga0496121_0001542 3300048924 Bacteria 38556
514 Ga0496121_0001914 3300048924 Bacteria 33228
515 Ga0496121_0001919 3300048924 Bacteria 33213
516 Ga0496121_0002864 3300048924 Bacteria 25422
517 Ga0496121_0037720 3300048924 Bacteria 4287
518 Ga0496121_0042197 3300048924 Bacteria 3973
519 Ga0496122_0000176 3300048925 Bacteria 152190
520 Ga0496122_0005106 3300048925 Bacteria 15836
521 Ga0496122_0031341 3300048925 Bacteria 4427
522 Ga0496123_0000159 3300048926 Bacteria 136014
523 Ga0496123_0000291 3300048926 Bacteria 97989
524 Ga0496123_0002869 3300048926 Bacteria 20241
525 Ga0496123_0009148 3300048926 Bacteria 8959
526 Ga0496123_0022617 3300048926 Bacteria 4839
527 Ga0496123_0031503 3300048926 Bacteria 3857
528 Ga0496124_0000081 3300048927 Bacteria 208413
529 Ga0496124_0002273 3300048927 Bacteria 25455
530 Ga0496124_0002527 3300048927 Bacteria 23742
531 Ga0496124_0098846 3300048927 Bacteria 2367
532 Ga0496124_0266017 3300048927 Bacteria 1258
533 Ga0496125_0000980 3300048928 Bacteria 44624
534 Ga0496125_0003982 3300048928 Bacteria 17382
535 Ga0496125_0043169 3300048928 Bacteria 3831
536 Ga0496125_0059042 3300048928 Bacteria 3094
537 Ga0496125_0086169 3300048928 Bacteria 2376
538 Ga0496126_0000051 3300048929 Bacteria 313169
539 Ga0496126_0000077 3300048929 Bacteria 231592
540 Ga0496126_0000283 3300048929 Bacteria 107129
541 Ga0496126_0000955 3300048929 Bacteria 49565
542 Ga0496126_0020825 3300048929 Bacteria 6419
543 Ga0496126_0023938 3300048929 Bacteria 5905
544 Ga0496126_0075909 3300048929 Bacteria 2982
545 Ga0501290_001006 3300049513 Bacteria 4049
546 Ga0501032_0094647 3300049569 Bacteria 1980
547 Ga0501033_0005709 3300049570 Bacteria 9810
548 Ga0501033_0110216 3300049570 Bacteria 2004
549 Ga0501034_0408031 3300049571 Bacteria 1281
550 Ga0501036_0010585 3300049572 Bacteria 7620
551 Ga0501036_0043827 3300049572 Bacteria 3789
552 Ga0501038_0040575 3300049574 Bacteria 4063
553 Ga0501039_0064138 3300049575 Bacteria 2847
554 Ga0501047_0103401 3300049581 Bacteria 2729
555 Ga0501047_0194909 3300049581 Bacteria 1888
556 Ga0501071_0047383 3300049587 Bacteria 3088
557 Ga0501235_010311 3300049669 Bacteria 2043
558 Ga0501249_000848 3300049679 Bacteria 6781
559 Ga0501249_015025 3300049679 Bacteria 1654
560 Ga0501257_000001 3300049686 Bacteria 74809
561 Ga0501241_004743 3300049758 Bacteria 2539
562 Ga0501035_0187077 3300049822 Bacteria 1782
563 Ga0501044_0000591 3300049823 Bacteria 44012
564 Ga0501044_0028035 3300049823 Bacteria 5943
565 Ga0501044_0106644 3300049823 Bacteria 2813
566 nmdc:mga03683_24257_c1 3300050489 Bacteria 2372
567 nmdc:mga03683_393_c1 3300050489 Bacteria 12561
568 nmdc:mga03683_45295_c1 3300050489 Bacteria 1820
569 nmdc:mga00v17_1341_c1 3300050491 Bacteria 12898
570 nmdc:mga0k408_10130_c1 3300050493 Bacteria 5093
571 nmdc:mga0k408_1586_c2 3300050493 Bacteria 5441
572 nmdc:mga0k408_89124_c1 3300050493 Bacteria 1812
573 nmdc:mga06z11_388_c1 3300050494 Bacteria 16612
574 nmdc:mga04h51_73_c1 3300050495 Bacteria 32039
575 nmdc:mga07m45_110859_c1 3300050496 Bacteria 1580
576 nmdc:mga07m45_2163_c1 3300050496 Bacteria 9154
577 nmdc:mga07m45_39242_c1 3300050496 Bacteria 2645
578 nmdc:mga07m45_5_c2 3300050496 Bacteria 297012
579 nmdc:mga0sz30_209_c1 3300050516 Bacteria 21984
580 nmdc:mga0sz30_33943_c1 3300050516 Bacteria 2122
581 Ga0500610_0009443 3300053079 Bacteria 4324
582 Ga0500643_000001 3300053087 Bacteria 1440111
583 Ga0500643_028166 3300053087 Bacteria 1739
584 Ga0500641_0065873 3300053096 Bacteria 1516
585 Ga0500556_0000144 3300053104 Bacteria 59354
586 Ga0500592_001926 3300053116 Bacteria 3338
587 Ga0500595_044015 3300053119 Bacteria 1418
588 Ga0500597_008459 3300053120 Bacteria 3560
589 Ga0500607_000009 3300053121 Bacteria 125590
590 Ga0500607_000292 3300053121 Bacteria 47464
591 Ga0500618_000211 3300053125 Bacteria 46131
592 Ga0500642_0000001 3300053130 Bacteria 1468402
593 Ga0500642_0000393 3300053130 Bacteria 14372
594 Ga0500658_0003688 3300053134 Bacteria 5772
595 Ga0500559_0001649 3300053136 Bacteria 12352
596 Ga0500559_0015729 3300053136 Bacteria 3195
597 Ga0500564_001534 3300053138 Bacteria 8032
598 Ga0500568_0064562 3300053139 Bacteria 1410
599 Ga0500573_0000015 3300053140 Bacteria 192264
600 Ga0500573_0055338 3300053140 Bacteria 2277
601 Ga0500588_0038894 3300053146 Bacteria 1421
602 Ga0500590_000367 3300053148 Bacteria 14913
603 Ga0500604_0022012 3300053151 Bacteria 1807
604 Ga0500616_0001216 3300053153 Bacteria 26011
605 Ga0500616_0003363 3300053153 Bacteria 12295
606 Ga0500619_013931 3300053154 Bacteria 2146
607 Ga0500622_0000253 3300053156 Bacteria 54354
608 Ga0500622_0036470 3300053156 Bacteria 2570
609 Ga0500624_000017 3300053157 Bacteria 132088
610 Ga0500624_000023 3300053157 Bacteria 114997
611 Ga0500627_0000100 3300053158 Bacteria 28817
612 Ga0500637_0000013 3300053178 Bacteria 73168
613 Ga0500637_0001397 3300053178 Bacteria 10269
614 Ga0500625_000005 3300053729 Bacteria 209509
615 Ga0500645_000002 3300053730 Bacteria 388892
616 Ga0500645_000414 3300053730 Bacteria 29750
617 Ga0500645_001762 3300053730 Bacteria 10487

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026067 Ga0207678_10163478 Ga0207678_101634782 339
2 3300053120 Ga0500597_008459 Ga0500597_008459_513_1634 348
3 3300053157 Ga0500624_000023 Ga0500624_000023_56398_57519 348
4 3300053178 Ga0500637_0000013 Ga0500637_0000013_30902_32023 348
5 3300046660 Ga0495625_0036381 Ga0495625_0036381_14_1138 367
6 3300053121 Ga0500607_000292 Ga0500607_000292_11811_13013 368
7 3300027543 Ga0209999_1004174 Ga0209999_10041743 370
8 3300027876 Ga0209974_10004024 Ga0209974_100040244 370
9 3300031548 Ga0307408_100022756 Ga0307408_1000227562 370
10 3300031731 Ga0307405_10049956 Ga0307405_100499563 370
11 3300031824 Ga0307413_10005384 Ga0307413_100053844 370
12 3300031852 Ga0307410_10002075 Ga0307410_100020756 370
13 3300031901 Ga0307406_10006711 Ga0307406_100067113 370
14 3300031903 Ga0307407_10001621 Ga0307407_100016217 370
15 3300031911 Ga0307412_10007151 Ga0307412_100071515 370
16 3300031995 Ga0307409_100006854 Ga0307409_1000068546 370
17 3300032002 Ga0307416_100085284 Ga0307416_1000852843 370
18 3300032004 Ga0307414_10003379 Ga0307414_100033796 370
19 3300032005 Ga0307411_10005204 Ga0307411_100052042 370
20 3300032126 Ga0307415_100005937 Ga0307415_1000059374 370
21 3300049669 Ga0501235_010311 Ga0501235_010311_131_1339 370
22 3300049679 Ga0501249_000848 Ga0501249_000848_3953_5161 370
23 3300053146 Ga0500588_0038894 Ga0500588_0038894_144_1382 372
24 3300005618 Ga0068864_100108208 Ga0068864_1001082082 373
25 3300005618 Ga0068864_100160020 Ga0068864_1001600202 374
26 3300025304 Ga0209257_1001326 Ga0209257_100132610 375
27 3300031731 Ga0307405_10014694 Ga0307405_100146943 375
28 3300031824 Ga0307413_10090385 Ga0307413_100903851 375
29 3300031852 Ga0307410_10046303 Ga0307410_100463033 375
30 3300031901 Ga0307406_10027877 Ga0307406_100278773 375
31 3300031911 Ga0307412_10019157 Ga0307412_100191573 375
32 3300032004 Ga0307414_10012232 Ga0307414_100122323 375
33 3300032004 Ga0307414_10067599 Ga0307414_100675992 375
34 3300032004 Ga0307414_10092926 Ga0307414_100929262 375
35 3300032005 Ga0307411_10038831 Ga0307411_100388313 375
36 3300032126 Ga0307415_100005573 Ga0307415_1000055732 375
37 3300049679 Ga0501249_015025 Ga0501249_015025_17_1177 375
38 3300053139 Ga0500568_0064562 Ga0500568_0064562_225_1379 375
39 3300053153 Ga0500616_0001216 Ga0500616_0001216_11002_12210 375
40 3300053156 Ga0500622_0036470 Ga0500622_0036470_1151_2359 375
41 3300031731 Ga0307405_10225175 Ga0307405_102251752 376
42 3300006353 Ga0075370_10099532 Ga0075370_100995322 377
43 3300026116 Ga0207674_10041856 Ga0207674_100418566 377
44 3300031731 Ga0307405_10001326 Ga0307405_1000132611 377
45 3300031911 Ga0307412_10012945 Ga0307412_100129456 377
46 3300005336 Ga0070680_100007121 Ga0070680_1000071217 378
47 3300005339 Ga0070660_100093279 Ga0070660_1000932792 378
48 3300025919 Ga0207657_10095609 Ga0207657_100956092 378
49 3300031901 Ga0307406_10060877 Ga0307406_100608773 378
50 3300031995 Ga0307409_100271799 Ga0307409_1002717992 378
51 3300032004 Ga0307414_10038785 Ga0307414_100387852 378
52 3300050496 nmdc:mga07m45_39242_c1 nmdc:mga07m45_39242_c1_334_1530 378
53 3300053157 Ga0500624_000017 Ga0500624_000017_16467_17678 378
54 3300003214 JGI25165J46597_1000012 JGI25165J46597_1000012101 379
55 3300005334 Ga0068869_100084489 Ga0068869_1000844892 379
56 3300005842 Ga0068858_100000472 Ga0068858_10000047211 379
57 3300009098 Ga0105245_10001108 Ga0105245_1000110822 379
58 3300009551 Ga0105238_10084215 Ga0105238_100842152 379
59 3300013296 Ga0157374_10015473 Ga0157374_100154732 379
60 3300013297 Ga0157378_10193513 Ga0157378_101935132 379
61 3300025261 Ga0209233_1000058 Ga0209233_1000058318 379
62 3300025921 Ga0207652_10241189 Ga0207652_102411892 379
63 3300025927 Ga0207687_10000853 Ga0207687_100008539 379
64 3300025942 Ga0207689_10075817 Ga0207689_100758172 379
65 3300026035 Ga0207703_10000568 Ga0207703_1000056830 379
66 3300031507 Ga0307509_10098666 Ga0307509_100986662 379
67 3300031616 Ga0307508_10001821 Ga0307508_100018217 379
68 3300031731 Ga0307405_10015282 Ga0307405_100152823 379
69 3300031824 Ga0307413_10004766 Ga0307413_100047664 379
70 3300031852 Ga0307410_10017407 Ga0307410_100174072 379
71 3300031901 Ga0307406_10014163 Ga0307406_100141634 379
72 3300031903 Ga0307407_10034315 Ga0307407_100343153 379
73 3300031911 Ga0307412_10023165 Ga0307412_100231654 379
74 3300032002 Ga0307416_100002227 Ga0307416_1000022277 379
75 3300032004 Ga0307414_10013483 Ga0307414_100134833 379
76 3300032005 Ga0307411_10002755 Ga0307411_100027558 379
77 3300032126 Ga0307415_100057327 Ga0307415_1000573271 379
78 3300006051 Ga0075364_10216796 Ga0075364_102167961 381
79 3300046522 Ga0495643_0037814 Ga0495643_0037814_99_1328 382
80 3300009093 Ga0105240_10001848 Ga0105240_1000184812 383
81 3300009545 Ga0105237_10002266 Ga0105237_100022664 383
82 3300010375 Ga0105239_10009734 Ga0105239_100097347 383
83 3300025913 Ga0207695_10000288 Ga0207695_1000028827 383
84 3300025981 Ga0207640_10142937 Ga0207640_101429372 383
85 3300048924 Ga0496121_0001914 Ga0496121_0001914_7345_8514 383
86 3300048924 Ga0496121_0001919 Ga0496121_0001919_22632_23801 383
87 3300048929 Ga0496126_0023938 Ga0496126_0023938_2117_3286 383
88 3300005367 Ga0070667_100000281 Ga0070667_10000028150 384
89 3300005841 Ga0068863_100004231 Ga0068863_1000042315 384
90 3300009148 Ga0105243_10150418 Ga0105243_101504182 384
91 3300025986 Ga0207658_10000415 Ga0207658_1000041534 384
92 3300026088 Ga0207641_10011356 Ga0207641_100113566 384
93 3300047472 Ga0495686_0001841 Ga0495686_0001841_15656_16870 384
94 3300005289 Ga0065704_10083691 Ga0065704_100836912 385
95 3300005347 Ga0070668_100016290 Ga0070668_1000162904 385
96 3300006051 Ga0075364_10034149 Ga0075364_100341492 385
97 3300025972 Ga0207668_10062746 Ga0207668_100627464 385
98 3300048905 Ga0496102_0344083 Ga0496102_0344083_97_1302 385
99 3300048921 Ga0496118_0010555 Ga0496118_0010555_7249_8454 385
100 3300048924 Ga0496121_0002864 Ga0496121_0002864_12036_13241 385
101 3300013102 Ga0157371_10033776 Ga0157371_100337763 386
102 3300038443 Ga0395901_0039524 Ga0395901_0039524_2247_3452 386
103 3300038443 Ga0395901_0116743 Ga0395901_0116743_269_1474 386
104 3300047472 Ga0495686_0002793 Ga0495686_0002793_3608_4831 386
105 3300048927 Ga0496124_0266017 Ga0496124_0266017_35_1234 386
106 3300053140 Ga0500573_0000015 Ga0500573_0000015_45313_46512 386
107 3300046501 Ga0495607_0025932 Ga0495607_0025932_2234_3439 387
108 3300025304 Ga0209257_1009938 Ga0209257_10099383 388
109 3300048924 Ga0496121_0000017 Ga0496121_0000017_482548_483786 388
110 3300048928 Ga0496125_0059042 Ga0496125_0059042_1743_2948 388
111 3300049569 Ga0501032_0094647 Ga0501032_0094647_527_1735 388
112 3300049570 Ga0501033_0005709 Ga0501033_0005709_3472_4680 388
113 3300049572 Ga0501036_0010585 Ga0501036_0010585_319_1527 388
114 3300049574 Ga0501038_0040575 Ga0501038_0040575_995_2203 388
115 3300049575 Ga0501039_0064138 Ga0501039_0064138_1421_2629 388
116 3300049823 Ga0501044_0106644 Ga0501044_0106644_1585_2793 388
117 3300005366 Ga0070659_100092449 Ga0070659_1000924492 389
118 3300005577 Ga0068857_100136768 Ga0068857_1001367682 389
119 3300005578 Ga0068854_100100749 Ga0068854_1001007492 389
120 3300005616 Ga0068852_100103788 Ga0068852_1001037883 389
121 3300025923 Ga0207681_10038828 Ga0207681_100388283 389
122 3300025981 Ga0207640_10049196 Ga0207640_100491962 389
123 3300026116 Ga0207674_10085008 Ga0207674_100850082 389
124 3300048907 Ga0496104_0035916 Ga0496104_0035916_1459_2667 389
125 3300048908 Ga0496105_0000446 Ga0496105_0000446_18498_19706 389
126 iso_pu_bacteria 2990265787 2990266438 389
127 iso_pu_bacteria 2993693658 2993695769 389
128 3300005367 Ga0070667_100005899 Ga0070667_1000058995 390
129 3300005548 Ga0070665_100008606 Ga0070665_1000086065 390
130 3300005841 Ga0068863_100000090 Ga0068863_10000009010 390
131 3300005842 Ga0068858_100003262 Ga0068858_1000032625 390
132 3300005843 Ga0068860_100000089 Ga0068860_100000089138 390
133 3300005844 Ga0068862_100037541 Ga0068862_1000375413 390
134 3300025986 Ga0207658_10004466 Ga0207658_100044667 390
135 3300026088 Ga0207641_10000069 Ga0207641_1000006911 390
136 3300026095 Ga0207676_10013117 Ga0207676_100131172 390
137 3300028379 Ga0268266_10003468 Ga0268266_100034684 390
138 3300028380 Ga0268265_10026456 Ga0268265_100264563 390
139 3300028381 Ga0268264_10000160 Ga0268264_1000016010 390
140 3300031548 Ga0307408_100115582 Ga0307408_1001155822 390
141 3300031995 Ga0307409_100001109 Ga0307409_10000110911 390
142 3300032005 Ga0307411_10007939 Ga0307411_100079394 390
143 3300032133 Ga0316583_10001033 Ga0316583_100010336 390
144 3300036712 Ga0316584_0089308 Ga0316584_0089308_369_1595 390
145 3300047472 Ga0495686_0000363 Ga0495686_0000363_47699_48910 390
146 3300048923 Ga0496120_0037255 Ga0496120_0037255_1231_2442 390
147 3300048925 Ga0496122_0000176 Ga0496122_0000176_125585_126799 390
148 3300048926 Ga0496123_0000291 Ga0496123_0000291_28645_29859 390
149 3300049513 Ga0501290_001006 Ga0501290_001006_2196_3398 390
150 3300049823 Ga0501044_0000591 Ga0501044_0000591_35971_37143 390
151 3300049823 Ga0501044_0028035 Ga0501044_0028035_2334_3545 390
152 iso_pu_bacteria 2599185354 2600202946 390
153 iso_pu_bacteria 2751185897 2753767310 390
154 3300009177 Ga0105248_10013624 Ga0105248_100136244 391
155 3300025941 Ga0207711_10008551 Ga0207711_100085516 391
156 3300031824 Ga0307413_10031139 Ga0307413_100311391 391
157 3300042436 Ga0439435_0003307 Ga0439435_0003307_1109_2344 391
158 3300046616 Ga0495668_0016858 Ga0495668_0016858_951_2147 391
159 3300048929 Ga0496126_0020825 Ga0496126_0020825_1973_3169 391
160 3300049758 Ga0501241_004743 Ga0501241_004743_68_1264 391
161 3300050496 nmdc:mga07m45_110859_c1 nmdc:mga07m45_110859_c1_331_1527 391
162 3300053087 Ga0500643_028166 Ga0500643_028166_258_1454 391
163 3300053104 Ga0500556_0000144 Ga0500556_0000144_31192_32388 391
164 3300053130 Ga0500642_0000001 Ga0500642_0000001_332880_334076 391
165 3300053730 Ga0500645_000414 Ga0500645_000414_920_2116 391
166 iso_pu_bacteria 2928027323 2928030576 391
167 iso_pu_bacteria 2946787523 2946791065 391
168 iso_pu_bacteria 2984555340 2984555646 391
169 iso_pu_bacteria 2984564862 2984566243 391
170 iso_pu_bacteria 2993356040 2993357256 391
171 3300005289 Ga0065704_10155604 Ga0065704_101556041 392
172 3300005295 Ga0065707_10084966 Ga0065707_100849665 392
173 3300005563 Ga0068855_100032690 Ga0068855_1000326904 392
174 3300011119 Ga0105246_10000354 Ga0105246_1000035419 392
175 3300013100 Ga0157373_10009265 Ga0157373_100092654 392
176 3300025949 Ga0207667_10009448 Ga0207667_100094484 392
177 3300032004 Ga0307414_10042959 Ga0307414_100429593 392
178 3300049822 Ga0501035_0187077 Ga0501035_0187077_128_1354 392
179 iso_pu_bacteria 2830075706 2830078119 392
180 iso_pu_bacteria 2885429604 2885430185 392
181 iso_pu_bacteria 8057101203 8057102862 392
182 3300003781 Ga0055536_1002179 Ga0055536_10021792 393
183 3300005367 Ga0070667_100209069 Ga0070667_1002090691 393
184 3300005539 Ga0068853_100020273 Ga0068853_1000202732 393
185 3300005834 Ga0068851_10018458 Ga0068851_100184582 393
186 3300025292 Ga0209676_1000081 Ga0209676_1000081121 393
187 3300025292 Ga0209676_1000769 Ga0209676_100076934 393
188 3300026041 Ga0207639_10004061 Ga0207639_100040612 393
189 3300026078 Ga0207702_10045051 Ga0207702_100450512 393
190 3300026116 Ga0207674_10004472 Ga0207674_1000447212 393
191 3300049686 Ga0501257_000001 Ga0501257_000001_60811_62022 393
192 3300005295 Ga0065707_10096660 Ga0065707_100966602 394
193 3300005356 Ga0070674_100262863 Ga0070674_1002628631 395
194 3300005456 Ga0070678_100000495 Ga0070678_1000004952 395
195 3300005459 Ga0068867_100009199 Ga0068867_1000091997 395
196 3300005543 Ga0070672_100169697 Ga0070672_1001696972 395
197 3300005563 Ga0068855_100073414 Ga0068855_1000734144 395
198 3300006237 Ga0097621_100025030 Ga0097621_1000250305 395
199 3300006358 Ga0068871_100088604 Ga0068871_1000886042 395
200 3300009148 Ga0105243_10000423 Ga0105243_1000042311 395
201 3300013296 Ga0157374_10062137 Ga0157374_100621373 395
202 3300025935 Ga0207709_10000727 Ga0207709_100007273 395
203 3300025937 Ga0207669_10000416 Ga0207669_100004162 395
204 3300025949 Ga0207667_10087386 Ga0207667_100873862 395
205 3300026089 Ga0207648_10010571 Ga0207648_100105713 395
206 3300026121 Ga0207683_10033561 Ga0207683_100335611 395
207 3300026142 Ga0207698_10035948 Ga0207698_100359482 395
208 3300049587 Ga0501071_0047383 Ga0501071_0047383_1331_2533 395
209 3300053119 Ga0500595_044015 Ga0500595_044015_95_1294 395
210 iso_pu_bacteria 2852653556 2852654413 395
211 iso_pu_bacteria 2882806704 2882808898 395
212 3300003781 Ga0055536_1004597 Ga0055536_10045972 396
213 3300003791 Ga0055530_10002097 Ga0055530_100020972 396
214 3300003794 Ga0055531_10019563 Ga0055531_100195631 396
215 3300005339 Ga0070660_100207781 Ga0070660_1002077812 396
216 3300005347 Ga0070668_100152206 Ga0070668_1001522061 396
217 3300005353 Ga0070669_100005390 Ga0070669_1000053906 396
218 3300005355 Ga0070671_100010917 Ga0070671_1000109174 396
219 3300005355 Ga0070671_100019173 Ga0070671_1000191734 396
220 3300005366 Ga0070659_100010584 Ga0070659_1000105846 396
221 3300005435 Ga0070714_100102887 Ga0070714_1001028872 396
222 3300005455 Ga0070663_100004975 Ga0070663_1000049754 396
223 3300005457 Ga0070662_100022716 Ga0070662_1000227163 396
224 3300005564 Ga0070664_100041761 Ga0070664_1000417614 396
225 3300005617 Ga0068859_100029459 Ga0068859_1000294594 396
226 3300005842 Ga0068858_100001618 Ga0068858_10000161810 396
227 3300006931 Ga0097620_100029459 Ga0097620_1000294594 396
228 3300009101 Ga0105247_10045856 Ga0105247_100458563 396
229 3300025291 Ga0209675_1000075 Ga0209675_100007577 396
230 3300025292 Ga0209676_1000949 Ga0209676_10009495 396
231 3300025298 Ga0209050_1000017 Ga0209050_1000017157 396
232 3300025298 Ga0209050_1003650 Ga0209050_10036505 396
233 3300025304 Ga0209257_1000206 Ga0209257_100020633 396
234 3300025304 Ga0209257_1001697 Ga0209257_100169710 396
235 3300025903 Ga0207680_10136692 Ga0207680_101366921 396
236 3300025919 Ga0207657_10142261 Ga0207657_101422612 396
237 3300025923 Ga0207681_10002731 Ga0207681_100027315 396
238 3300025931 Ga0207644_10000004 Ga0207644_100000045 396
239 3300025931 Ga0207644_10093244 Ga0207644_100932442 396
240 3300025941 Ga0207711_10100579 Ga0207711_101005792 396
241 3300025945 Ga0207679_10055487 Ga0207679_100554872 396
242 3300026035 Ga0207703_10001318 Ga0207703_1000131816 396
243 3300026067 Ga0207678_10045630 Ga0207678_100456302 396
244 3300028380 Ga0268265_10114509 Ga0268265_101145092 396
245 3300031731 Ga0307405_10196817 Ga0307405_101968171 396
246 3300031824 Ga0307413_10137532 Ga0307413_101375322 396
247 3300031911 Ga0307412_10041123 Ga0307412_100411232 396
248 3300032002 Ga0307416_100309466 Ga0307416_1003094661 396
249 3300032005 Ga0307411_10139741 Ga0307411_101397412 396
250 3300046522 Ga0495643_0017045 Ga0495643_0017045_2982_4202 396
251 3300046616 Ga0495668_0000076 Ga0495668_0000076_51293_52513 396
252 3300046660 Ga0495625_0000520 Ga0495625_0000520_46172_47392 396
253 3300048903 Ga0496100_0005025 Ga0496100_0005025_4127_5353 396
254 3300048906 Ga0496103_0117781 Ga0496103_0117781_335_1561 396
255 3300048909 Ga0496106_0004026 Ga0496106_0004026_5410_6636 396
256 3300048910 Ga0496107_0000221 Ga0496107_0000221_14023_15249 396
257 3300048916 Ga0496113_0015080 Ga0496113_0015080_3263_4489 396
258 3300048924 Ga0496121_0042197 Ga0496121_0042197_1159_2361 396
259 3300048929 Ga0496126_0000955 Ga0496126_0000955_12091_13317 396
260 3300053116 Ga0500592_001926 Ga0500592_001926_551_1771 396
261 3300053151 Ga0500604_0022012 Ga0500604_0022012_20_1240 396
262 3300053158 Ga0500627_0000100 Ga0500627_0000100_20845_22065 396
263 3300005262 Ga0065165_1005037 Ga0065165_10050375 397
264 3300025913 Ga0207695_10052359 Ga0207695_100523595 397
265 3300025914 Ga0207671_10002453 Ga0207671_100024534 397
266 3300031456 Ga0307513_10006540 Ga0307513_100065408 397
267 3300046452 Ga0495617_014504 Ga0495617_014504_839_2071 397
268 3300046460 Ga0495638_0001145 Ga0495638_0001145_17069_18283 397
269 3300046471 Ga0495650_0000158 Ga0495650_0000158_55635_56867 397
270 3300046500 Ga0495596_0000006 Ga0495596_0000006_57134_58360 397
271 3300046501 Ga0495607_0008886 Ga0495607_0008886_4072_5298 397
272 3300046506 Ga0495583_0000631 Ga0495583_0000631_9824_11056 397
273 3300046507 Ga0495606_0022008 Ga0495606_0022008_2848_4074 397
274 3300046519 Ga0495632_0029606 Ga0495632_0029606_1030_2256 397
275 3300046522 Ga0495643_0011201 Ga0495643_0011201_60_1286 397
276 3300046558 Ga0495633_0026130 Ga0495633_0026130_1399_2631 397
277 3300046616 Ga0495668_0077851 Ga0495668_0077851_140_1366 397
278 3300046660 Ga0495625_0027361 Ga0495625_0027361_1294_2520 397
279 3300046665 Ga0495661_0040380 Ga0495661_0040380_1375_2607 397
280 3300046665 Ga0495661_0072631 Ga0495661_0072631_367_1593 397
281 3300047472 Ga0495686_0010684 Ga0495686_0010684_1688_2899 397
282 3300053134 Ga0500658_0003688 Ga0500658_0003688_3499_4713 397
283 iso_pu_bacteria 2643221563 2643834238 397
284 iso_pu_bacteria 2643221608 2644055163 397
285 iso_pu_bacteria 2852680915 2852684325 397
286 iso_pu_bacteria 3000865235 3000866873 397
287 3300005617 Ga0068859_100010880 Ga0068859_1000108802 398
288 3300005719 Ga0068861_100000299 Ga0068861_10000029921 398
289 3300006353 Ga0075370_10003188 Ga0075370_100031883 398
290 3300006881 Ga0068865_100108501 Ga0068865_1001085012 398
291 3300006931 Ga0097620_100010880 Ga0097620_1000108802 398
292 3300009177 Ga0105248_10001023 Ga0105248_1000102322 398
293 3300025941 Ga0207711_10000912 Ga0207711_100009128 398
294 3300026118 Ga0207675_100000394 Ga0207675_10000039422 398
295 3300028786 Ga0307517_10014999 Ga0307517_1001499910 398
296 3300032004 Ga0307414_10180773 Ga0307414_101807732 398
297 3300046453 Ga0495627_000278 Ga0495627_000278_40594_41853 398
298 3300046471 Ga0495650_0003474 Ga0495650_0003474_5959_7218 398
299 3300047470 Ga0495681_0000974 Ga0495681_0000974_11344_12603 398
300 3300047472 Ga0495686_0000340 Ga0495686_0000340_9743_10969 398
301 3300048924 Ga0496121_0000347 Ga0496121_0000347_70530_71741 398
302 3300053121 Ga0500607_000009 Ga0500607_000009_25401_26603 398
303 3300053136 Ga0500559_0001649 Ga0500559_0001649_8802_10004 398
304 3300053136 Ga0500559_0015729 Ga0500559_0015729_1731_2933 398
305 3300053178 Ga0500637_0001397 Ga0500637_0001397_4377_5579 398
306 3300053730 Ga0500645_001762 Ga0500645_001762_786_1988 398
307 iso_pu_bacteria 2919138771 2919143104 398
308 3300006042 Ga0075368_10004412 Ga0075368_100044121 399
309 3300006177 Ga0075362_10004550 Ga0075362_100045504 399
310 3300006178 Ga0075367_10002649 Ga0075367_1000264910 399
311 3300006195 Ga0075366_10009143 Ga0075366_100091435 399
312 3300006353 Ga0075370_10016709 Ga0075370_100167094 399
313 3300027866 Ga0209813_10000060 Ga0209813_1000006022 399
314 3300031731 Ga0307405_10002903 Ga0307405_100029034 399
315 3300031911 Ga0307412_10010045 Ga0307412_100100454 399
316 3300038443 Ga0395901_0080949 Ga0395901_0080949_331_1560 399
317 3300050489 nmdc:mga03683_393_c1 nmdc:mga03683_393_c1_8403_9605 399
318 3300050493 nmdc:mga0k408_89124_c1 nmdc:mga0k408_89124_c1_401_1603 399
319 3300050494 nmdc:mga06z11_388_c1 nmdc:mga06z11_388_c1_10465_11667 399
320 3300050495 nmdc:mga04h51_73_c1 nmdc:mga04h51_73_c1_21484_22686 399
321 3300050496 nmdc:mga07m45_5_c2 nmdc:mga07m45_5_c2_236827_238029 399
322 3300050516 nmdc:mga0sz30_209_c1 nmdc:mga0sz30_209_c1_7461_8663 399
323 iso_pu_bacteria 2738541275 2738710734 399
324 iso_pu_bacteria 2738541301 2738849159 399
325 iso_pu_bacteria 2738541304 2738864888 399
326 iso_pu_bacteria 2738543022 2739297406 399
327 iso_pu_bacteria 2738543033 2739359084 399
328 iso_pu_bacteria 2928100450 2928100837 399
329 iso_pu_bacteria 2928959182 2928960902 399
330 3300001979 JGI24740J21852_10007561 JGI24740J21852_100075615 400
331 3300001989 JGI24739J22299_10008795 JGI24739J22299_100087952 400
332 3300001990 JGI24737J22298_10000905 JGI24737J22298_100009052 400
333 3300003759 Ga0055525_1000012 Ga0055525_1000012325 400
334 3300003762 Ga0055542_1000355 Ga0055542_100035533 400
335 3300003763 Ga0055529_1000045 Ga0055529_1000045163 400
336 3300005327 Ga0070658_10001571 Ga0070658_1000157113 400
337 3300005330 Ga0070690_100045048 Ga0070690_1000450482 400
338 3300005331 Ga0070670_100079503 Ga0070670_1000795031 400
339 3300005339 Ga0070660_100033442 Ga0070660_1000334421 400
340 3300005344 Ga0070661_100011035 Ga0070661_1000110352 400
341 3300005347 Ga0070668_100095230 Ga0070668_1000952302 400
342 3300005356 Ga0070674_100034152 Ga0070674_1000341521 400
343 3300005367 Ga0070667_100046664 Ga0070667_1000466643 400
344 3300005457 Ga0070662_100102594 Ga0070662_1001025942 400
345 3300005539 Ga0068853_100111428 Ga0068853_1001114282 400
346 3300005563 Ga0068855_100016252 Ga0068855_1000162522 400
347 3300005564 Ga0070664_100026441 Ga0070664_1000264413 400
348 3300005614 Ga0068856_100157129 Ga0068856_1001571292 400
349 3300005834 Ga0068851_10009573 Ga0068851_100095735 400
350 3300006058 Ga0075432_10001768 Ga0075432_100017682 400
351 3300006186 Ga0075369_10008054 Ga0075369_100080542 400
352 3300006195 Ga0075366_10011463 Ga0075366_100114632 400
353 3300006353 Ga0075370_10001111 Ga0075370_100011114 400
354 3300006353 Ga0075370_10028082 Ga0075370_100280823 400
355 3300006946 Ga0079104_1014634 Ga0079104_10146342 400
356 3300009174 Ga0105241_10069590 Ga0105241_100695902 400
357 3300009551 Ga0105238_10183084 Ga0105238_101830842 400
358 3300010375 Ga0105239_10135119 Ga0105239_101351192 400
359 3300012513 Ga0157326_1001490 Ga0157326_10014902 400
360 3300013102 Ga0157371_10000032 Ga0157371_1000003282 400
361 3300013104 Ga0157370_10163395 Ga0157370_101633952 400
362 3300013105 Ga0157369_10065036 Ga0157369_100650363 400
363 3300017792 Ga0163161_10135562 Ga0163161_101355622 400
364 3300025230 Ga0209563_100030 Ga0209563_100030125 400
365 3300025253 Ga0209677_107661 Ga0209677_1076612 400
366 3300025254 Ga0209148_1000011 Ga0209148_1000011602 400
367 3300025272 Ga0209455_1000006 Ga0209455_1000006592 400
368 3300025297 Ga0209758_1000001 Ga0209758_1000001276 400
369 3300025321 Ga0207656_10000378 Ga0207656_100003788 400
370 3300025901 Ga0207688_10085086 Ga0207688_100850862 400
371 3300025904 Ga0207647_10051147 Ga0207647_100511472 400
372 3300025909 Ga0207705_10006619 Ga0207705_1000661910 400
373 3300025911 Ga0207654_10005404 Ga0207654_100054046 400
374 3300025913 Ga0207695_10015610 Ga0207695_100156102 400
375 3300025914 Ga0207671_10008049 Ga0207671_100080496 400
376 3300025919 Ga0207657_10007801 Ga0207657_100078019 400
377 3300025920 Ga0207649_10000482 Ga0207649_1000048212 400
378 3300025924 Ga0207694_10038986 Ga0207694_100389862 400
379 3300025932 Ga0207690_10000696 Ga0207690_1000069616 400
380 3300025945 Ga0207679_10057954 Ga0207679_100579543 400
381 3300025949 Ga0207667_10000002 Ga0207667_10000002332 400
382 3300025981 Ga0207640_10000586 Ga0207640_1000058614 400
383 3300026041 Ga0207639_10006007 Ga0207639_100060072 400
384 3300026067 Ga0207678_10020590 Ga0207678_100205907 400
385 3300026078 Ga0207702_10076672 Ga0207702_100766722 400
386 3300026116 Ga0207674_10013772 Ga0207674_100137729 400
387 3300026118 Ga0207675_100188482 Ga0207675_1001884822 400
388 3300026142 Ga0207698_10005612 Ga0207698_100056122 400
389 3300028379 Ga0268266_10000002 Ga0268266_100000021693 400
390 3300028786 Ga0307517_10015806 Ga0307517_100158067 400
391 3300031251 Ga0265327_10020461 Ga0265327_100204614 400
392 3300037312 Ga0395899_0031849 Ga0395899_0031849_588_1817 400
393 3300046474 Ga0495605_0069596 Ga0495605_0069596_71_1300 400
394 3300046492 Ga0495585_0004856 Ga0495585_0004856_6767_7996 400
395 3300046492 Ga0495585_0052350 Ga0495585_0052350_893_2122 400
396 3300046506 Ga0495583_0020282 Ga0495583_0020282_1403_2632 400
397 3300046507 Ga0495606_0000672 Ga0495606_0000672_21340_22569 400
398 3300046518 Ga0495631_0008798 Ga0495631_0008798_1026_2255 400
399 3300046520 Ga0495637_0015883 Ga0495637_0015883_1629_2858 400
400 3300046522 Ga0495643_0003727 Ga0495643_0003727_7759_8988 400
401 3300046522 Ga0495643_0020288 Ga0495643_0020288_1368_2597 400
402 3300046522 Ga0495643_0021086 Ga0495643_0021086_1972_3201 400
403 3300046524 Ga0495648_0000143 Ga0495648_0000143_43238_44467 400
404 3300046525 Ga0495663_0001342 Ga0495663_0001342_1427_2656 400
405 3300046528 Ga0495642_0009263 Ga0495642_0009263_1714_2943 400
406 3300046530 Ga0495654_0020341 Ga0495654_0020341_458_1666 400
407 3300046538 Ga0495609_0032441 Ga0495609_0032441_14_1243 400
408 3300046558 Ga0495633_0004678 Ga0495633_0004678_3661_4890 400
409 3300046616 Ga0495668_0000016 Ga0495668_0000016_298191_299420 400
410 3300046616 Ga0495668_0051903 Ga0495668_0051903_411_1613 400
411 3300046660 Ga0495625_0000150 Ga0495625_0000150_43285_44514 400
412 3300046660 Ga0495625_0054961 Ga0495625_0054961_1545_2774 400
413 3300046684 Ga0495669_0000050 Ga0495669_0000050_12846_14075 400
414 3300046810 Ga0495660_0029202 Ga0495660_0029202_227_1456 400
415 3300047323 Ga0495683_0000963 Ga0495683_0000963_9127_10356 400
416 3300047323 Ga0495683_0009437 Ga0495683_0009437_1140_2369 400
417 3300047443 Ga0495687_001845 Ga0495687_001845_11177_12406 400
418 3300047443 Ga0495687_002183 Ga0495687_002183_8917_10146 400
419 3300047470 Ga0495681_0004732 Ga0495681_0004732_4300_5529 400
420 3300048905 Ga0496102_0000199 Ga0496102_0000199_16832_18061 400
421 3300048906 Ga0496103_0000633 Ga0496103_0000633_9013_10242 400
422 3300048907 Ga0496104_0011045 Ga0496104_0011045_4141_5370 400
423 3300048908 Ga0496105_0000690 Ga0496105_0000690_16951_18180 400
424 3300048909 Ga0496106_0184571 Ga0496106_0184571_127_1356 400
425 3300048913 Ga0496110_0112948 Ga0496110_0112948_778_2007 400
426 3300048914 Ga0496111_0032279 Ga0496111_0032279_1428_2657 400
427 3300048917 Ga0496114_0002491 Ga0496114_0002491_7008_8237 400
428 3300048918 Ga0496115_0000131 Ga0496115_0000131_55048_56277 400
429 3300048919 Ga0496116_0011618 Ga0496116_0011618_2361_3590 400
430 3300048920 Ga0496117_0000352 Ga0496117_0000352_63303_64532 400
431 3300048921 Ga0496118_0000092 Ga0496118_0000092_151136_152365 400
432 3300048922 Ga0496119_0004697 Ga0496119_0004697_2471_3700 400
433 3300048923 Ga0496120_0009062 Ga0496120_0009062_182_1411 400
434 3300048924 Ga0496121_0000228 Ga0496121_0000228_55085_56314 400
435 3300048926 Ga0496123_0022617 Ga0496123_0022617_2984_4213 400
436 3300048927 Ga0496124_0000081 Ga0496124_0000081_55977_57206 400
437 3300048928 Ga0496125_0000980 Ga0496125_0000980_17687_18916 400
438 3300048929 Ga0496126_0000283 Ga0496126_0000283_16750_17979 400
439 3300049571 Ga0501034_0408031 Ga0501034_0408031_48_1271 400
440 3300050493 nmdc:mga0k408_10130_c1 nmdc:mga0k408_10130_c1_3077_4306 400
441 3300050516 nmdc:mga0sz30_33943_c1 nmdc:mga0sz30_33943_c1_354_1583 400
442 3300053079 Ga0500610_0009443 Ga0500610_0009443_1679_2908 400
443 3300053130 Ga0500642_0000393 Ga0500642_0000393_9897_11126 400
444 3300053153 Ga0500616_0003363 Ga0500616_0003363_4918_6144 400
445 3300053154 Ga0500619_013931 Ga0500619_013931_674_1915 400
446 3300053156 Ga0500622_0000253 Ga0500622_0000253_28971_30173 400
447 3300053730 Ga0500645_000002 Ga0500645_000002_20018_21247 400
448 iso_pu_bacteria 2643221588 2643948371 400
449 iso_pu_bacteria 2739367664 2739651271 400
450 iso_pu_bacteria 2739367865 2740029744 400
451 3300006195 Ga0075366_10004768 Ga0075366_100047686 401
452 3300044735 Ga0466968_0013146 Ga0466968_0013146_1341_2564 401
453 3300050493 nmdc:mga0k408_1586_c2 nmdc:mga0k408_1586_c2_927_2135 401
454 3300050496 nmdc:mga07m45_2163_c1 nmdc:mga07m45_2163_c1_4386_5600 401
455 3300053087 Ga0500643_000001 Ga0500643_000001_361055_362284 401
456 3300053096 Ga0500641_0065873 Ga0500641_0065873_177_1412 401
457 3300053140 Ga0500573_0055338 Ga0500573_0055338_637_1866 401
458 iso_pu_bacteria 2896184354 2896186614 401
459 iso_pu_bacteria 2896253425 2896254382 401
460 3300005289 Ga0065704_10084596 Ga0065704_100845962 402
461 3300005331 Ga0070670_100054077 Ga0070670_1000540773 402
462 3300005353 Ga0070669_100000139 Ga0070669_10000013947 402
463 3300005548 Ga0070665_100000101 Ga0070665_100000101153 402
464 3300005841 Ga0068863_100017402 Ga0068863_1000174022 402
465 3300005842 Ga0068858_100057331 Ga0068858_1000573312 402
466 3300005844 Ga0068862_100028918 Ga0068862_1000289182 402
467 3300009011 Ga0105251_10001250 Ga0105251_1000125023 402
468 3300009101 Ga0105247_10010323 Ga0105247_100103235 402
469 3300009177 Ga0105248_10184415 Ga0105248_101844152 402
470 3300009553 Ga0105249_10163607 Ga0105249_101636072 402
471 3300025735 Ga0207713_1003912 Ga0207713_10039125 402
472 3300025923 Ga0207681_10000179 Ga0207681_100001795 402
473 3300025931 Ga0207644_10001696 Ga0207644_100016966 402
474 3300025941 Ga0207711_10004180 Ga0207711_100041802 402
475 3300025986 Ga0207658_10027744 Ga0207658_100277442 402
476 3300026088 Ga0207641_10017539 Ga0207641_100175392 402
477 3300028379 Ga0268266_10000239 Ga0268266_1000023947 402
478 3300031852 Ga0307410_10109452 Ga0307410_101094522 402
479 3300048919 Ga0496116_0016826 Ga0496116_0016826_880_2127 402
480 3300048921 Ga0496118_0077898 Ga0496118_0077898_201_1448 402
481 3300048922 Ga0496119_0026586 Ga0496119_0026586_2241_3488 402
482 3300048923 Ga0496120_0029800 Ga0496120_0029800_640_1887 402
483 3300048926 Ga0496123_0031503 Ga0496123_0031503_1773_3020 402
484 3300048928 Ga0496125_0086169 Ga0496125_0086169_232_1479 402
485 iso_pu_bacteria 2895880812 2895884788 402
486 3300005327 Ga0070658_10010285 Ga0070658_100102855 403
487 3300005327 Ga0070658_10014487 Ga0070658_100144874 403
488 3300005327 Ga0070658_10108164 Ga0070658_101081642 403
489 3300005329 Ga0070683_100003226 Ga0070683_10000322614 403
490 3300005336 Ga0070680_100010656 Ga0070680_1000106562 403
491 3300005339 Ga0070660_100002160 Ga0070660_1000021606 403
492 3300005344 Ga0070661_100001061 Ga0070661_10000106112 403
493 3300005366 Ga0070659_100008276 Ga0070659_1000082764 403
494 3300005457 Ga0070662_100001696 Ga0070662_1000016962 403
495 3300005458 Ga0070681_10005920 Ga0070681_1000592011 403
496 3300005530 Ga0070679_100004469 Ga0070679_1000044696 403
497 3300005530 Ga0070679_100015815 Ga0070679_1000158154 403
498 3300005530 Ga0070679_100020119 Ga0070679_1000201193 403
499 3300005535 Ga0070684_100029316 Ga0070684_1000293162 403
500 3300005539 Ga0068853_100008054 Ga0068853_1000080544 403
501 3300005563 Ga0068855_100004017 Ga0068855_10000401714 403
502 3300005564 Ga0070664_100038836 Ga0070664_1000388362 403
503 3300005577 Ga0068857_100193542 Ga0068857_1001935422 403
504 3300005578 Ga0068854_100037775 Ga0068854_1000377752 403
505 3300005614 Ga0068856_100049867 Ga0068856_1000498672 403
506 3300010375 Ga0105239_10059536 Ga0105239_100595362 403
507 3300013100 Ga0157373_10005198 Ga0157373_100051984 403
508 3300013102 Ga0157371_10001531 Ga0157371_100015319 403
509 3300013104 Ga0157370_10004317 Ga0157370_1000431711 403
510 3300013105 Ga0157369_10002247 Ga0157369_1000224714 403
511 3300013307 Ga0157372_10004467 Ga0157372_100044676 403
512 3300025909 Ga0207705_10000637 Ga0207705_1000063726 403
513 3300025909 Ga0207705_10009600 Ga0207705_100096004 403
514 3300025909 Ga0207705_10011018 Ga0207705_100110184 403
515 3300025912 Ga0207707_10065315 Ga0207707_100653153 403
516 3300025917 Ga0207660_10005603 Ga0207660_100056034 403
517 3300025919 Ga0207657_10001083 Ga0207657_1000108319 403
518 3300025919 Ga0207657_10016392 Ga0207657_100163924 403
519 3300025921 Ga0207652_10002246 Ga0207652_100022466 403
520 3300025921 Ga0207652_10005534 Ga0207652_100055345 403
521 3300025921 Ga0207652_10026805 Ga0207652_100268054 403
522 3300025932 Ga0207690_10000506 Ga0207690_1000050615 403
523 3300025932 Ga0207690_10078656 Ga0207690_100786562 403
524 3300025932 Ga0207690_10094020 Ga0207690_100940202 403
525 3300025933 Ga0207706_10002162 Ga0207706_100021625 403
526 3300025944 Ga0207661_10124085 Ga0207661_101240852 403
527 3300025945 Ga0207679_10026833 Ga0207679_100268332 403
528 3300025949 Ga0207667_10005551 Ga0207667_1000555113 403
529 3300025949 Ga0207667_10293038 Ga0207667_102930381 403
530 3300025981 Ga0207640_10040599 Ga0207640_100405993 403
531 3300026041 Ga0207639_10001972 Ga0207639_100019728 403
532 3300026067 Ga0207678_10030203 Ga0207678_100302034 403
533 3300026078 Ga0207702_10017889 Ga0207702_100178892 403
534 3300026116 Ga0207674_10031161 Ga0207674_100311615 403
535 3300026116 Ga0207674_10049550 Ga0207674_100495502 403
536 3300049570 Ga0501033_0110216 Ga0501033_0110216_749_1981 403
537 3300049572 Ga0501036_0043827 Ga0501036_0043827_762_1994 403
538 3300049581 Ga0501047_0194909 Ga0501047_0194909_186_1418 403
539 3300006353 Ga0075370_10017832 Ga0075370_100178322 404
540 3300009148 Ga0105243_10013621 Ga0105243_100136215 404
541 3300013306 Ga0163162_10086963 Ga0163162_100869632 404
542 3300025935 Ga0207709_10046285 Ga0207709_100462852 404
543 3300027876 Ga0209974_10001551 Ga0209974_100015512 404
544 3300031548 Ga0307408_100021871 Ga0307408_1000218712 404
545 3300032002 Ga0307416_100017737 Ga0307416_1000177373 404
546 3300032005 Ga0307411_10013678 Ga0307411_100136785 404
547 3300032126 Ga0307415_100088977 Ga0307415_1000889772 404
548 3300045051 Ga0451576_0000024 Ga0451576_0000024_454093_455334 404
549 3300046475 Ga0495639_0046696 Ga0495639_0046696_543_1781 404
550 3300046530 Ga0495654_0082184 Ga0495654_0082184_192_1430 404
551 3300053138 Ga0500564_001534 Ga0500564_001534_4498_5736 404
552 3300053729 Ga0500625_000005 Ga0500625_000005_175514_176752 404
553 iso_pu_bacteria 2848297114 2848298819 404
554 iso_pu_bacteria 8054302542 8054303122 404
555 3300005289 Ga0065704_10001580 Ga0065704_1000158013 405
556 3300005327 Ga0070658_10016667 Ga0070658_100166674 405
557 3300005347 Ga0070668_100000650 Ga0070668_10000065019 405
558 3300005353 Ga0070669_100002049 Ga0070669_10000204911 405
559 3300005355 Ga0070671_100001672 Ga0070671_1000016728 405
560 3300005367 Ga0070667_100002441 Ga0070667_10000244111 405
561 3300005548 Ga0070665_100001723 Ga0070665_10000172318 405
562 3300005841 Ga0068863_100172959 Ga0068863_1001729592 405
563 3300005843 Ga0068860_100011153 Ga0068860_1000111537 405
564 3300006177 Ga0075362_10010458 Ga0075362_100104583 405
565 3300009553 Ga0105249_10022999 Ga0105249_100229994 405
566 3300013306 Ga0163162_10027215 Ga0163162_100272152 405
567 3300025711 Ga0207696_1002899 Ga0207696_10028992 405
568 3300025735 Ga0207713_1005617 Ga0207713_10056177 405
569 3300025923 Ga0207681_10000467 Ga0207681_1000046718 405
570 3300025931 Ga0207644_10009126 Ga0207644_100091267 405
571 3300025961 Ga0207712_10031707 Ga0207712_100317073 405
572 3300025972 Ga0207668_10000523 Ga0207668_100005236 405
573 3300025986 Ga0207658_10002340 Ga0207658_100023409 405
574 3300028379 Ga0268266_10001120 Ga0268266_100011208 405
575 3300028380 Ga0268265_10057401 Ga0268265_100574013 405
576 3300028381 Ga0268264_10011204 Ga0268264_100112046 405
577 3300031911 Ga0307412_10119984 Ga0307412_101199841 405
578 3300032004 Ga0307414_10144064 Ga0307414_101440641 405
579 3300036712 Ga0316584_0014468 Ga0316584_0014468_1581_2834 405
580 3300048905 Ga0496102_0000856 Ga0496102_0000856_11880_13121 405
581 3300048906 Ga0496103_0000140 Ga0496103_0000140_17240_18481 405
582 3300048907 Ga0496104_0001582 Ga0496104_0001582_18107_19348 405
583 3300048908 Ga0496105_0005353 Ga0496105_0005353_7176_8417 405
584 3300048910 Ga0496107_0041029 Ga0496107_0041029_1186_2427 405
585 3300048915 Ga0496112_0003754 Ga0496112_0003754_5303_6544 405
586 3300048916 Ga0496113_0000197 Ga0496113_0000197_17246_18487 405
587 3300048918 Ga0496115_0051369 Ga0496115_0051369_2051_3292 405
588 3300048919 Ga0496116_0058238 Ga0496116_0058238_812_2053 405
589 3300048920 Ga0496117_0000331 Ga0496117_0000331_7032_8273 405
590 3300048921 Ga0496118_0003689 Ga0496118_0003689_11327_12568 405
591 3300048923 Ga0496120_0005607 Ga0496120_0005607_8245_9486 405
592 3300048924 Ga0496121_0037720 Ga0496121_0037720_1684_2925 405
593 3300048925 Ga0496122_0031341 Ga0496122_0031341_2772_4013 405
594 3300048926 Ga0496123_0009148 Ga0496123_0009148_543_1784 405
595 3300048927 Ga0496124_0002273 Ga0496124_0002273_22618_23859 405
596 3300048928 Ga0496125_0003982 Ga0496125_0003982_13370_14611 405
597 3300048929 Ga0496126_0000051 Ga0496126_0000051_17271_18512 405
598 3300050489 nmdc:mga03683_24257_c1 nmdc:mga03683_24257_c1_1044_2288 405
599 3300053125 Ga0500618_000211 Ga0500618_000211_36126_37349 405
600 3300053148 Ga0500590_000367 Ga0500590_000367_8364_9701 405
601 3300005366 Ga0070659_100088796 Ga0070659_1000887963 407
602 3300006051 Ga0075364_10020007 Ga0075364_100200074 407
603 3300006177 Ga0075362_10076030 Ga0075362_100760301 407
604 3300013308 Ga0157375_10430563 Ga0157375_104305632 407
605 3300025944 Ga0207661_10004071 Ga0207661_100040715 407
606 3300045051 Ga0451576_0162645 Ga0451576_0162645_308_1558 407
607 3300048929 Ga0496126_0075909 Ga0496126_0075909_553_1800 407
608 3300050489 nmdc:mga03683_45295_c1 nmdc:mga03683_45295_c1_65_1291 407
609 3300050491 nmdc:mga00v17_1341_c1 nmdc:mga00v17_1341_c1_6946_8172 407
610 3300002459 JGI24751J29686_10000084 JGI24751J29686_100000843 408
611 3300002459 JGI24751J29686_10000279 JGI24751J29686_1000027918 408
612 3300005289 Ga0065704_10070184 Ga0065704_1007018411 408
613 3300005327 Ga0070658_10000144 Ga0070658_1000014424 408
614 3300005614 Ga0068856_100018169 Ga0068856_1000181694 408
615 3300005614 Ga0068856_100241157 Ga0068856_1002411572 408
616 3300005616 Ga0068852_100000273 Ga0068852_10000027328 408
617 3300005616 Ga0068852_100006730 Ga0068852_1000067304 408
618 3300005843 Ga0068860_100012804 Ga0068860_1000128045 408
619 3300009093 Ga0105240_10001369 Ga0105240_100013692 408
620 3300009093 Ga0105240_10248869 Ga0105240_102488692 408
621 3300025904 Ga0207647_10013331 Ga0207647_100133312 408
622 3300025909 Ga0207705_10000155 Ga0207705_1000015538 408
623 3300025924 Ga0207694_10024085 Ga0207694_100240854 408
624 3300026078 Ga0207702_10013356 Ga0207702_100133564 408
625 3300026078 Ga0207702_10273642 Ga0207702_102736421 408
626 3300026142 Ga0207698_10000179 Ga0207698_1000017928 408
627 3300026142 Ga0207698_10011951 Ga0207698_100119511 408
628 3300026142 Ga0207698_10255246 Ga0207698_102552462 408
629 3300046500 Ga0495596_0000830 Ga0495596_0000830_11696_12922 408
630 3300046512 Ga0495610_0000116 Ga0495610_0000116_61699_62925 408
631 3300046512 Ga0495610_0001706 Ga0495610_0001706_949_2175 408
632 3300048090 Ga0495615_0000126 Ga0495615_0000126_3952_5178 408
633 3300048091 Ga0495626_0000165 Ga0495626_0000165_24615_25841 408
634 3300048919 Ga0496116_0000035 Ga0496116_0000035_321272_322498 408
635 3300048921 Ga0496118_0008603 Ga0496118_0008603_5477_6703 408
636 3300048924 Ga0496121_0001542 Ga0496121_0001542_23494_24720 408
637 3300048925 Ga0496122_0005106 Ga0496122_0005106_3841_5067 408
638 3300048926 Ga0496123_0000159 Ga0496123_0000159_113471_114697 408
639 3300048926 Ga0496123_0002869 Ga0496123_0002869_15214_16440 408
640 3300048927 Ga0496124_0002527 Ga0496124_0002527_3708_4934 408
641 3300048927 Ga0496124_0098846 Ga0496124_0098846_331_1557 408
642 3300048928 Ga0496125_0043169 Ga0496125_0043169_2526_3752 408
643 3300048929 Ga0496126_0000077 Ga0496126_0000077_103794_105020 408
644 3300005844 Ga0068862_100004597 Ga0068862_1000045974 409
645 3300009101 Ga0105247_10035453 Ga0105247_100354533 409
646 3300009147 Ga0114129_10183624 Ga0114129_101836243 409
647 3300025900 Ga0207710_10015220 Ga0207710_100152203 409
648 3300028380 Ga0268265_10001670 Ga0268265_1000167017 409
649 3300049581 Ga0501047_0103401 Ga0501047_0103401_254_1519 410
650 2162886007 SwRhRL2b_contig_2139679 SwRhRL2b_0810.00002100 412
651 3300025298 Ga0209050_1000127 Ga0209050_10001274 412
652 iso_pu_bacteria 2818991438 2819552212 412

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03739

LptF_LptG

Lipopolysaccharide export system permease LptF/LptG

49

405

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6s8g-assembly1.cif.gz_F cryo-em structure of lptb2fgc in complex with amp-pnp 0.8884 10 365
6s8n-assembly1.cif.gz_F cryo-em structure of lptb2fgc in complex with lipopolysaccharide 0.8871 10 365
6s8g-assembly1.cif.gz_F cryo-em structure of lptb2fgc in complex with amp-pnp 0.86 10 365
7efo-assembly1.cif.gz_F lptb2fg-lps from klebsiella pneumoniae in nanodiscs 0.8583 10 366
6s8n-assembly1.cif.gz_F cryo-em structure of lptb2fgc in complex with lipopolysaccharide 0.8559 10 365
ID Description Score Start End Superfamily
af_Q4D131_41_117_2.30.30.100 Mainly Beta;Roll;SH3 type barrels.; 0.5946 179 242 2.30.30.100
af_P32774_58_118_2.30.18.10 Mainly Beta;Roll;TATA box binding Protein, subunit D; domain 2;Transcription factor IIA (TFIIA), beta-barrel domain 0.5793 193 243 2.30.18.10
af_Q7K010_1_97_1.20.5.110 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; 0.5334 262 335 1.20.5.110
af_O74483_1_71_2.30.30.100 Mainly Beta;Roll;SH3 type barrels.; 0.5109 184 240 2.30.30.100
af_P32774_58_118_2.30.18.10 Mainly Beta;Roll;TATA box binding Protein, subunit D; domain 2;Transcription factor IIA (TFIIA), beta-barrel domain 0.4888 193 243 2.30.18.10
ID Description Score Start End GO Terms
AF-A0A522AD52-F1-model_v4 LptF/LptG family permease 0.9475 10 143 GO:0015920
GO:0043190
AF-A0A356E3V0-F1-model_v4 Permease 0.9468 11 143 GO:0015920
GO:0043190
AF-A0A3C1WIC5-F1-model_v4 YjgP/YjgQ family permease 0.9299 9 130 GO:0015920
GO:0043190
AF-A0A651FW52-F1-model_v4 LptF/LptG family permease 0.9262 12 147 GO:0015920
GO:0043190
AF-A0A432HXB4-F1-model_v4 LptF/LptG family permease 0.917 9 147 GO:0015920
GO:0043190

Feature Viewer

pLDDT pTM Quality
82.9 0.72 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map