F472639
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 651 | 286 | 1302 | 200 |
Family's Representative Sequence
| Representative Sequence | 3300049744|Ga0501083_0020870|Ga0501083_0020870_90_773 |
| Length | 227 |
| Sequence | MWLVPYGSPGVRASEAPTTEVTVSDTEQRGTHVPADETEAVRAAEAAEEQGLLFTDDVSPLPSDTGYRGPTACNAAGITYRQLDYWARTGLVEPSVRSATGSGSQRLYSFRDILLLKVIKRLLDAGISLQQIRTAVQHLRNRGTDDLTRVTLMSDGASVYECTSNDEVIDLLQGGQGVFGIAIGGVWREIEGSLSELPSERAGTDEAQAGPMPGDELAARRAARNAG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 2 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 7 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 8 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 9 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 29 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 35 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 37 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 38 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 40 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 41 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 42 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 43 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 44 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 45 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 46 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 47 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 48 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 49 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 50 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 51 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 53 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 54 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 55 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 57 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 58 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 59 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 60 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 61 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 62 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 63 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300012482 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 | Metagenome | Rhizosphere |
| 74 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 80 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 82 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 84 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 85 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 86 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 87 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 88 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 89 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 90 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 91 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 124 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 128 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 129 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 130 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 131 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 132 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 133 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 134 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 135 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 136 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 137 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 138 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 139 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 140 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 141 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 142 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 143 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 144 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 145 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 146 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 147 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 148 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 149 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 150 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 151 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 152 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 153 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 154 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 155 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 156 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 157 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 158 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 159 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 160 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 161 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 162 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 163 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 164 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 165 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 166 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 167 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 168 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 169 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 170 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 171 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 172 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 173 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 174 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 182 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 183 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 184 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 185 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 186 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 187 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 188 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 189 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 190 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 191 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 192 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 193 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 194 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 195 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 196 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 197 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 198 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 199 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 200 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 201 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 202 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 203 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 204 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 205 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 206 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 207 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 208 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 209 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 210 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 211 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 212 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 213 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 214 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 215 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 216 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 217 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 218 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 219 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 220 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 221 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 222 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 225 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 226 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 227 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 228 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 229 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 230 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 231 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 232 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 233 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 234 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 235 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 236 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 237 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 238 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 239 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 240 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 241 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 242 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 243 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 248 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 249 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 250 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 251 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 252 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 254 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 255 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 256 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 258 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 259 | 2643221576 | Nocardioides sp. Root614 | Isolate | Unclassified |
| 260 | 2643221590 | Nocardioides sp. Root682 | Isolate | Unclassified |
| 261 | 2643221604 | Nocardioides sp. Root190 | Isolate | Unclassified |
| 262 | 2643221615 | Nocardioides sp. Root224 | Isolate | Unclassified |
| 263 | 2643221617 | Nocardioides sp. Root79 | Isolate | Unclassified |
| 264 | 2643221620 | Nocardioides sp. Root240 | Isolate | Unclassified |
| 265 | 2643221641 | Nocardioides sp. Root122 | Isolate | Unclassified |
| 266 | 2643221657 | Nocardioides sp. Root1257 | Isolate | Unclassified |
| 267 | 2643221681 | Aeromicrobium sp. Root472D3 | Isolate | Unclassified |
| 268 | 2643221711 | Terrabacter sp. Root85 | Isolate | Unclassified |
| 269 | 2643221961 | Aeromicrobium sp. Root236 | Isolate | Unclassified |
| 270 | 2643221962 | Aeromicrobium sp. Root344 | Isolate | Unclassified |
| 271 | 2738541305 | Nocardioides sp. CF167 | Isolate | Unclassified |
| 272 | 2739367898 | Nocardioides sp. CF479 | Isolate | Unclassified |
| 273 | 2773857762 | Nocardioides sp. SAI-095 | Isolate | Unclassified |
| 274 | 2808606439 | Nocardioides sp. SLBN-172 | Isolate | Unclassified |
| 275 | 2811994874 | Nocardioides sp. SLBN-35 | Isolate | Unclassified |
| 276 | 2811994878 | Nocardioides sp. SLBN-169 | Isolate | Unclassified |
| 277 | 2816332119 | Kribbella amoyensis DSM 24683 | Isolate | Rhizosphere |
| 278 | 2855386786 | Nocardioides ferulae EGI 63112 | Isolate | Unclassified |
| 279 | 2857481737 | Nocardioides sp. R-74106 | Isolate | Unclassified |
| 280 | 2873314349 | Sphaerisporangium siamense DSM 45784 | Isolate | Rhizosphere |
| 281 | 2891968417 | Nocardioides luteus SAI-037 | Isolate | Unclassified |
| 282 | 2984576629 | Nocardioides zeae SORGH_AS913 | Isolate | Aerial Root |
| 283 | 2984592036 | Aeromicrobium sp. SORGH_AS981 | Isolate | Aerial Root |
| 284 | 2990256926 | Nocardioides zeae SORGH_AS885 | Isolate | Aerial Root |
| 285 | 8054609563 | Nocardioides astragali CGMCC 4.7327 | Isolate | Nodule |
| 286 | 8055066027 | Sphaerisporangium corydalis NEAU-YHS15 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.86 |
| Metatranscriptomes | 3.84 |
| Isolates | 4.3 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.46 |
| Bulb | 0 |
| Endosphere | 11.21 |
| Nodule | 0.15 |
| Rhizoplane | 5.99 |
| Rhizosphere | 76.5 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501083_0020870 | 3300049744 | Bacteria | 4553 |
| 2 | LJQas_1003731 | 3300000549 | Bacteria | 2024 |
| 3 | JGI24740J21852_10024066 | 3300001979 | Bacteria | 2070 |
| 4 | JGI24739J22299_10008156 | 3300001989 | Bacteria | 3911 |
| 5 | JGI24737J22298_10008836 | 3300001990 | Bacteria | 3362 |
| 6 | JGI24735J21928_10027133 | 3300002067 | Bacteria | 1717 |
| 7 | JGI24735J21928_10043611 | 3300002067 | Bacteria | 1304 |
| 8 | JGI25407J50210_10022274 | 3300003373 | Bacteria | 1647 |
| 9 | Ga0006562J51391_1050600 | 3300003578 | Bacteria | 2290 |
| 10 | Ga0006562J51391_1050602 | 3300003578 | Bacteria | 1370 |
| 11 | Ga0058862_12652283 | 3300004803 | Bacteria | 860 |
| 12 | Ga0070683_100003740 | 3300005329 | Bacteria | 12410 |
| 13 | Ga0070683_100074850 | 3300005329 | Bacteria | 3163 |
| 14 | Ga0070683_100119383 | 3300005329 | Bacteria | 2490 |
| 15 | Ga0070683_100231775 | 3300005329 | Bacteria | 1756 |
| 16 | Ga0070683_100435434 | 3300005329 | Bacteria | 1251 |
| 17 | Ga0070682_100025384 | 3300005337 | Bacteria | 3535 |
| 18 | Ga0070682_100072157 | 3300005337 | Bacteria | 2212 |
| 19 | Ga0070682_100253115 | 3300005337 | Bacteria | 1271 |
| 20 | Ga0068868_100316386 | 3300005338 | Bacteria | 1329 |
| 21 | Ga0070660_100011867 | 3300005339 | Bacteria | 6210 |
| 22 | Ga0070660_100162212 | 3300005339 | Bacteria | 1802 |
| 23 | Ga0070689_100301495 | 3300005340 | Bacteria | 1334 |
| 24 | Ga0070692_10184768 | 3300005345 | Bacteria | 1211 |
| 25 | Ga0070692_10352561 | 3300005345 | Bacteria | 915 |
| 26 | Ga0070668_100201306 | 3300005347 | Bacteria | 1635 |
| 27 | Ga0070674_100628427 | 3300005356 | Bacteria | 911 |
| 28 | Ga0070659_100008263 | 3300005366 | Bacteria | 7601 |
| 29 | Ga0070659_100166845 | 3300005366 | Bacteria | 1802 |
| 30 | Ga0070667_100307718 | 3300005367 | Bacteria | 1428 |
| 31 | Ga0070667_100922706 | 3300005367 | Bacteria | 813 |
| 32 | Ga0070714_100005337 | 3300005435 | Bacteria | 9799 |
| 33 | Ga0070713_100070762 | 3300005436 | Bacteria | 2945 |
| 34 | Ga0070701_10512628 | 3300005438 | Bacteria | 781 |
| 35 | Ga0070700_100247387 | 3300005441 | Bacteria | 1277 |
| 36 | Ga0070663_100172459 | 3300005455 | Bacteria | 1673 |
| 37 | Ga0070678_100695316 | 3300005456 | Bacteria | 916 |
| 38 | Ga0070662_100049420 | 3300005457 | Bacteria | 3033 |
| 39 | Ga0070681_10122084 | 3300005458 | Bacteria | 2539 |
| 40 | Ga0068867_100622443 | 3300005459 | Bacteria | 944 |
| 41 | Ga0070698_100006744 | 3300005471 | Bacteria | 12448 |
| 42 | Ga0070679_100014118 | 3300005530 | Bacteria | 7661 |
| 43 | Ga0070684_100003215 | 3300005535 | Bacteria | 12221 |
| 44 | Ga0070684_100093938 | 3300005535 | Bacteria | 2671 |
| 45 | Ga0070684_100103686 | 3300005535 | Bacteria | 2544 |
| 46 | Ga0070684_100108037 | 3300005535 | Bacteria | 2493 |
| 47 | Ga0070684_100521094 | 3300005535 | Bacteria | 1102 |
| 48 | Ga0070672_100261385 | 3300005543 | Bacteria | 1460 |
| 49 | Ga0070665_100000718 | 3300005548 | Bacteria | 44076 |
| 50 | Ga0070665_101220385 | 3300005548 | Bacteria | 763 |
| 51 | Ga0068855_100166448 | 3300005563 | Bacteria | 2499 |
| 52 | Ga0068855_100512877 | 3300005563 | Bacteria | 1302 |
| 53 | Ga0070664_100842084 | 3300005564 | Bacteria | 859 |
| 54 | Ga0068857_100033027 | 3300005577 | Bacteria | 4576 |
| 55 | Ga0068857_100055612 | 3300005577 | Bacteria | 3512 |
| 56 | Ga0068857_100293425 | 3300005577 | Bacteria | 1498 |
| 57 | Ga0068856_100023421 | 3300005614 | Bacteria | 6004 |
| 58 | Ga0068856_100322966 | 3300005614 | Bacteria | 1561 |
| 59 | Ga0068856_100558796 | 3300005614 | Bacteria | 1166 |
| 60 | Ga0068856_100633197 | 3300005614 | Bacteria | 1090 |
| 61 | Ga0070702_100020628 | 3300005615 | Bacteria | 3455 |
| 62 | Ga0068852_100375884 | 3300005616 | Bacteria | 1393 |
| 63 | Ga0068852_100742075 | 3300005616 | Bacteria | 994 |
| 64 | Ga0068852_100754076 | 3300005616 | Bacteria | 986 |
| 65 | Ga0068864_100043411 | 3300005618 | Bacteria | 3850 |
| 66 | Ga0068866_10471802 | 3300005718 | Bacteria | 825 |
| 67 | Ga0068861_100280875 | 3300005719 | Bacteria | 1434 |
| 68 | Ga0068861_100377605 | 3300005719 | Bacteria | 1251 |
| 69 | Ga0068858_100059911 | 3300005842 | Bacteria | 3519 |
| 70 | Ga0068860_100000795 | 3300005843 | Bacteria | 35417 |
| 71 | Ga0081455_10002473 | 3300005937 | Bacteria | 21966 |
| 72 | Ga0081455_10008841 | 3300005937 | Bacteria | 10417 |
| 73 | Ga0081455_10030284 | 3300005937 | Bacteria | 4919 |
| 74 | Ga0081455_10094549 | 3300005937 | Bacteria | 2414 |
| 75 | Ga0081538_10000036 | 3300005981 | Bacteria | 119944 |
| 76 | Ga0081538_10020962 | 3300005981 | Bacteria | 4793 |
| 77 | Ga0075365_10031881 | 3300006038 | Bacteria | 3384 |
| 78 | Ga0075365_10032136 | 3300006038 | Bacteria | 3371 |
| 79 | Ga0075365_10064813 | 3300006038 | Bacteria | 2448 |
| 80 | Ga0075365_10065898 | 3300006038 | Bacteria | 2428 |
| 81 | Ga0075365_10084937 | 3300006038 | Bacteria | 2149 |
| 82 | Ga0075365_10156267 | 3300006038 | Bacteria | 1587 |
| 83 | Ga0075365_10212788 | 3300006038 | Bacteria | 1355 |
| 84 | Ga0075365_10217728 | 3300006038 | Bacteria | 1339 |
| 85 | Ga0075365_10256019 | 3300006038 | Bacteria | 1230 |
| 86 | Ga0075365_10266244 | 3300006038 | Bacteria | 1205 |
| 87 | Ga0075365_10413257 | 3300006038 | Bacteria | 952 |
| 88 | Ga0075365_10510682 | 3300006038 | Bacteria | 849 |
| 89 | Ga0075368_10000651 | 3300006042 | Bacteria | 10558 |
| 90 | Ga0075368_10000759 | 3300006042 | Bacteria | 9904 |
| 91 | Ga0075368_10110381 | 3300006042 | Bacteria | 1134 |
| 92 | Ga0075363_100008166 | 3300006048 | Bacteria | 4860 |
| 93 | Ga0075363_100073334 | 3300006048 | Bacteria | 1862 |
| 94 | Ga0075363_100166080 | 3300006048 | Bacteria | 1251 |
| 95 | Ga0075363_100393527 | 3300006048 | Bacteria | 814 |
| 96 | Ga0075364_10015661 | 3300006051 | Bacteria | 4706 |
| 97 | Ga0075364_10048931 | 3300006051 | Bacteria | 2755 |
| 98 | Ga0075364_10167762 | 3300006051 | Bacteria | 1483 |
| 99 | Ga0075364_10252190 | 3300006051 | Bacteria | 1199 |
| 100 | Ga0075364_10484613 | 3300006051 | Bacteria | 845 |
| 101 | Ga0070712_100163138 | 3300006175 | Bacteria | 1722 |
| 102 | Ga0075362_10100951 | 3300006177 | Bacteria | 1349 |
| 103 | Ga0075367_10016017 | 3300006178 | Bacteria | 4088 |
| 104 | Ga0075367_10076401 | 3300006178 | Bacteria | 2021 |
| 105 | Ga0075367_10093513 | 3300006178 | Bacteria | 1831 |
| 106 | Ga0075367_10126344 | 3300006178 | Bacteria | 1578 |
| 107 | Ga0075367_10152289 | 3300006178 | Bacteria | 1436 |
| 108 | Ga0075369_10116084 | 3300006186 | Bacteria | 1209 |
| 109 | Ga0097621_100152868 | 3300006237 | Bacteria | 1979 |
| 110 | Ga0097621_100386406 | 3300006237 | Bacteria | 1251 |
| 111 | Ga0075370_10008207 | 3300006353 | Bacteria | 5359 |
| 112 | Ga0075370_10024266 | 3300006353 | Bacteria | 3348 |
| 113 | Ga0075370_10482815 | 3300006353 | Bacteria | 747 |
| 114 | Ga0075428_100001304 | 3300006844 | Bacteria | 26458 |
| 115 | Ga0075428_100018522 | 3300006844 | Bacteria | 7699 |
| 116 | Ga0075430_100006263 | 3300006846 | Bacteria | 10034 |
| 117 | Ga0075431_100005941 | 3300006847 | Bacteria | 12078 |
| 118 | Ga0075431_100008250 | 3300006847 | Bacteria | 10415 |
| 119 | Ga0075431_100012367 | 3300006847 | Bacteria | 8613 |
| 120 | Ga0075434_100890735 | 3300006871 | Bacteria | 905 |
| 121 | Ga0075429_100001324 | 3300006880 | Bacteria | 20208 |
| 122 | Ga0075429_100005562 | 3300006880 | Bacteria | 10857 |
| 123 | Ga0068865_100053158 | 3300006881 | Bacteria | 2810 |
| 124 | Ga0068865_100194027 | 3300006881 | Bacteria | 1573 |
| 125 | Ga0068865_100458910 | 3300006881 | Bacteria | 1055 |
| 126 | Ga0105245_10030002 | 3300009098 | Bacteria | 4808 |
| 127 | Ga0105245_10467629 | 3300009098 | Bacteria | 1272 |
| 128 | Ga0105245_10897724 | 3300009098 | Bacteria | 928 |
| 129 | Ga0114129_10005577 | 3300009147 | Bacteria | 17801 |
| 130 | Ga0114129_10334294 | 3300009147 | Bacteria | 2010 |
| 131 | Ga0105243_10091798 | 3300009148 | Bacteria | 2501 |
| 132 | Ga0105243_10816057 | 3300009148 | Bacteria | 921 |
| 133 | Ga0105242_10340246 | 3300009176 | Bacteria | 1382 |
| 134 | Ga0105242_10387425 | 3300009176 | Bacteria | 1301 |
| 135 | Ga0105242_11386923 | 3300009176 | Bacteria | 730 |
| 136 | Ga0105248_10526386 | 3300009177 | Bacteria | 1333 |
| 137 | Ga0105237_10076087 | 3300009545 | Bacteria | 3347 |
| 138 | Ga0105237_10377184 | 3300009545 | Bacteria | 1423 |
| 139 | Ga0105237_10414944 | 3300009545 | Bacteria | 1351 |
| 140 | Ga0105237_10799357 | 3300009545 | Bacteria | 950 |
| 141 | Ga0105238_10232288 | 3300009551 | Bacteria | 1821 |
| 142 | Ga0105249_10176113 | 3300009553 | Bacteria | 2078 |
| 143 | Ga0105249_10736884 | 3300009553 | Bacteria | 1047 |
| 144 | Ga0105239_10007348 | 3300010375 | Bacteria | 12656 |
| 145 | Ga0105239_10043400 | 3300010375 | Bacteria | 4928 |
| 146 | Ga0105246_10094437 | 3300011119 | Bacteria | 2163 |
| 147 | Ga0105246_10275888 | 3300011119 | Bacteria | 1346 |
| 148 | Ga0105246_10814700 | 3300011119 | Bacteria | 830 |
| 149 | Ga0157318_1008524 | 3300012482 | Bacteria | 722 |
| 150 | Ga0157370_10684822 | 3300013104 | Bacteria | 936 |
| 151 | Ga0163162_10018511 | 3300013306 | Bacteria | 6824 |
| 152 | Ga0157372_10007692 | 3300013307 | Bacteria | 11465 |
| 153 | Ga0157372_10570005 | 3300013307 | Bacteria | 1319 |
| 154 | Ga0157372_10706639 | 3300013307 | Bacteria | 1173 |
| 155 | Ga0157372_11014759 | 3300013307 | Bacteria | 961 |
| 156 | Ga0163163_10184891 | 3300014325 | Bacteria | 2132 |
| 157 | Ga0163163_10302785 | 3300014325 | Bacteria | 1651 |
| 158 | Ga0163163_10417360 | 3300014325 | Bacteria | 1401 |
| 159 | Ga0157380_10232072 | 3300014326 | Bacteria | 1658 |
| 160 | Ga0182008_10074703 | 3300014497 | Bacteria | 1668 |
| 161 | Ga0182008_10086116 | 3300014497 | Bacteria | 1547 |
| 162 | Ga0157377_10072866 | 3300014745 | Bacteria | 1989 |
| 163 | Ga0157377_10399493 | 3300014745 | Bacteria | 936 |
| 164 | Ga0182006_1202842 | 3300015261 | Bacteria | 657 |
| 165 | Ga0163161_10093911 | 3300017792 | Bacteria | 2223 |
| 166 | Ga0163161_10304698 | 3300017792 | Bacteria | 1256 |
| 167 | Ga0197907_10065901 | 3300020069 | Bacteria | 1180 |
| 168 | Ga0197907_10248495 | 3300020069 | Bacteria | 2620 |
| 169 | Ga0197907_10744107 | 3300020069 | Bacteria | 1620 |
| 170 | Ga0206349_1753929 | 3300020075 | Bacteria | 956 |
| 171 | Ga0206351_10862294 | 3300020077 | Bacteria | 2089 |
| 172 | Ga0206351_10876275 | 3300020077 | Bacteria | 738 |
| 173 | Ga0206352_10249820 | 3300020078 | Bacteria | 1433 |
| 174 | Ga0206350_10362717 | 3300020080 | Bacteria | 990 |
| 175 | Ga0206350_10529565 | 3300020080 | Bacteria | 2540 |
| 176 | Ga0206350_11029862 | 3300020080 | Bacteria | 1005 |
| 177 | Ga0206350_11314634 | 3300020080 | Bacteria | 1524 |
| 178 | Ga0206354_10987867 | 3300020081 | Bacteria | 3719 |
| 179 | Ga0206354_11720080 | 3300020081 | Bacteria | 873 |
| 180 | Ga0206353_10193799 | 3300020082 | Bacteria | 1353 |
| 181 | Ga0206353_10445806 | 3300020082 | Bacteria | 9670 |
| 182 | Ga0206353_10770605 | 3300020082 | Bacteria | 2041 |
| 183 | Ga0206353_11162229 | 3300020082 | Bacteria | 2132 |
| 184 | Ga0224712_10029028 | 3300022467 | Bacteria | 1983 |
| 185 | Ga0224712_10060181 | 3300022467 | Bacteria | 1510 |
| 186 | Ga0207642_10286585 | 3300025899 | Bacteria | 949 |
| 187 | Ga0207647_10108457 | 3300025904 | Bacteria | 1642 |
| 188 | Ga0207647_10124994 | 3300025904 | Bacteria | 1514 |
| 189 | Ga0207643_10104365 | 3300025908 | Bacteria | 1664 |
| 190 | Ga0207705_10159576 | 3300025909 | Bacteria | 1694 |
| 191 | Ga0207705_10273384 | 3300025909 | Bacteria | 1292 |
| 192 | Ga0207707_10713873 | 3300025912 | Bacteria | 841 |
| 193 | Ga0207671_10166077 | 3300025914 | Bacteria | 1711 |
| 194 | Ga0207671_10599599 | 3300025914 | Bacteria | 878 |
| 195 | Ga0207693_10195969 | 3300025915 | Bacteria | 1589 |
| 196 | Ga0207657_10015319 | 3300025919 | Bacteria | 7432 |
| 197 | Ga0207657_10045545 | 3300025919 | Bacteria | 3849 |
| 198 | Ga0207657_10104445 | 3300025919 | Bacteria | 2347 |
| 199 | Ga0207652_10045754 | 3300025921 | Bacteria | 3731 |
| 200 | Ga0207687_10023055 | 3300025927 | Bacteria | 4146 |
| 201 | Ga0207687_10519515 | 3300025927 | Bacteria | 996 |
| 202 | Ga0207700_10060662 | 3300025928 | Bacteria | 2865 |
| 203 | Ga0207664_10004124 | 3300025929 | Bacteria | 9806 |
| 204 | Ga0207690_10012748 | 3300025932 | Bacteria | 5037 |
| 205 | Ga0207690_10076392 | 3300025932 | Bacteria | 2326 |
| 206 | Ga0207690_10465059 | 3300025932 | Bacteria | 1018 |
| 207 | Ga0207690_10511179 | 3300025932 | Bacteria | 972 |
| 208 | Ga0207709_10766383 | 3300025935 | Bacteria | 777 |
| 209 | Ga0207704_10108866 | 3300025938 | Bacteria | 1867 |
| 210 | Ga0207704_10384721 | 3300025938 | Bacteria | 1102 |
| 211 | Ga0207691_10128940 | 3300025940 | Bacteria | 2236 |
| 212 | Ga0207661_10094156 | 3300025944 | Bacteria | 2501 |
| 213 | Ga0207661_10331391 | 3300025944 | Bacteria | 1370 |
| 214 | Ga0207661_10420201 | 3300025944 | Bacteria | 1214 |
| 215 | Ga0207679_10368361 | 3300025945 | Bacteria | 1257 |
| 216 | Ga0207667_10086092 | 3300025949 | Bacteria | 3253 |
| 217 | Ga0207667_10529841 | 3300025949 | Bacteria | 1193 |
| 218 | Ga0207668_10290896 | 3300025972 | Bacteria | 1344 |
| 219 | Ga0207658_10710672 | 3300025986 | Bacteria | 909 |
| 220 | Ga0207677_10121398 | 3300026023 | Bacteria | 1966 |
| 221 | Ga0207677_10201621 | 3300026023 | Bacteria | 1582 |
| 222 | Ga0207703_10031783 | 3300026035 | Bacteria | 4175 |
| 223 | Ga0207678_10078899 | 3300026067 | Bacteria | 2820 |
| 224 | Ga0207678_10414918 | 3300026067 | Bacteria | 1167 |
| 225 | Ga0207678_10661122 | 3300026067 | Bacteria | 918 |
| 226 | Ga0207708_10095591 | 3300026075 | Bacteria | 2295 |
| 227 | Ga0207702_10062128 | 3300026078 | Bacteria | 3188 |
| 228 | Ga0207702_10137949 | 3300026078 | Bacteria | 2203 |
| 229 | Ga0207702_10163106 | 3300026078 | Bacteria | 2037 |
| 230 | Ga0207702_10334151 | 3300026078 | Bacteria | 1446 |
| 231 | Ga0207648_10577247 | 3300026089 | Bacteria | 1035 |
| 232 | Ga0207676_10015967 | 3300026095 | Bacteria | 5432 |
| 233 | Ga0207674_10008329 | 3300026116 | Bacteria | 11994 |
| 234 | Ga0207674_10026516 | 3300026116 | Bacteria | 6151 |
| 235 | Ga0207674_10263124 | 3300026116 | Bacteria | 1672 |
| 236 | Ga0207674_10385830 | 3300026116 | Bacteria | 1354 |
| 237 | Ga0207675_100487453 | 3300026118 | Bacteria | 1226 |
| 238 | Ga0207675_100621618 | 3300026118 | Bacteria | 1085 |
| 239 | Ga0207698_10208937 | 3300026142 | Bacteria | 1755 |
| 240 | Ga0209813_10041175 | 3300027866 | Bacteria | 1407 |
| 241 | Ga0209813_10048606 | 3300027866 | Bacteria | 1318 |
| 242 | Ga0209813_10130699 | 3300027866 | Bacteria | 883 |
| 243 | Ga0207428_10002497 | 3300027907 | Bacteria | 18376 |
| 244 | Ga0207428_10063797 | 3300027907 | Bacteria | 2910 |
| 245 | Ga0268266_10001282 | 3300028379 | Bacteria | 30666 |
| 246 | Ga0268266_10558861 | 3300028379 | Bacteria | 1097 |
| 247 | Ga0268265_10252949 | 3300028380 | Bacteria | 1562 |
| 248 | Ga0268265_10404403 | 3300028380 | Bacteria | 1263 |
| 249 | Ga0268264_10395811 | 3300028381 | Bacteria | 1326 |
| 250 | Ga0316182_1448023 | 3300030745 | Bacteria | 1627 |
| 251 | Ga0307508_10207708 | 3300031616 | Bacteria | 1559 |
| 252 | Ga0307405_10087831 | 3300031731 | Bacteria | 2050 |
| 253 | Ga0307413_10023910 | 3300031824 | Bacteria | 3320 |
| 254 | Ga0307413_10137167 | 3300031824 | Bacteria | 1684 |
| 255 | Ga0307410_10024462 | 3300031852 | Bacteria | 3773 |
| 256 | Ga0307410_10138671 | 3300031852 | Bacteria | 1796 |
| 257 | Ga0307406_10008723 | 3300031901 | Bacteria | 5666 |
| 258 | Ga0307407_10108680 | 3300031903 | Bacteria | 1737 |
| 259 | Ga0307407_10186959 | 3300031903 | Bacteria | 1377 |
| 260 | Ga0307407_10323950 | 3300031903 | Bacteria | 1082 |
| 261 | Ga0307407_10420183 | 3300031903 | Bacteria | 963 |
| 262 | Ga0307412_10403692 | 3300031911 | Bacteria | 1113 |
| 263 | Ga0307409_100011064 | 3300031995 | Bacteria | 5661 |
| 264 | Ga0307409_100026236 | 3300031995 | Bacteria | 4105 |
| 265 | Ga0307409_100029113 | 3300031995 | Bacteria | 3948 |
| 266 | Ga0307409_100032879 | 3300031995 | Bacteria | 3767 |
| 267 | Ga0307409_100534273 | 3300031995 | Bacteria | 1148 |
| 268 | Ga0307409_101084422 | 3300031995 | Bacteria | 821 |
| 269 | Ga0307409_101327462 | 3300031995 | Bacteria | 745 |
| 270 | Ga0307416_100001535 | 3300032002 | Bacteria | 12624 |
| 271 | Ga0307416_100114735 | 3300032002 | Bacteria | 2384 |
| 272 | Ga0307416_100390019 | 3300032002 | Bacteria | 1426 |
| 273 | Ga0307416_100752172 | 3300032002 | Bacteria | 1067 |
| 274 | Ga0307416_101080769 | 3300032002 | Bacteria | 906 |
| 275 | Ga0307414_10132737 | 3300032004 | Bacteria | 1936 |
| 276 | Ga0307414_10720906 | 3300032004 | Bacteria | 904 |
| 277 | Ga0307414_10919158 | 3300032004 | Bacteria | 803 |
| 278 | Ga0307411_10644809 | 3300032005 | Bacteria | 916 |
| 279 | Ga0307415_100000465 | 3300032126 | Bacteria | 17499 |
| 280 | Ga0307415_100048248 | 3300032126 | Bacteria | 2872 |
| 281 | Ga0307415_100055185 | 3300032126 | Bacteria | 2717 |
| 282 | Ga0307415_100191196 | 3300032126 | Bacteria | 1615 |
| 283 | Ga0307415_100497243 | 3300032126 | Bacteria | 1065 |
| 284 | Ga0307415_101223437 | 3300032126 | Bacteria | 708 |
| 285 | Ga0373951_0095391 | 3300035091 | Bacteria | 785 |
| 286 | Ga0395899_0110088 | 3300037312 | Bacteria | 1981 |
| 287 | Ga0395900_0184133 | 3300037418 | Bacteria | 2121 |
| 288 | Ga0395900_0365605 | 3300037418 | Bacteria | 1413 |
| 289 | Ga0395898_0506280 | 3300037466 | Bacteria | 1148 |
| 290 | Ga0395905_0046796 | 3300037471 | Bacteria | 4056 |
| 291 | Ga0436364_0879964 | 3300037853 | Bacteria | 1406 |
| 292 | Ga0395901_0133003 | 3300038443 | Bacteria | 2614 |
| 293 | Ga0395901_0799229 | 3300038443 | Bacteria | 932 |
| 294 | Ga0436360_0772751 | 3300039438 | Bacteria | 643 |
| 295 | Ga0439465_0016986 | 3300041413 | Bacteria | 2271 |
| 296 | Ga0439465_0031090 | 3300041413 | Bacteria | 1700 |
| 297 | Ga0451833_0134092 | 3300041491 | Bacteria | 2920 |
| 298 | Ga0451833_0146647 | 3300041491 | Bacteria | 5377 |
| 299 | Ga0451833_0592120 | 3300041491 | Bacteria | 928 |
| 300 | Ga0451837_0003726 | 3300041494 | Bacteria | 5607 |
| 301 | Ga0451839_1035743 | 3300041496 | Bacteria | 4422 |
| 302 | Ga0451853_1057058 | 3300041512 | Bacteria | 9964 |
| 303 | Ga0451853_2374902 | 3300041512 | Bacteria | 1779 |
| 304 | Ga0451853_3299735 | 3300041512 | Bacteria | 747 |
| 305 | Ga0439431_0009456 | 3300041997 | Bacteria | 2202 |
| 306 | Ga0439431_0070108 | 3300041997 | Bacteria | 933 |
| 307 | Ga0439445_0004717 | 3300042004 | Bacteria | 3092 |
| 308 | Ga0439445_0024862 | 3300042004 | Bacteria | 1525 |
| 309 | Ga0439432_081351 | 3300042006 | Bacteria | 981 |
| 310 | Ga0439449_0090825 | 3300042007 | Bacteria | 1128 |
| 311 | Ga0439446_0004746 | 3300042156 | Bacteria | 3458 |
| 312 | Ga0439434_0011486 | 3300042435 | Bacteria | 2618 |
| 313 | Ga0439434_0012802 | 3300042435 | Bacteria | 2486 |
| 314 | Ga0439434_0136034 | 3300042435 | Bacteria | 808 |
| 315 | Ga0439464_0030151 | 3300042439 | Bacteria | 1518 |
| 316 | Ga0466969_0077935 | 3300044656 | Bacteria | 1585 |
| 317 | Ga0466972_0002214 | 3300044658 | Bacteria | 9547 |
| 318 | Ga0466972_0046852 | 3300044658 | Bacteria | 2092 |
| 319 | Ga0466972_0145681 | 3300044658 | Bacteria | 1114 |
| 320 | Ga0466972_0231069 | 3300044658 | Bacteria | 865 |
| 321 | Ga0466965_0020176 | 3300044683 | Bacteria | 3202 |
| 322 | Ga0466965_0042954 | 3300044683 | Bacteria | 2231 |
| 323 | Ga0466965_0164162 | 3300044683 | Bacteria | 1166 |
| 324 | Ga0466965_0303765 | 3300044683 | Bacteria | 866 |
| 325 | Ga0466966_0002073 | 3300044684 | Bacteria | 12998 |
| 326 | Ga0466961_0021468 | 3300044693 | Bacteria | 4155 |
| 327 | Ga0466963_0000954 | 3300044694 | Bacteria | 14852 |
| 328 | Ga0466963_0024025 | 3300044694 | Bacteria | 3877 |
| 329 | Ga0466963_0064596 | 3300044694 | Bacteria | 2452 |
| 330 | Ga0466963_0225129 | 3300044694 | Bacteria | 1314 |
| 331 | Ga0466963_0318635 | 3300044694 | Bacteria | 1094 |
| 332 | Ga0466964_0207092 | 3300044706 | Bacteria | 945 |
| 333 | Ga0466971_0005350 | 3300044719 | Bacteria | 5565 |
| 334 | Ga0466971_0043121 | 3300044719 | Bacteria | 2027 |
| 335 | Ga0466971_0076470 | 3300044719 | Bacteria | 1523 |
| 336 | Ga0466968_0028294 | 3300044735 | Bacteria | 2311 |
| 337 | Ga0466968_0257346 | 3300044735 | Bacteria | 830 |
| 338 | Ga0466970_0004978 | 3300044765 | Bacteria | 6565 |
| 339 | Ga0466970_0014684 | 3300044765 | Bacteria | 4023 |
| 340 | Ga0466970_0025594 | 3300044765 | Bacteria | 3090 |
| 341 | Ga0466970_0080583 | 3300044765 | Bacteria | 1759 |
| 342 | Ga0466970_0124192 | 3300044765 | Bacteria | 1415 |
| 343 | Ga0466970_0255213 | 3300044765 | Bacteria | 983 |
| 344 | Ga0466970_0278956 | 3300044765 | Bacteria | 940 |
| 345 | Ga0466970_0379498 | 3300044765 | Bacteria | 804 |
| 346 | Ga0466957_0067880 | 3300044842 | Bacteria | 2200 |
| 347 | Ga0466957_0271270 | 3300044842 | Bacteria | 1133 |
| 348 | Ga0466960_0008169 | 3300044901 | Bacteria | 4278 |
| 349 | Ga0466960_0072768 | 3300044901 | Bacteria | 1714 |
| 350 | Ga0466960_0102482 | 3300044901 | Bacteria | 1476 |
| 351 | Ga0466960_0156558 | 3300044901 | Bacteria | 1220 |
| 352 | Ga0466960_0223382 | 3300044901 | Bacteria | 1037 |
| 353 | Ga0466960_0374746 | 3300044901 | Bacteria | 816 |
| 354 | Ga0466959_0044099 | 3300045049 | Bacteria | 3286 |
| 355 | Ga0466959_0156306 | 3300045049 | Bacteria | 1605 |
| 356 | Ga0466959_0323594 | 3300045049 | Bacteria | 1054 |
| 357 | Ga0466967_0001480 | 3300045976 | Bacteria | 13704 |
| 358 | Ga0466967_0026752 | 3300045976 | Bacteria | 4785 |
| 359 | Ga0466967_0027395 | 3300045976 | Bacteria | 4739 |
| 360 | Ga0466967_0033913 | 3300045976 | Bacteria | 4326 |
| 361 | Ga0466967_0044313 | 3300045976 | Bacteria | 3858 |
| 362 | Ga0466967_0162319 | 3300045976 | Bacteria | 2098 |
| 363 | Ga0466967_0287850 | 3300045976 | Bacteria | 1578 |
| 364 | Ga0466967_0291867 | 3300045976 | Bacteria | 1567 |
| 365 | Ga0466967_0335570 | 3300045976 | Bacteria | 1461 |
| 366 | Ga0466967_0391882 | 3300045976 | Bacteria | 1350 |
| 367 | Ga0466967_0705762 | 3300045976 | Bacteria | 999 |
| 368 | Ga0495627_043083 | 3300046453 | Bacteria | 1381 |
| 369 | Ga0495630_0369157 | 3300046517 | Bacteria | 1099 |
| 370 | Ga0495635_0401429 | 3300046663 | Bacteria | 911 |
| 371 | Ga0495624_0453977 | 3300046690 | Bacteria | 768 |
| 372 | Ga0495649_0355987 | 3300046694 | Bacteria | 739 |
| 373 | Ga0495600_0215736 | 3300046809 | Bacteria | 1229 |
| 374 | Ga0495581_0075245 | 3300047315 | Bacteria | 1954 |
| 375 | Ga0496100_0249389 | 3300048903 | Bacteria | 1313 |
| 376 | Ga0496100_0486540 | 3300048903 | Bacteria | 949 |
| 377 | Ga0496101_0136594 | 3300048904 | Bacteria | 1866 |
| 378 | Ga0496102_0022378 | 3300048905 | Bacteria | 5600 |
| 379 | Ga0496102_0035621 | 3300048905 | Bacteria | 4480 |
| 380 | Ga0496102_0102588 | 3300048905 | Bacteria | 2659 |
| 381 | Ga0496102_0448933 | 3300048905 | Bacteria | 1210 |
| 382 | Ga0496103_0127528 | 3300048906 | Bacteria | 1623 |
| 383 | Ga0496103_0139888 | 3300048906 | Bacteria | 1548 |
| 384 | Ga0496103_0223947 | 3300048906 | Bacteria | 1209 |
| 385 | Ga0496104_0747006 | 3300048907 | Bacteria | 885 |
| 386 | Ga0496105_0121474 | 3300048908 | Bacteria | 2154 |
| 387 | Ga0496106_0019110 | 3300048909 | Bacteria | 5079 |
| 388 | Ga0496106_0023995 | 3300048909 | Bacteria | 4532 |
| 389 | Ga0496107_0041937 | 3300048910 | Bacteria | 3287 |
| 390 | Ga0496108_0004318 | 3300048911 | Bacteria | 11429 |
| 391 | Ga0496108_0142909 | 3300048911 | Bacteria | 2062 |
| 392 | Ga0496108_0222238 | 3300048911 | Bacteria | 1641 |
| 393 | Ga0496108_0610218 | 3300048911 | Bacteria | 950 |
| 394 | Ga0496109_0043342 | 3300048912 | Bacteria | 4078 |
| 395 | Ga0496109_0139415 | 3300048912 | Bacteria | 2267 |
| 396 | Ga0496109_0640982 | 3300048912 | Bacteria | 999 |
| 397 | Ga0496109_0648846 | 3300048912 | Bacteria | 992 |
| 398 | Ga0496110_0002633 | 3300048913 | Bacteria | 13519 |
| 399 | Ga0496110_0046611 | 3300048913 | Bacteria | 3792 |
| 400 | Ga0496110_0124378 | 3300048913 | Bacteria | 2326 |
| 401 | Ga0496110_0204196 | 3300048913 | Bacteria | 1796 |
| 402 | Ga0496111_0001296 | 3300048914 | Bacteria | 14025 |
| 403 | Ga0496111_0195009 | 3300048914 | Bacteria | 1505 |
| 404 | Ga0496112_0110054 | 3300048915 | Bacteria | 2725 |
| 405 | Ga0496112_0516588 | 3300048915 | Bacteria | 1129 |
| 406 | Ga0496114_0061011 | 3300048917 | Bacteria | 3153 |
| 407 | Ga0496114_0093556 | 3300048917 | Bacteria | 2556 |
| 408 | Ga0496114_0095344 | 3300048917 | Bacteria | 2532 |
| 409 | Ga0496114_0116564 | 3300048917 | Bacteria | 2293 |
| 410 | Ga0496114_0213313 | 3300048917 | Bacteria | 1694 |
| 411 | Ga0496114_0301861 | 3300048917 | Bacteria | 1414 |
| 412 | Ga0496114_0414614 | 3300048917 | Bacteria | 1193 |
| 413 | Ga0496114_0457082 | 3300048917 | Bacteria | 1130 |
| 414 | Ga0496123_0037516 | 3300048926 | Bacteria | 3420 |
| 415 | Ga0496124_0068545 | 3300048927 | Bacteria | 2948 |
| 416 | Ga0496126_0540812 | 3300048929 | Bacteria | 926 |
| 417 | Ga0501031_0018376 | 3300049568 | Bacteria | 4551 |
| 418 | Ga0501031_0061422 | 3300049568 | Bacteria | 2449 |
| 419 | Ga0501031_0073255 | 3300049568 | Bacteria | 2230 |
| 420 | Ga0501031_0112484 | 3300049568 | Bacteria | 1778 |
| 421 | Ga0501031_0297567 | 3300049568 | Bacteria | 1046 |
| 422 | Ga0501031_0343369 | 3300049568 | Bacteria | 966 |
| 423 | Ga0501032_0145527 | 3300049569 | Bacteria | 1560 |
| 424 | Ga0501033_0002738 | 3300049570 | Bacteria | 14781 |
| 425 | Ga0501033_0137487 | 3300049570 | Bacteria | 1768 |
| 426 | Ga0501034_0003420 | 3300049571 | Bacteria | 18127 |
| 427 | Ga0501034_0009364 | 3300049571 | Bacteria | 10262 |
| 428 | Ga0501034_0041305 | 3300049571 | Bacteria | 4666 |
| 429 | Ga0501034_0065126 | 3300049571 | Bacteria | 3657 |
| 430 | Ga0501034_0220200 | 3300049571 | Bacteria | 1851 |
| 431 | Ga0501036_0022050 | 3300049572 | Bacteria | 5356 |
| 432 | Ga0501036_0063225 | 3300049572 | Bacteria | 3134 |
| 433 | Ga0501036_0095534 | 3300049572 | Bacteria | 2512 |
| 434 | Ga0501036_0207058 | 3300049572 | Bacteria | 1649 |
| 435 | Ga0501036_0256933 | 3300049572 | Bacteria | 1464 |
| 436 | Ga0501036_0268815 | 3300049572 | Bacteria | 1428 |
| 437 | Ga0501037_0002685 | 3300049573 | Bacteria | 12837 |
| 438 | Ga0501037_0059501 | 3300049573 | Bacteria | 2787 |
| 439 | Ga0501037_0122570 | 3300049573 | Bacteria | 1868 |
| 440 | Ga0501037_0146437 | 3300049573 | Bacteria | 1689 |
| 441 | Ga0501037_0307026 | 3300049573 | Bacteria | 1101 |
| 442 | Ga0501038_0008939 | 3300049574 | Bacteria | 9190 |
| 443 | Ga0501038_0106431 | 3300049574 | Bacteria | 2328 |
| 444 | Ga0501038_0334261 | 3300049574 | Bacteria | 1183 |
| 445 | Ga0501039_0003723 | 3300049575 | Bacteria | 11454 |
| 446 | Ga0501039_0019805 | 3300049575 | Bacteria | 5158 |
| 447 | Ga0501039_0031977 | 3300049575 | Bacteria | 4056 |
| 448 | Ga0501039_0108252 | 3300049575 | Bacteria | 2172 |
| 449 | Ga0501039_0236017 | 3300049575 | Bacteria | 1438 |
| 450 | Ga0501039_0429867 | 3300049575 | Bacteria | 1037 |
| 451 | Ga0501040_0015306 | 3300049576 | Bacteria | 5071 |
| 452 | Ga0501040_0087395 | 3300049576 | Bacteria | 2165 |
| 453 | Ga0501041_0008092 | 3300049577 | Bacteria | 6189 |
| 454 | Ga0501041_0046586 | 3300049577 | Bacteria | 2638 |
| 455 | Ga0501041_0137536 | 3300049577 | Bacteria | 1523 |
| 456 | Ga0501041_0163769 | 3300049577 | Bacteria | 1391 |
| 457 | Ga0501042_0005584 | 3300049578 | Bacteria | 8106 |
| 458 | Ga0501042_0030049 | 3300049578 | Bacteria | 3836 |
| 459 | Ga0501042_0042004 | 3300049578 | Bacteria | 3253 |
| 460 | Ga0501042_0113731 | 3300049578 | Bacteria | 1949 |
| 461 | Ga0501042_0163977 | 3300049578 | Bacteria | 1603 |
| 462 | Ga0501042_0179673 | 3300049578 | Bacteria | 1527 |
| 463 | Ga0501043_0012296 | 3300049579 | Bacteria | 6691 |
| 464 | Ga0501043_0015277 | 3300049579 | Bacteria | 6014 |
| 465 | Ga0501043_0203455 | 3300049579 | Bacteria | 1536 |
| 466 | Ga0501043_0417909 | 3300049579 | Bacteria | 1011 |
| 467 | Ga0501046_0001565 | 3300049580 | Bacteria | 21864 |
| 468 | Ga0501046_0005428 | 3300049580 | Bacteria | 11393 |
| 469 | Ga0501046_0092828 | 3300049580 | Bacteria | 2320 |
| 470 | Ga0501047_0024486 | 3300049581 | Bacteria | 5792 |
| 471 | Ga0501047_0045310 | 3300049581 | Bacteria | 4252 |
| 472 | Ga0501047_0590957 | 3300049581 | Bacteria | 932 |
| 473 | Ga0501047_0624514 | 3300049581 | Bacteria | 898 |
| 474 | Ga0501048_0009344 | 3300049582 | Bacteria | 7362 |
| 475 | Ga0501048_0016709 | 3300049582 | Bacteria | 5409 |
| 476 | Ga0501048_0109316 | 3300049582 | Bacteria | 1952 |
| 477 | Ga0501048_0165290 | 3300049582 | Bacteria | 1567 |
| 478 | Ga0501067_0001120 | 3300049583 | Bacteria | 14498 |
| 479 | Ga0501067_0001382 | 3300049583 | Bacteria | 13158 |
| 480 | Ga0501067_0014065 | 3300049583 | Bacteria | 4434 |
| 481 | Ga0501067_0083831 | 3300049583 | Bacteria | 1768 |
| 482 | Ga0501067_0084124 | 3300049583 | Bacteria | 1765 |
| 483 | Ga0501067_0353025 | 3300049583 | Bacteria | 820 |
| 484 | Ga0501068_0001745 | 3300049584 | Bacteria | 11565 |
| 485 | Ga0501068_0023545 | 3300049584 | Bacteria | 3609 |
| 486 | Ga0501068_0038296 | 3300049584 | Bacteria | 2872 |
| 487 | Ga0501068_0061218 | 3300049584 | Bacteria | 2287 |
| 488 | Ga0501069_0210357 | 3300049585 | Bacteria | 1129 |
| 489 | Ga0501069_0412920 | 3300049585 | Bacteria | 799 |
| 490 | Ga0501070_0001013 | 3300049586 | Bacteria | 25211 |
| 491 | Ga0501070_0015547 | 3300049586 | Bacteria | 6401 |
| 492 | Ga0501070_0021607 | 3300049586 | Bacteria | 5397 |
| 493 | Ga0501070_0062168 | 3300049586 | Bacteria | 3093 |
| 494 | Ga0501070_0064022 | 3300049586 | Bacteria | 3046 |
| 495 | Ga0501070_0144844 | 3300049586 | Bacteria | 1961 |
| 496 | Ga0501070_0274095 | 3300049586 | Bacteria | 1377 |
| 497 | Ga0501070_0322823 | 3300049586 | Bacteria | 1255 |
| 498 | Ga0501070_0706348 | 3300049586 | Bacteria | 797 |
| 499 | Ga0501071_0001200 | 3300049587 | Bacteria | 14638 |
| 500 | Ga0501071_0003370 | 3300049587 | Bacteria | 9979 |
| 501 | Ga0501071_0035796 | 3300049587 | Bacteria | 3537 |
| 502 | Ga0501071_0090031 | 3300049587 | Bacteria | 2253 |
| 503 | Ga0501071_0090630 | 3300049587 | Bacteria | 2245 |
| 504 | Ga0501071_0258757 | 3300049587 | Bacteria | 1314 |
| 505 | Ga0501071_0439582 | 3300049587 | Bacteria | 998 |
| 506 | Ga0501072_0005237 | 3300049588 | Bacteria | 9873 |
| 507 | Ga0501072_0009652 | 3300049588 | Bacteria | 7341 |
| 508 | Ga0501072_0013040 | 3300049588 | Bacteria | 6362 |
| 509 | Ga0501072_0086600 | 3300049588 | Bacteria | 2486 |
| 510 | Ga0501072_0108359 | 3300049588 | Bacteria | 2210 |
| 511 | Ga0501072_0680679 | 3300049588 | Bacteria | 809 |
| 512 | Ga0501073_0001891 | 3300049589 | Bacteria | 15599 |
| 513 | Ga0501073_0012139 | 3300049589 | Bacteria | 6290 |
| 514 | Ga0501073_0028226 | 3300049589 | Bacteria | 4010 |
| 515 | Ga0501074_0000418 | 3300049590 | Bacteria | 25404 |
| 516 | Ga0501074_0001793 | 3300049590 | Bacteria | 14692 |
| 517 | Ga0501074_0030618 | 3300049590 | Bacteria | 3900 |
| 518 | Ga0501074_0036185 | 3300049590 | Bacteria | 3577 |
| 519 | Ga0501074_0067315 | 3300049590 | Bacteria | 2576 |
| 520 | Ga0501075_0031735 | 3300049591 | Bacteria | 3923 |
| 521 | Ga0501075_0151238 | 3300049591 | Bacteria | 1769 |
| 522 | Ga0501075_0176292 | 3300049591 | Bacteria | 1631 |
| 523 | Ga0501076_0009331 | 3300049592 | Bacteria | 7240 |
| 524 | Ga0501076_0036315 | 3300049592 | Bacteria | 3861 |
| 525 | Ga0501076_0453357 | 3300049592 | Bacteria | 1056 |
| 526 | Ga0501077_0120113 | 3300049593 | Bacteria | 1665 |
| 527 | Ga0501077_0144610 | 3300049593 | Bacteria | 1508 |
| 528 | Ga0501079_0002456 | 3300049741 | Bacteria | 13459 |
| 529 | Ga0501079_0006491 | 3300049741 | Bacteria | 8784 |
| 530 | Ga0501079_0016089 | 3300049741 | Bacteria | 5716 |
| 531 | Ga0501079_0413504 | 3300049741 | Bacteria | 1058 |
| 532 | Ga0501080_0019863 | 3300049742 | Bacteria | 6221 |
| 533 | Ga0501080_0049943 | 3300049742 | Bacteria | 3893 |
| 534 | Ga0501081_0043743 | 3300049743 | Bacteria | 3073 |
| 535 | Ga0501081_0083119 | 3300049743 | Bacteria | 2244 |
| 536 | Ga0501081_0253423 | 3300049743 | Bacteria | 1285 |
| 537 | Ga0501083_0001662 | 3300049744 | Bacteria | 15178 |
| 538 | Ga0501083_0101244 | 3300049744 | Bacteria | 1900 |
| 539 | Ga0501083_0366360 | 3300049744 | Bacteria | 937 |
| 540 | Ga0501035_0115490 | 3300049822 | Bacteria | 2349 |
| 541 | Ga0501035_0197548 | 3300049822 | Bacteria | 1727 |
| 542 | Ga0501035_0339215 | 3300049822 | Bacteria | 1260 |
| 543 | Ga0501044_0049433 | 3300049823 | Bacteria | 4341 |
| 544 | Ga0501044_0177412 | 3300049823 | Bacteria | 2099 |
| 545 | Ga0501044_0388769 | 3300049823 | Bacteria | 1309 |
| 546 | Ga0501045_0023480 | 3300049824 | Bacteria | 4422 |
| 547 | Ga0501045_0035738 | 3300049824 | Bacteria | 3608 |
| 548 | Ga0501045_0149430 | 3300049824 | Bacteria | 1738 |
| 549 | Ga0501045_0166986 | 3300049824 | Bacteria | 1639 |
| 550 | Ga0501045_0409960 | 3300049824 | Bacteria | 1008 |
| 551 | nmdc:mga03n38_225245_c1 | 3300050490 | Bacteria | 981 |
| 552 | nmdc:mga03n38_48099_c1 | 3300050490 | Bacteria | 1891 |
| 553 | nmdc:mga03n38_71215_c1 | 3300050490 | Bacteria | 1610 |
| 554 | nmdc:mga00v17_130334_c1 | 3300050491 | Bacteria | 1607 |
| 555 | nmdc:mga00v17_134216_c1 | 3300050491 | Bacteria | 1584 |
| 556 | nmdc:mga00v17_185951_c1 | 3300050491 | Bacteria | 1341 |
| 557 | nmdc:mga00v17_259731_c1 | 3300050491 | Bacteria | 1127 |
| 558 | nmdc:mga00v17_292452_c1 | 3300050491 | Bacteria | 1058 |
| 559 | nmdc:mga00v17_3307_c2 | 3300050491 | Bacteria | 4601 |
| 560 | nmdc:mga0yw44_12417_c1 | 3300050492 | Bacteria | 4439 |
| 561 | nmdc:mga0yw44_13212_c1 | 3300050492 | Bacteria | 4338 |
| 562 | nmdc:mga0yw44_307386_c1 | 3300050492 | Bacteria | 1063 |
| 563 | nmdc:mga0yw44_3266_c1 | 3300050492 | Bacteria | 7157 |
| 564 | nmdc:mga0yw44_335316_c1 | 3300050492 | Bacteria | 1017 |
| 565 | nmdc:mga0yw44_475816_c1 | 3300050492 | Bacteria | 847 |
| 566 | nmdc:mga0yw44_60139_c1 | 3300050492 | Bacteria | 2327 |
| 567 | nmdc:mga0yw44_73941_c1 | 3300050492 | Bacteria | 2122 |
| 568 | nmdc:mga0yw44_87157_c1 | 3300050492 | Bacteria | 1968 |
| 569 | nmdc:mga0yw44_9816_c1 | 3300050492 | Bacteria | 4861 |
| 570 | nmdc:mga06z11_100912_c1 | 3300050494 | Bacteria | 1583 |
| 571 | nmdc:mga06z11_105290_c1 | 3300050494 | Bacteria | 1554 |
| 572 | nmdc:mga06z11_38699_c1 | 3300050494 | Bacteria | 2369 |
| 573 | nmdc:mga04h51_11516_c1 | 3300050495 | Bacteria | 2457 |
| 574 | nmdc:mga04h51_56431_c1 | 3300050495 | Bacteria | 1333 |
| 575 | nmdc:mga04h51_5683_c1 | 3300050495 | Bacteria | 3189 |
| 576 | nmdc:mga07m45_25281_c1 | 3300050496 | Bacteria | 3256 |
| 577 | nmdc:mga07m45_411813_c1 | 3300050496 | Bacteria | 784 |
| 578 | nmdc:mga07m45_477578_c1 | 3300050496 | Bacteria | 722 |
| 579 | nmdc:mga07m45_50818_c1 | 3300050496 | Bacteria | 2337 |
| 580 | nmdc:mga07m45_52629_c1 | 3300050496 | Bacteria | 2299 |
| 581 | nmdc:mga05p37_24408_c1 | 3300050507 | Bacteria | 7347 |
| 582 | nmdc:mga05p37_440_c1 | 3300050507 | Bacteria | 45174 |
| 583 | nmdc:mga09592_242576_c1 | 3300050508 | Bacteria | 1561 |
| 584 | nmdc:mga09592_278_c1 | 3300050508 | Bacteria | 37149 |
| 585 | nmdc:mga09592_861389_c1 | 3300050508 | Bacteria | 764 |
| 586 | nmdc:mga0qj67_228450_c1 | 3300050509 | Bacteria | 1510 |
| 587 | nmdc:mga0qj67_2876_c1 | 3300050509 | Bacteria | 12357 |
| 588 | nmdc:mga06r32_153455_c1 | 3300050510 | Bacteria | 2283 |
| 589 | nmdc:mga06r32_4205_c1 | 3300050510 | Bacteria | 12899 |
| 590 | nmdc:mga06r32_434_c1 | 3300050510 | Bacteria | 35341 |
| 591 | nmdc:mga08y16_35992_c1 | 3300050511 | Bacteria | 5199 |
| 592 | nmdc:mga08y16_780046_c1 | 3300050511 | Bacteria | 950 |
| 593 | nmdc:mga08y16_9696_c1 | 3300050511 | Bacteria | 10110 |
| 594 | nmdc:mga0n895_691812_c1 | 3300050512 | Bacteria | 1016 |
| 595 | nmdc:mga0sz30_8758_c1 | 3300050516 | Bacteria | 3829 |
| 596 | Ga0495601_0048827 | 3300053077 | Bacteria | 2666 |
| 597 | Ga0495612_0084608 | 3300053078 | Bacteria | 1336 |
| 598 | Ga0495655_0063804 | 3300053083 | Bacteria | 1012 |
| 599 | Ga0495619_0384202 | 3300053085 | Bacteria | 970 |
| 600 | Ga0500644_0000011 | 3300053088 | Bacteria | 125595 |
| 601 | Ga0500641_0003416 | 3300053096 | Bacteria | 5612 |
| 602 | Ga0500556_0003615 | 3300053104 | Bacteria | 4503 |
| 603 | Ga0500593_000249 | 3300053117 | Bacteria | 22097 |
| 604 | Ga0500573_0019858 | 3300053140 | Bacteria | 3846 |
| 605 | Ga0501084_0013682 | 3300054114 | Bacteria | 6717 |
| 606 | Ga0501084_0029488 | 3300054114 | Bacteria | 4589 |
| 607 | Ga0501084_0076260 | 3300054114 | Bacteria | 2810 |
| 608 | Ga0501084_0364341 | 3300054114 | Bacteria | 1221 |
| 609 | Ga0501084_0629458 | 3300054114 | Bacteria | 906 |
| 610 | Ga0587077_092344 | 3300059493 | Bacteria | 714 |
| 611 | Ga0587082_070715 | 3300059504 | Bacteria | 708 |
| 612 | Ga0587091_096821 | 3300059511 | Bacteria | 686 |
| 613 | Ga0501082_0021928 | 3300060353 | Bacteria | 5506 |
| 614 | Ga0501082_0041150 | 3300060353 | Bacteria | 3984 |
| 615 | Ga0501082_0331863 | 3300060353 | Bacteria | 1325 |
| 616 | Ga0501082_0412656 | 3300060353 | Bacteria | 1179 |
| 617 | Ga0501082_0775645 | 3300060353 | Bacteria | 839 |
| 618 | Ga0501082_0919170 | 3300060353 | Bacteria | 765 |
| 619 | Ga0466962_0011797 | 3300061719 | Bacteria | 4208 |
| 620 | Ga0466962_0119682 | 3300061719 | Bacteria | 1270 |
| 621 | Ga0530510_0086659 | 3300061734 | Bacteria | 2282 |
| 622 | Ga0530510_0100948 | 3300061734 | Bacteria | 2110 |
| 623 | Ga0530510_0237165 | 3300061734 | Bacteria | 1357 |
| 624 | 2643893472 | 2643221576 | Bacteria | 5214352 |
| 625 | 2643962522 | 2643221590 | Bacteria | 5214697 |
| 626 | 2644035478 | 2643221604 | Bacteria | 5014917 |
| 627 | 2644089194 | 2643221615 | Bacteria | 5487866 |
| 628 | 2644101711 | 2643221617 | Bacteria | 5139111 |
| 629 | 2644115773 | 2643221620 | Bacteria | 5134593 |
| 630 | 2644230463 | 2643221641 | Bacteria | 4490190 |
| 631 | 2644319039 | 2643221657 | Bacteria | 5490246 |
| 632 | 2644456979 | 2643221681 | Bacteria | 3707866 |
| 633 | 2644609741 | 2643221711 | Bacteria | 4865335 |
| 634 | 2645719717 | 2643221961 | Bacteria | 3919167 |
| 635 | 2645726605 | 2643221962 | Bacteria | 3874254 |
| 636 | 2738868453 | 2738541305 | Bacteria | 4910150 |
| 637 | 2740168870 | 2739367898 | Bacteria | 4367674 |
| 638 | 2774392740 | 2773857762 | Bacteria | 5971770 |
| 639 | 2809196540 | 2808606439 | Bacteria | 5952208 |
| 640 | 2812332918 | 2811994874 | Bacteria | 5367947 |
| 641 | 2812351308 | 2811994878 | Bacteria | 5992952 |
| 642 | 2816425555 | 2816332119 | Bacteria | 8120218 |
| 643 | 2855387314 | 2855386786 | Bacteria | 4752232 |
| 644 | 2857482167 | 2857481737 | Bacteria | 4761446 |
| 645 | 2873319998 | 2873314349 | Bacteria | 8512634 |
| 646 | 2891971079 | 2891968417 | Bacteria | 5821697 |
| 647 | 2984580186 | 2984576629 | Bacteria | 4248407 |
| 648 | 2984594845 | 2984592036 | Bacteria | 3670284 |
| 649 | 2990259036 | 2990256926 | Bacteria | 4252839 |
| 650 | 8054611323 | 8054609563 | Bacteria | 5170090 |
| 651 | 8055066080 | 8055066027 | Bacteria | 9479577 |
| 652 | Ga0501083_0020870 | |||
| 653 | LJQas_1003731 | |||
| 654 | JGI24740J21852_10024066 | |||
| 655 | JGI24739J22299_10008156 | |||
| 656 | JGI24737J22298_10008836 | |||
| 657 | JGI24735J21928_10027133 | |||
| 658 | JGI24735J21928_10043611 | |||
| 659 | JGI25407J50210_10022274 | |||
| 660 | Ga0006562J51391_1050600 | |||
| 661 | Ga0006562J51391_1050602 | |||
| 662 | Ga0058862_12652283 | |||
| 663 | Ga0070683_100003740 | |||
| 664 | Ga0070683_100074850 | |||
| 665 | Ga0070683_100119383 | |||
| 666 | Ga0070683_100231775 | |||
| 667 | Ga0070683_100435434 | |||
| 668 | Ga0070682_100025384 | |||
| 669 | Ga0070682_100072157 | |||
| 670 | Ga0070682_100253115 | |||
| 671 | Ga0068868_100316386 | |||
| 672 | Ga0070660_100011867 | |||
| 673 | Ga0070660_100162212 | |||
| 674 | Ga0070689_100301495 | |||
| 675 | Ga0070692_10184768 | |||
| 676 | Ga0070692_10352561 | |||
| 677 | Ga0070668_100201306 | |||
| 678 | Ga0070674_100628427 | |||
| 679 | Ga0070659_100008263 | |||
| 680 | Ga0070659_100166845 | |||
| 681 | Ga0070667_100307718 | |||
| 682 | Ga0070667_100922706 | |||
| 683 | Ga0070714_100005337 | |||
| 684 | Ga0070713_100070762 | |||
| 685 | Ga0070701_10512628 | |||
| 686 | Ga0070700_100247387 | |||
| 687 | Ga0070663_100172459 | |||
| 688 | Ga0070678_100695316 | |||
| 689 | Ga0070662_100049420 | |||
| 690 | Ga0070681_10122084 | |||
| 691 | Ga0068867_100622443 | |||
| 692 | Ga0070698_100006744 | |||
| 693 | Ga0070679_100014118 | |||
| 694 | Ga0070684_100003215 | |||
| 695 | Ga0070684_100093938 | |||
| 696 | Ga0070684_100103686 | |||
| 697 | Ga0070684_100108037 | |||
| 698 | Ga0070684_100521094 | |||
| 699 | Ga0070672_100261385 | |||
| 700 | Ga0070665_100000718 | |||
| 701 | Ga0070665_101220385 | |||
| 702 | Ga0068855_100166448 | |||
| 703 | Ga0068855_100512877 | |||
| 704 | Ga0070664_100842084 | |||
| 705 | Ga0068857_100033027 | |||
| 706 | Ga0068857_100055612 | |||
| 707 | Ga0068857_100293425 | |||
| 708 | Ga0068856_100023421 | |||
| 709 | Ga0068856_100322966 | |||
| 710 | Ga0068856_100558796 | |||
| 711 | Ga0068856_100633197 | |||
| 712 | Ga0070702_100020628 | |||
| 713 | Ga0068852_100375884 | |||
| 714 | Ga0068852_100742075 | |||
| 715 | Ga0068852_100754076 | |||
| 716 | Ga0068864_100043411 | |||
| 717 | Ga0068866_10471802 | |||
| 718 | Ga0068861_100280875 | |||
| 719 | Ga0068861_100377605 | |||
| 720 | Ga0068858_100059911 | |||
| 721 | Ga0068860_100000795 | |||
| 722 | Ga0081455_10002473 | |||
| 723 | Ga0081455_10008841 | |||
| 724 | Ga0081455_10030284 | |||
| 725 | Ga0081455_10094549 | |||
| 726 | Ga0081538_10000036 | |||
| 727 | Ga0081538_10020962 | |||
| 728 | Ga0075365_10031881 | |||
| 729 | Ga0075365_10032136 | |||
| 730 | Ga0075365_10064813 | |||
| 731 | Ga0075365_10065898 | |||
| 732 | Ga0075365_10084937 | |||
| 733 | Ga0075365_10156267 | |||
| 734 | Ga0075365_10212788 | |||
| 735 | Ga0075365_10217728 | |||
| 736 | Ga0075365_10256019 | |||
| 737 | Ga0075365_10266244 | |||
| 738 | Ga0075365_10413257 | |||
| 739 | Ga0075365_10510682 | |||
| 740 | Ga0075368_10000651 | |||
| 741 | Ga0075368_10000759 | |||
| 742 | Ga0075368_10110381 | |||
| 743 | Ga0075363_100008166 | |||
| 744 | Ga0075363_100073334 | |||
| 745 | Ga0075363_100166080 | |||
| 746 | Ga0075363_100393527 | |||
| 747 | Ga0075364_10015661 | |||
| 748 | Ga0075364_10048931 | |||
| 749 | Ga0075364_10167762 | |||
| 750 | Ga0075364_10252190 | |||
| 751 | Ga0075364_10484613 | |||
| 752 | Ga0070712_100163138 | |||
| 753 | Ga0075362_10100951 | |||
| 754 | Ga0075367_10016017 | |||
| 755 | Ga0075367_10076401 | |||
| 756 | Ga0075367_10093513 | |||
| 757 | Ga0075367_10126344 | |||
| 758 | Ga0075367_10152289 | |||
| 759 | Ga0075369_10116084 | |||
| 760 | Ga0097621_100152868 | |||
| 761 | Ga0097621_100386406 | |||
| 762 | Ga0075370_10008207 | |||
| 763 | Ga0075370_10024266 | |||
| 764 | Ga0075370_10482815 | |||
| 765 | Ga0075428_100001304 | |||
| 766 | Ga0075428_100018522 | |||
| 767 | Ga0075430_100006263 | |||
| 768 | Ga0075431_100005941 | |||
| 769 | Ga0075431_100008250 | |||
| 770 | Ga0075431_100012367 | |||
| 771 | Ga0075434_100890735 | |||
| 772 | Ga0075429_100001324 | |||
| 773 | Ga0075429_100005562 | |||
| 774 | Ga0068865_100053158 | |||
| 775 | Ga0068865_100194027 | |||
| 776 | Ga0068865_100458910 | |||
| 777 | Ga0105245_10030002 | |||
| 778 | Ga0105245_10467629 | |||
| 779 | Ga0105245_10897724 | |||
| 780 | Ga0114129_10005577 | |||
| 781 | Ga0114129_10334294 | |||
| 782 | Ga0105243_10091798 | |||
| 783 | Ga0105243_10816057 | |||
| 784 | Ga0105242_10340246 | |||
| 785 | Ga0105242_10387425 | |||
| 786 | Ga0105242_11386923 | |||
| 787 | Ga0105248_10526386 | |||
| 788 | Ga0105237_10076087 | |||
| 789 | Ga0105237_10377184 | |||
| 790 | Ga0105237_10414944 | |||
| 791 | Ga0105237_10799357 | |||
| 792 | Ga0105238_10232288 | |||
| 793 | Ga0105249_10176113 | |||
| 794 | Ga0105249_10736884 | |||
| 795 | Ga0105239_10007348 | |||
| 796 | Ga0105239_10043400 | |||
| 797 | Ga0105246_10094437 | |||
| 798 | Ga0105246_10275888 | |||
| 799 | Ga0105246_10814700 | |||
| 800 | Ga0157318_1008524 | |||
| 801 | Ga0157370_10684822 | |||
| 802 | Ga0163162_10018511 | |||
| 803 | Ga0157372_10007692 | |||
| 804 | Ga0157372_10570005 | |||
| 805 | Ga0157372_10706639 | |||
| 806 | Ga0157372_11014759 | |||
| 807 | Ga0163163_10184891 | |||
| 808 | Ga0163163_10302785 | |||
| 809 | Ga0163163_10417360 | |||
| 810 | Ga0157380_10232072 | |||
| 811 | Ga0182008_10074703 | |||
| 812 | Ga0182008_10086116 | |||
| 813 | Ga0157377_10072866 | |||
| 814 | Ga0157377_10399493 | |||
| 815 | Ga0182006_1202842 | |||
| 816 | Ga0163161_10093911 | |||
| 817 | Ga0163161_10304698 | |||
| 818 | Ga0197907_10065901 | |||
| 819 | Ga0197907_10248495 | |||
| 820 | Ga0197907_10744107 | |||
| 821 | Ga0206349_1753929 | |||
| 822 | Ga0206351_10862294 | |||
| 823 | Ga0206351_10876275 | |||
| 824 | Ga0206352_10249820 | |||
| 825 | Ga0206350_10362717 | |||
| 826 | Ga0206350_10529565 | |||
| 827 | Ga0206350_11029862 | |||
| 828 | Ga0206350_11314634 | |||
| 829 | Ga0206354_10987867 | |||
| 830 | Ga0206354_11720080 | |||
| 831 | Ga0206353_10193799 | |||
| 832 | Ga0206353_10445806 | |||
| 833 | Ga0206353_10770605 | |||
| 834 | Ga0206353_11162229 | |||
| 835 | Ga0224712_10029028 | |||
| 836 | Ga0224712_10060181 | |||
| 837 | Ga0207642_10286585 | |||
| 838 | Ga0207647_10108457 | |||
| 839 | Ga0207647_10124994 | |||
| 840 | Ga0207643_10104365 | |||
| 841 | Ga0207705_10159576 | |||
| 842 | Ga0207705_10273384 | |||
| 843 | Ga0207707_10713873 | |||
| 844 | Ga0207671_10166077 | |||
| 845 | Ga0207671_10599599 | |||
| 846 | Ga0207693_10195969 | |||
| 847 | Ga0207657_10015319 | |||
| 848 | Ga0207657_10045545 | |||
| 849 | Ga0207657_10104445 | |||
| 850 | Ga0207652_10045754 | |||
| 851 | Ga0207687_10023055 | |||
| 852 | Ga0207687_10519515 | |||
| 853 | Ga0207700_10060662 | |||
| 854 | Ga0207664_10004124 | |||
| 855 | Ga0207690_10012748 | |||
| 856 | Ga0207690_10076392 | |||
| 857 | Ga0207690_10465059 | |||
| 858 | Ga0207690_10511179 | |||
| 859 | Ga0207709_10766383 | |||
| 860 | Ga0207704_10108866 | |||
| 861 | Ga0207704_10384721 | |||
| 862 | Ga0207691_10128940 | |||
| 863 | Ga0207661_10094156 | |||
| 864 | Ga0207661_10331391 | |||
| 865 | Ga0207661_10420201 | |||
| 866 | Ga0207679_10368361 | |||
| 867 | Ga0207667_10086092 | |||
| 868 | Ga0207667_10529841 | |||
| 869 | Ga0207668_10290896 | |||
| 870 | Ga0207658_10710672 | |||
| 871 | Ga0207677_10121398 | |||
| 872 | Ga0207677_10201621 | |||
| 873 | Ga0207703_10031783 | |||
| 874 | Ga0207678_10078899 | |||
| 875 | Ga0207678_10414918 | |||
| 876 | Ga0207678_10661122 | |||
| 877 | Ga0207708_10095591 | |||
| 878 | Ga0207702_10062128 | |||
| 879 | Ga0207702_10137949 | |||
| 880 | Ga0207702_10163106 | |||
| 881 | Ga0207702_10334151 | |||
| 882 | Ga0207648_10577247 | |||
| 883 | Ga0207676_10015967 | |||
| 884 | Ga0207674_10008329 | |||
| 885 | Ga0207674_10026516 | |||
| 886 | Ga0207674_10263124 | |||
| 887 | Ga0207674_10385830 | |||
| 888 | Ga0207675_100487453 | |||
| 889 | Ga0207675_100621618 | |||
| 890 | Ga0207698_10208937 | |||
| 891 | Ga0209813_10041175 | |||
| 892 | Ga0209813_10048606 | |||
| 893 | Ga0209813_10130699 | |||
| 894 | Ga0207428_10002497 | |||
| 895 | Ga0207428_10063797 | |||
| 896 | Ga0268266_10001282 | |||
| 897 | Ga0268266_10558861 | |||
| 898 | Ga0268265_10252949 | |||
| 899 | Ga0268265_10404403 | |||
| 900 | Ga0268264_10395811 | |||
| 901 | Ga0316182_1448023 | |||
| 902 | Ga0307508_10207708 | |||
| 903 | Ga0307405_10087831 | |||
| 904 | Ga0307413_10023910 | |||
| 905 | Ga0307413_10137167 | |||
| 906 | Ga0307410_10024462 | |||
| 907 | Ga0307410_10138671 | |||
| 908 | Ga0307406_10008723 | |||
| 909 | Ga0307407_10108680 | |||
| 910 | Ga0307407_10186959 | |||
| 911 | Ga0307407_10323950 | |||
| 912 | Ga0307407_10420183 | |||
| 913 | Ga0307412_10403692 | |||
| 914 | Ga0307409_100011064 | |||
| 915 | Ga0307409_100026236 | |||
| 916 | Ga0307409_100029113 | |||
| 917 | Ga0307409_100032879 | |||
| 918 | Ga0307409_100534273 | |||
| 919 | Ga0307409_101084422 | |||
| 920 | Ga0307409_101327462 | |||
| 921 | Ga0307416_100001535 | |||
| 922 | Ga0307416_100114735 | |||
| 923 | Ga0307416_100390019 | |||
| 924 | Ga0307416_100752172 | |||
| 925 | Ga0307416_101080769 | |||
| 926 | Ga0307414_10132737 | |||
| 927 | Ga0307414_10720906 | |||
| 928 | Ga0307414_10919158 | |||
| 929 | Ga0307411_10644809 | |||
| 930 | Ga0307415_100000465 | |||
| 931 | Ga0307415_100048248 | |||
| 932 | Ga0307415_100055185 | |||
| 933 | Ga0307415_100191196 | |||
| 934 | Ga0307415_100497243 | |||
| 935 | Ga0307415_101223437 | |||
| 936 | Ga0373951_0095391 | |||
| 937 | Ga0395899_0110088 | |||
| 938 | Ga0395900_0184133 | |||
| 939 | Ga0395900_0365605 | |||
| 940 | Ga0395898_0506280 | |||
| 941 | Ga0395905_0046796 | |||
| 942 | Ga0436364_0879964 | |||
| 943 | Ga0395901_0133003 | |||
| 944 | Ga0395901_0799229 | |||
| 945 | Ga0436360_0772751 | |||
| 946 | Ga0439465_0016986 | |||
| 947 | Ga0439465_0031090 | |||
| 948 | Ga0451833_0134092 | |||
| 949 | Ga0451833_0146647 | |||
| 950 | Ga0451833_0592120 | |||
| 951 | Ga0451837_0003726 | |||
| 952 | Ga0451839_1035743 | |||
| 953 | Ga0451853_1057058 | |||
| 954 | Ga0451853_2374902 | |||
| 955 | Ga0451853_3299735 | |||
| 956 | Ga0439431_0009456 | |||
| 957 | Ga0439431_0070108 | |||
| 958 | Ga0439445_0004717 | |||
| 959 | Ga0439445_0024862 | |||
| 960 | Ga0439432_081351 | |||
| 961 | Ga0439449_0090825 | |||
| 962 | Ga0439446_0004746 | |||
| 963 | Ga0439434_0011486 | |||
| 964 | Ga0439434_0012802 | |||
| 965 | Ga0439434_0136034 | |||
| 966 | Ga0439464_0030151 | |||
| 967 | Ga0466969_0077935 | |||
| 968 | Ga0466972_0002214 | |||
| 969 | Ga0466972_0046852 | |||
| 970 | Ga0466972_0145681 | |||
| 971 | Ga0466972_0231069 | |||
| 972 | Ga0466965_0020176 | |||
| 973 | Ga0466965_0042954 | |||
| 974 | Ga0466965_0164162 | |||
| 975 | Ga0466965_0303765 | |||
| 976 | Ga0466966_0002073 | |||
| 977 | Ga0466961_0021468 | |||
| 978 | Ga0466963_0000954 | |||
| 979 | Ga0466963_0024025 | |||
| 980 | Ga0466963_0064596 | |||
| 981 | Ga0466963_0225129 | |||
| 982 | Ga0466963_0318635 | |||
| 983 | Ga0466964_0207092 | |||
| 984 | Ga0466971_0005350 | |||
| 985 | Ga0466971_0043121 | |||
| 986 | Ga0466971_0076470 | |||
| 987 | Ga0466968_0028294 | |||
| 988 | Ga0466968_0257346 | |||
| 989 | Ga0466970_0004978 | |||
| 990 | Ga0466970_0014684 | |||
| 991 | Ga0466970_0025594 | |||
| 992 | Ga0466970_0080583 | |||
| 993 | Ga0466970_0124192 | |||
| 994 | Ga0466970_0255213 | |||
| 995 | Ga0466970_0278956 | |||
| 996 | Ga0466970_0379498 | |||
| 997 | Ga0466957_0067880 | |||
| 998 | Ga0466957_0271270 | |||
| 999 | Ga0466960_0008169 | |||
| 1000 | Ga0466960_0072768 | |||
| 1001 | Ga0466960_0102482 | |||
| 1002 | Ga0466960_0156558 | |||
| 1003 | Ga0466960_0223382 | |||
| 1004 | Ga0466960_0374746 | |||
| 1005 | Ga0466959_0044099 | |||
| 1006 | Ga0466959_0156306 | |||
| 1007 | Ga0466959_0323594 | |||
| 1008 | Ga0466967_0001480 | |||
| 1009 | Ga0466967_0026752 | |||
| 1010 | Ga0466967_0027395 | |||
| 1011 | Ga0466967_0033913 | |||
| 1012 | Ga0466967_0044313 | |||
| 1013 | Ga0466967_0162319 | |||
| 1014 | Ga0466967_0287850 | |||
| 1015 | Ga0466967_0291867 | |||
| 1016 | Ga0466967_0335570 | |||
| 1017 | Ga0466967_0391882 | |||
| 1018 | Ga0466967_0705762 | |||
| 1019 | Ga0495627_043083 | |||
| 1020 | Ga0495630_0369157 | |||
| 1021 | Ga0495635_0401429 | |||
| 1022 | Ga0495624_0453977 | |||
| 1023 | Ga0495649_0355987 | |||
| 1024 | Ga0495600_0215736 | |||
| 1025 | Ga0495581_0075245 | |||
| 1026 | Ga0496100_0249389 | |||
| 1027 | Ga0496100_0486540 | |||
| 1028 | Ga0496101_0136594 | |||
| 1029 | Ga0496102_0022378 | |||
| 1030 | Ga0496102_0035621 | |||
| 1031 | Ga0496102_0102588 | |||
| 1032 | Ga0496102_0448933 | |||
| 1033 | Ga0496103_0127528 | |||
| 1034 | Ga0496103_0139888 | |||
| 1035 | Ga0496103_0223947 | |||
| 1036 | Ga0496104_0747006 | |||
| 1037 | Ga0496105_0121474 | |||
| 1038 | Ga0496106_0019110 | |||
| 1039 | Ga0496106_0023995 | |||
| 1040 | Ga0496107_0041937 | |||
| 1041 | Ga0496108_0004318 | |||
| 1042 | Ga0496108_0142909 | |||
| 1043 | Ga0496108_0222238 | |||
| 1044 | Ga0496108_0610218 | |||
| 1045 | Ga0496109_0043342 | |||
| 1046 | Ga0496109_0139415 | |||
| 1047 | Ga0496109_0640982 | |||
| 1048 | Ga0496109_0648846 | |||
| 1049 | Ga0496110_0002633 | |||
| 1050 | Ga0496110_0046611 | |||
| 1051 | Ga0496110_0124378 | |||
| 1052 | Ga0496110_0204196 | |||
| 1053 | Ga0496111_0001296 | |||
| 1054 | Ga0496111_0195009 | |||
| 1055 | Ga0496112_0110054 | |||
| 1056 | Ga0496112_0516588 | |||
| 1057 | Ga0496114_0061011 | |||
| 1058 | Ga0496114_0093556 | |||
| 1059 | Ga0496114_0095344 | |||
| 1060 | Ga0496114_0116564 | |||
| 1061 | Ga0496114_0213313 | |||
| 1062 | Ga0496114_0301861 | |||
| 1063 | Ga0496114_0414614 | |||
| 1064 | Ga0496114_0457082 | |||
| 1065 | Ga0496123_0037516 | |||
| 1066 | Ga0496124_0068545 | |||
| 1067 | Ga0496126_0540812 | |||
| 1068 | Ga0501031_0018376 | |||
| 1069 | Ga0501031_0061422 | |||
| 1070 | Ga0501031_0073255 | |||
| 1071 | Ga0501031_0112484 | |||
| 1072 | Ga0501031_0297567 | |||
| 1073 | Ga0501031_0343369 | |||
| 1074 | Ga0501032_0145527 | |||
| 1075 | Ga0501033_0002738 | |||
| 1076 | Ga0501033_0137487 | |||
| 1077 | Ga0501034_0003420 | |||
| 1078 | Ga0501034_0009364 | |||
| 1079 | Ga0501034_0041305 | |||
| 1080 | Ga0501034_0065126 | |||
| 1081 | Ga0501034_0220200 | |||
| 1082 | Ga0501036_0022050 | |||
| 1083 | Ga0501036_0063225 | |||
| 1084 | Ga0501036_0095534 | |||
| 1085 | Ga0501036_0207058 | |||
| 1086 | Ga0501036_0256933 | |||
| 1087 | Ga0501036_0268815 | |||
| 1088 | Ga0501037_0002685 | |||
| 1089 | Ga0501037_0059501 | |||
| 1090 | Ga0501037_0122570 | |||
| 1091 | Ga0501037_0146437 | |||
| 1092 | Ga0501037_0307026 | |||
| 1093 | Ga0501038_0008939 | |||
| 1094 | Ga0501038_0106431 | |||
| 1095 | Ga0501038_0334261 | |||
| 1096 | Ga0501039_0003723 | |||
| 1097 | Ga0501039_0019805 | |||
| 1098 | Ga0501039_0031977 | |||
| 1099 | Ga0501039_0108252 | |||
| 1100 | Ga0501039_0236017 | |||
| 1101 | Ga0501039_0429867 | |||
| 1102 | Ga0501040_0015306 | |||
| 1103 | Ga0501040_0087395 | |||
| 1104 | Ga0501041_0008092 | |||
| 1105 | Ga0501041_0046586 | |||
| 1106 | Ga0501041_0137536 | |||
| 1107 | Ga0501041_0163769 | |||
| 1108 | Ga0501042_0005584 | |||
| 1109 | Ga0501042_0030049 | |||
| 1110 | Ga0501042_0042004 | |||
| 1111 | Ga0501042_0113731 | |||
| 1112 | Ga0501042_0163977 | |||
| 1113 | Ga0501042_0179673 | |||
| 1114 | Ga0501043_0012296 | |||
| 1115 | Ga0501043_0015277 | |||
| 1116 | Ga0501043_0203455 | |||
| 1117 | Ga0501043_0417909 | |||
| 1118 | Ga0501046_0001565 | |||
| 1119 | Ga0501046_0005428 | |||
| 1120 | Ga0501046_0092828 | |||
| 1121 | Ga0501047_0024486 | |||
| 1122 | Ga0501047_0045310 | |||
| 1123 | Ga0501047_0590957 | |||
| 1124 | Ga0501047_0624514 | |||
| 1125 | Ga0501048_0009344 | |||
| 1126 | Ga0501048_0016709 | |||
| 1127 | Ga0501048_0109316 | |||
| 1128 | Ga0501048_0165290 | |||
| 1129 | Ga0501067_0001120 | |||
| 1130 | Ga0501067_0001382 | |||
| 1131 | Ga0501067_0014065 | |||
| 1132 | Ga0501067_0083831 | |||
| 1133 | Ga0501067_0084124 | |||
| 1134 | Ga0501067_0353025 | |||
| 1135 | Ga0501068_0001745 | |||
| 1136 | Ga0501068_0023545 | |||
| 1137 | Ga0501068_0038296 | |||
| 1138 | Ga0501068_0061218 | |||
| 1139 | Ga0501069_0210357 | |||
| 1140 | Ga0501069_0412920 | |||
| 1141 | Ga0501070_0001013 | |||
| 1142 | Ga0501070_0015547 | |||
| 1143 | Ga0501070_0021607 | |||
| 1144 | Ga0501070_0062168 | |||
| 1145 | Ga0501070_0064022 | |||
| 1146 | Ga0501070_0144844 | |||
| 1147 | Ga0501070_0274095 | |||
| 1148 | Ga0501070_0322823 | |||
| 1149 | Ga0501070_0706348 | |||
| 1150 | Ga0501071_0001200 | |||
| 1151 | Ga0501071_0003370 | |||
| 1152 | Ga0501071_0035796 | |||
| 1153 | Ga0501071_0090031 | |||
| 1154 | Ga0501071_0090630 | |||
| 1155 | Ga0501071_0258757 | |||
| 1156 | Ga0501071_0439582 | |||
| 1157 | Ga0501072_0005237 | |||
| 1158 | Ga0501072_0009652 | |||
| 1159 | Ga0501072_0013040 | |||
| 1160 | Ga0501072_0086600 | |||
| 1161 | Ga0501072_0108359 | |||
| 1162 | Ga0501072_0680679 | |||
| 1163 | Ga0501073_0001891 | |||
| 1164 | Ga0501073_0012139 | |||
| 1165 | Ga0501073_0028226 | |||
| 1166 | Ga0501074_0000418 | |||
| 1167 | Ga0501074_0001793 | |||
| 1168 | Ga0501074_0030618 | |||
| 1169 | Ga0501074_0036185 | |||
| 1170 | Ga0501074_0067315 | |||
| 1171 | Ga0501075_0031735 | |||
| 1172 | Ga0501075_0151238 | |||
| 1173 | Ga0501075_0176292 | |||
| 1174 | Ga0501076_0009331 | |||
| 1175 | Ga0501076_0036315 | |||
| 1176 | Ga0501076_0453357 | |||
| 1177 | Ga0501077_0120113 | |||
| 1178 | Ga0501077_0144610 | |||
| 1179 | Ga0501079_0002456 | |||
| 1180 | Ga0501079_0006491 | |||
| 1181 | Ga0501079_0016089 | |||
| 1182 | Ga0501079_0413504 | |||
| 1183 | Ga0501080_0019863 | |||
| 1184 | Ga0501080_0049943 | |||
| 1185 | Ga0501081_0043743 | |||
| 1186 | Ga0501081_0083119 | |||
| 1187 | Ga0501081_0253423 | |||
| 1188 | Ga0501083_0001662 | |||
| 1189 | Ga0501083_0101244 | |||
| 1190 | Ga0501083_0366360 | |||
| 1191 | Ga0501035_0115490 | |||
| 1192 | Ga0501035_0197548 | |||
| 1193 | Ga0501035_0339215 | |||
| 1194 | Ga0501044_0049433 | |||
| 1195 | Ga0501044_0177412 | |||
| 1196 | Ga0501044_0388769 | |||
| 1197 | Ga0501045_0023480 | |||
| 1198 | Ga0501045_0035738 | |||
| 1199 | Ga0501045_0149430 | |||
| 1200 | Ga0501045_0166986 | |||
| 1201 | Ga0501045_0409960 | |||
| 1202 | nmdc:mga03n38_225245_c1 | |||
| 1203 | nmdc:mga03n38_48099_c1 | |||
| 1204 | nmdc:mga03n38_71215_c1 | |||
| 1205 | nmdc:mga00v17_130334_c1 | |||
| 1206 | nmdc:mga00v17_134216_c1 | |||
| 1207 | nmdc:mga00v17_185951_c1 | |||
| 1208 | nmdc:mga00v17_259731_c1 | |||
| 1209 | nmdc:mga00v17_292452_c1 | |||
| 1210 | nmdc:mga00v17_3307_c2 | |||
| 1211 | nmdc:mga0yw44_12417_c1 | |||
| 1212 | nmdc:mga0yw44_13212_c1 | |||
| 1213 | nmdc:mga0yw44_307386_c1 | |||
| 1214 | nmdc:mga0yw44_3266_c1 | |||
| 1215 | nmdc:mga0yw44_335316_c1 | |||
| 1216 | nmdc:mga0yw44_475816_c1 | |||
| 1217 | nmdc:mga0yw44_60139_c1 | |||
| 1218 | nmdc:mga0yw44_73941_c1 | |||
| 1219 | nmdc:mga0yw44_87157_c1 | |||
| 1220 | nmdc:mga0yw44_9816_c1 | |||
| 1221 | nmdc:mga06z11_100912_c1 | |||
| 1222 | nmdc:mga06z11_105290_c1 | |||
| 1223 | nmdc:mga06z11_38699_c1 | |||
| 1224 | nmdc:mga04h51_11516_c1 | |||
| 1225 | nmdc:mga04h51_56431_c1 | |||
| 1226 | nmdc:mga04h51_5683_c1 | |||
| 1227 | nmdc:mga07m45_25281_c1 | |||
| 1228 | nmdc:mga07m45_411813_c1 | |||
| 1229 | nmdc:mga07m45_477578_c1 | |||
| 1230 | nmdc:mga07m45_50818_c1 | |||
| 1231 | nmdc:mga07m45_52629_c1 | |||
| 1232 | nmdc:mga05p37_24408_c1 | |||
| 1233 | nmdc:mga05p37_440_c1 | |||
| 1234 | nmdc:mga09592_242576_c1 | |||
| 1235 | nmdc:mga09592_278_c1 | |||
| 1236 | nmdc:mga09592_861389_c1 | |||
| 1237 | nmdc:mga0qj67_228450_c1 | |||
| 1238 | nmdc:mga0qj67_2876_c1 | |||
| 1239 | nmdc:mga06r32_153455_c1 | |||
| 1240 | nmdc:mga06r32_4205_c1 | |||
| 1241 | nmdc:mga06r32_434_c1 | |||
| 1242 | nmdc:mga08y16_35992_c1 | |||
| 1243 | nmdc:mga08y16_780046_c1 | |||
| 1244 | nmdc:mga08y16_9696_c1 | |||
| 1245 | nmdc:mga0n895_691812_c1 | |||
| 1246 | nmdc:mga0sz30_8758_c1 | |||
| 1247 | Ga0495601_0048827 | |||
| 1248 | Ga0495612_0084608 | |||
| 1249 | Ga0495655_0063804 | |||
| 1250 | Ga0495619_0384202 | |||
| 1251 | Ga0500644_0000011 | |||
| 1252 | Ga0500641_0003416 | |||
| 1253 | Ga0500556_0003615 | |||
| 1254 | Ga0500593_000249 | |||
| 1255 | Ga0500573_0019858 | |||
| 1256 | Ga0501084_0013682 | |||
| 1257 | Ga0501084_0029488 | |||
| 1258 | Ga0501084_0076260 | |||
| 1259 | Ga0501084_0364341 | |||
| 1260 | Ga0501084_0629458 | |||
| 1261 | Ga0587077_092344 | |||
| 1262 | Ga0587082_070715 | |||
| 1263 | Ga0587091_096821 | |||
| 1264 | Ga0501082_0021928 | |||
| 1265 | Ga0501082_0041150 | |||
| 1266 | Ga0501082_0331863 | |||
| 1267 | Ga0501082_0412656 | |||
| 1268 | Ga0501082_0775645 | |||
| 1269 | Ga0501082_0919170 | |||
| 1270 | Ga0466962_0011797 | |||
| 1271 | Ga0466962_0119682 | |||
| 1272 | Ga0530510_0086659 | |||
| 1273 | Ga0530510_0100948 | |||
| 1274 | Ga0530510_0237165 | |||
| 1275 | 2643893472 | |||
| 1276 | 2643962522 | |||
| 1277 | 2644035478 | |||
| 1278 | 2644089194 | |||
| 1279 | 2644101711 | |||
| 1280 | 2644115773 | |||
| 1281 | 2644230463 | |||
| 1282 | 2644319039 | |||
| 1283 | 2644456979 | |||
| 1284 | 2644609741 | |||
| 1285 | 2645719717 | |||
| 1286 | 2645726605 | |||
| 1287 | 2738868453 | |||
| 1288 | 2740168870 | |||
| 1289 | 2774392740 | |||
| 1290 | 2809196540 | |||
| 1291 | 2812332918 | |||
| 1292 | 2812351308 | |||
| 1293 | 2816425555 | |||
| 1294 | 2855387314 | |||
| 1295 | 2857482167 | |||
| 1296 | 2873319998 | |||
| 1297 | 2891971079 | |||
| 1298 | 2984580186 | |||
| 1299 | 2984594845 | |||
| 1300 | 2990259036 | |||
| 1301 | 8054611323 | |||
| 1302 | 8055066080 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6jni-assembly2.cif.gz_D | crystal structure of the transcriptional regulator cadr from p. putida in complex with zinc(ii) and dna | 0.8907 | 41 | 111 |
| 7tea-assembly2.cif.gz_C | crystal structure of s. aureus glnr-dna complex | 0.8803 | 39 | 111 |
| 3qao-assembly1.cif.gz_A-2 | the crystal structure of the n-terminal domain of a merr-like transcriptional regulator from listeria monocytogenes egd-e | 0.8712 | 40 | 108 |
| 2dg6-assembly1.cif.gz_A-2 | crystal structure of the putative transcriptional regulator sco5550 from streptomyces coelicolor a3(2) | 0.8586 | 41 | 112 |
| 4r24-assembly1.cif.gz_B | complete dissection of b. subtilis nitrogen homeostatic circuitry | 0.8364 | 37 | 116 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P33358_1_73_1.10.1660.10 | Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; | 0.8802 | 40 | 113 | 1.10.1660.10 |
| af_O06302_4_79_1.10.1660.10 | Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; | 0.876 | 40 | 107 | 1.10.1660.10 |
| 3qaoA00 | Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; | 0.8577 | 44 | 108 | 1.10.1660.10 |
| 3hh0C01 | Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; | 0.8508 | 40 | 113 | 1.10.1660.10 |
| af_P33358_1_73_1.10.1660.10 | Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; | 0.8473 | 40 | 113 | 1.10.1660.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6N8KTY5-F1-model_v4 | MerR family transcriptional regulator | 0.9032 | 41 | 115 |
GO:0003677
GO:0003700 |
| AF-A0A4V5KJQ0-F1-model_v4 | MerR family transcriptional regulator | 0.9015 | 38 | 111 |
GO:0003677
GO:0003700 |
| AF-A0A7X1L7F5-F1-model_v4 | MerR family transcriptional regulator | 0.9006 | 40 | 112 |
GO:0003677
GO:0003700 |
| AF-A0A2T2WUV0-F1-model_v4 | MerR family transcriptional regulator | 0.8852 | 40 | 172 |
GO:0003677
GO:0003700 |
| AF-A0A7C1P3L5-F1-model_v4 | MerR family transcriptional regulator | 0.8829 | 40 | 170 |
GO:0003677
GO:0003700 |