F472639

General Info

Members Datasets Scaffolds Average Seq Length
651 286 1302 200

Family's Representative Sequence

Representative Sequence 3300049744|Ga0501083_0020870|Ga0501083_0020870_90_773
Length 227
Sequence MWLVPYGSPGVRASEAPTTEVTVSDTEQRGTHVPADETEAVRAAEAAEEQGLLFTDDVSPLPSDTGYRGPTACNAAGITYRQLDYWARTGLVEPSVRSATGSGSQRLYSFRDILLLKVIKRLLDAGISLQQIRTAVQHLRNRGTDDLTRVTLMSDGASVYECTSNDEVIDLLQGGQGVFGIAIGGVWREIEGSLSELPSERAGTDEAQAGPMPGDELAARRAARNAG

Samples

Sample ID Description Type Environment
1 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
8 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
9 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
47 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
48 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
49 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
50 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
53 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
54 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
123 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
128 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
129 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
130 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
131 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
132 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
133 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
134 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
135 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
136 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
137 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
138 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
139 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
140 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
141 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
142 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
143 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
144 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
145 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
146 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
147 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
148 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
149 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
150 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
151 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
152 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
153 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
154 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
155 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
156 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
157 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
158 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
159 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
160 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
161 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
162 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
163 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
164 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
165 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
166 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
167 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
168 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
169 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
170 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
171 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
172 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
173 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
174 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
175 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
176 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
177 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
178 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
179 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
180 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
181 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
182 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
183 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
184 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
185 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
186 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
187 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
188 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
189 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
190 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
191 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
192 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
193 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
194 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
195 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
196 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
197 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
198 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
214 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
215 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
216 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
217 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
218 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
219 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
220 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
221 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
222 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
223 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
224 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
225 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
226 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
227 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
230 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
231 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
232 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
233 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
234 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
235 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
236 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
237 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
238 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
239 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
240 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
241 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
242 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
243 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
244 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
245 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
246 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
247 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
248 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
249 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
250 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
251 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
252 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
253 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
254 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
255 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
256 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
257 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
258 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
259 2643221576 Nocardioides sp. Root614 Isolate Unclassified
260 2643221590 Nocardioides sp. Root682 Isolate Unclassified
261 2643221604 Nocardioides sp. Root190 Isolate Unclassified
262 2643221615 Nocardioides sp. Root224 Isolate Unclassified
263 2643221617 Nocardioides sp. Root79 Isolate Unclassified
264 2643221620 Nocardioides sp. Root240 Isolate Unclassified
265 2643221641 Nocardioides sp. Root122 Isolate Unclassified
266 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
267 2643221681 Aeromicrobium sp. Root472D3 Isolate Unclassified
268 2643221711 Terrabacter sp. Root85 Isolate Unclassified
269 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
270 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
271 2738541305 Nocardioides sp. CF167 Isolate Unclassified
272 2739367898 Nocardioides sp. CF479 Isolate Unclassified
273 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
274 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
275 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
276 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
277 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
278 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
279 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
280 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
281 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
282 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
283 2984592036 Aeromicrobium sp. SORGH_AS981 Isolate Aerial Root
284 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
285 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule
286 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 91.86
Metatranscriptomes 3.84
Isolates 4.3

Biome Distribution

Category Percentage (%)
Aerial Root 0.46
Bulb 0
Endosphere 11.21
Nodule 0.15
Rhizoplane 5.99
Rhizosphere 76.5
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501083_0020870 3300049744 Bacteria 4553
2 LJQas_1003731 3300000549 Bacteria 2024
3 JGI24740J21852_10024066 3300001979 Bacteria 2070
4 JGI24739J22299_10008156 3300001989 Bacteria 3911
5 JGI24737J22298_10008836 3300001990 Bacteria 3362
6 JGI24735J21928_10027133 3300002067 Bacteria 1717
7 JGI24735J21928_10043611 3300002067 Bacteria 1304
8 JGI25407J50210_10022274 3300003373 Bacteria 1647
9 Ga0006562J51391_1050600 3300003578 Bacteria 2290
10 Ga0006562J51391_1050602 3300003578 Bacteria 1370
11 Ga0058862_12652283 3300004803 Bacteria 860
12 Ga0070683_100003740 3300005329 Bacteria 12410
13 Ga0070683_100074850 3300005329 Bacteria 3163
14 Ga0070683_100119383 3300005329 Bacteria 2490
15 Ga0070683_100231775 3300005329 Bacteria 1756
16 Ga0070683_100435434 3300005329 Bacteria 1251
17 Ga0070682_100025384 3300005337 Bacteria 3535
18 Ga0070682_100072157 3300005337 Bacteria 2212
19 Ga0070682_100253115 3300005337 Bacteria 1271
20 Ga0068868_100316386 3300005338 Bacteria 1329
21 Ga0070660_100011867 3300005339 Bacteria 6210
22 Ga0070660_100162212 3300005339 Bacteria 1802
23 Ga0070689_100301495 3300005340 Bacteria 1334
24 Ga0070692_10184768 3300005345 Bacteria 1211
25 Ga0070692_10352561 3300005345 Bacteria 915
26 Ga0070668_100201306 3300005347 Bacteria 1635
27 Ga0070674_100628427 3300005356 Bacteria 911
28 Ga0070659_100008263 3300005366 Bacteria 7601
29 Ga0070659_100166845 3300005366 Bacteria 1802
30 Ga0070667_100307718 3300005367 Bacteria 1428
31 Ga0070667_100922706 3300005367 Bacteria 813
32 Ga0070714_100005337 3300005435 Bacteria 9799
33 Ga0070713_100070762 3300005436 Bacteria 2945
34 Ga0070701_10512628 3300005438 Bacteria 781
35 Ga0070700_100247387 3300005441 Bacteria 1277
36 Ga0070663_100172459 3300005455 Bacteria 1673
37 Ga0070678_100695316 3300005456 Bacteria 916
38 Ga0070662_100049420 3300005457 Bacteria 3033
39 Ga0070681_10122084 3300005458 Bacteria 2539
40 Ga0068867_100622443 3300005459 Bacteria 944
41 Ga0070698_100006744 3300005471 Bacteria 12448
42 Ga0070679_100014118 3300005530 Bacteria 7661
43 Ga0070684_100003215 3300005535 Bacteria 12221
44 Ga0070684_100093938 3300005535 Bacteria 2671
45 Ga0070684_100103686 3300005535 Bacteria 2544
46 Ga0070684_100108037 3300005535 Bacteria 2493
47 Ga0070684_100521094 3300005535 Bacteria 1102
48 Ga0070672_100261385 3300005543 Bacteria 1460
49 Ga0070665_100000718 3300005548 Bacteria 44076
50 Ga0070665_101220385 3300005548 Bacteria 763
51 Ga0068855_100166448 3300005563 Bacteria 2499
52 Ga0068855_100512877 3300005563 Bacteria 1302
53 Ga0070664_100842084 3300005564 Bacteria 859
54 Ga0068857_100033027 3300005577 Bacteria 4576
55 Ga0068857_100055612 3300005577 Bacteria 3512
56 Ga0068857_100293425 3300005577 Bacteria 1498
57 Ga0068856_100023421 3300005614 Bacteria 6004
58 Ga0068856_100322966 3300005614 Bacteria 1561
59 Ga0068856_100558796 3300005614 Bacteria 1166
60 Ga0068856_100633197 3300005614 Bacteria 1090
61 Ga0070702_100020628 3300005615 Bacteria 3455
62 Ga0068852_100375884 3300005616 Bacteria 1393
63 Ga0068852_100742075 3300005616 Bacteria 994
64 Ga0068852_100754076 3300005616 Bacteria 986
65 Ga0068864_100043411 3300005618 Bacteria 3850
66 Ga0068866_10471802 3300005718 Bacteria 825
67 Ga0068861_100280875 3300005719 Bacteria 1434
68 Ga0068861_100377605 3300005719 Bacteria 1251
69 Ga0068858_100059911 3300005842 Bacteria 3519
70 Ga0068860_100000795 3300005843 Bacteria 35417
71 Ga0081455_10002473 3300005937 Bacteria 21966
72 Ga0081455_10008841 3300005937 Bacteria 10417
73 Ga0081455_10030284 3300005937 Bacteria 4919
74 Ga0081455_10094549 3300005937 Bacteria 2414
75 Ga0081538_10000036 3300005981 Bacteria 119944
76 Ga0081538_10020962 3300005981 Bacteria 4793
77 Ga0075365_10031881 3300006038 Bacteria 3384
78 Ga0075365_10032136 3300006038 Bacteria 3371
79 Ga0075365_10064813 3300006038 Bacteria 2448
80 Ga0075365_10065898 3300006038 Bacteria 2428
81 Ga0075365_10084937 3300006038 Bacteria 2149
82 Ga0075365_10156267 3300006038 Bacteria 1587
83 Ga0075365_10212788 3300006038 Bacteria 1355
84 Ga0075365_10217728 3300006038 Bacteria 1339
85 Ga0075365_10256019 3300006038 Bacteria 1230
86 Ga0075365_10266244 3300006038 Bacteria 1205
87 Ga0075365_10413257 3300006038 Bacteria 952
88 Ga0075365_10510682 3300006038 Bacteria 849
89 Ga0075368_10000651 3300006042 Bacteria 10558
90 Ga0075368_10000759 3300006042 Bacteria 9904
91 Ga0075368_10110381 3300006042 Bacteria 1134
92 Ga0075363_100008166 3300006048 Bacteria 4860
93 Ga0075363_100073334 3300006048 Bacteria 1862
94 Ga0075363_100166080 3300006048 Bacteria 1251
95 Ga0075363_100393527 3300006048 Bacteria 814
96 Ga0075364_10015661 3300006051 Bacteria 4706
97 Ga0075364_10048931 3300006051 Bacteria 2755
98 Ga0075364_10167762 3300006051 Bacteria 1483
99 Ga0075364_10252190 3300006051 Bacteria 1199
100 Ga0075364_10484613 3300006051 Bacteria 845
101 Ga0070712_100163138 3300006175 Bacteria 1722
102 Ga0075362_10100951 3300006177 Bacteria 1349
103 Ga0075367_10016017 3300006178 Bacteria 4088
104 Ga0075367_10076401 3300006178 Bacteria 2021
105 Ga0075367_10093513 3300006178 Bacteria 1831
106 Ga0075367_10126344 3300006178 Bacteria 1578
107 Ga0075367_10152289 3300006178 Bacteria 1436
108 Ga0075369_10116084 3300006186 Bacteria 1209
109 Ga0097621_100152868 3300006237 Bacteria 1979
110 Ga0097621_100386406 3300006237 Bacteria 1251
111 Ga0075370_10008207 3300006353 Bacteria 5359
112 Ga0075370_10024266 3300006353 Bacteria 3348
113 Ga0075370_10482815 3300006353 Bacteria 747
114 Ga0075428_100001304 3300006844 Bacteria 26458
115 Ga0075428_100018522 3300006844 Bacteria 7699
116 Ga0075430_100006263 3300006846 Bacteria 10034
117 Ga0075431_100005941 3300006847 Bacteria 12078
118 Ga0075431_100008250 3300006847 Bacteria 10415
119 Ga0075431_100012367 3300006847 Bacteria 8613
120 Ga0075434_100890735 3300006871 Bacteria 905
121 Ga0075429_100001324 3300006880 Bacteria 20208
122 Ga0075429_100005562 3300006880 Bacteria 10857
123 Ga0068865_100053158 3300006881 Bacteria 2810
124 Ga0068865_100194027 3300006881 Bacteria 1573
125 Ga0068865_100458910 3300006881 Bacteria 1055
126 Ga0105245_10030002 3300009098 Bacteria 4808
127 Ga0105245_10467629 3300009098 Bacteria 1272
128 Ga0105245_10897724 3300009098 Bacteria 928
129 Ga0114129_10005577 3300009147 Bacteria 17801
130 Ga0114129_10334294 3300009147 Bacteria 2010
131 Ga0105243_10091798 3300009148 Bacteria 2501
132 Ga0105243_10816057 3300009148 Bacteria 921
133 Ga0105242_10340246 3300009176 Bacteria 1382
134 Ga0105242_10387425 3300009176 Bacteria 1301
135 Ga0105242_11386923 3300009176 Bacteria 730
136 Ga0105248_10526386 3300009177 Bacteria 1333
137 Ga0105237_10076087 3300009545 Bacteria 3347
138 Ga0105237_10377184 3300009545 Bacteria 1423
139 Ga0105237_10414944 3300009545 Bacteria 1351
140 Ga0105237_10799357 3300009545 Bacteria 950
141 Ga0105238_10232288 3300009551 Bacteria 1821
142 Ga0105249_10176113 3300009553 Bacteria 2078
143 Ga0105249_10736884 3300009553 Bacteria 1047
144 Ga0105239_10007348 3300010375 Bacteria 12656
145 Ga0105239_10043400 3300010375 Bacteria 4928
146 Ga0105246_10094437 3300011119 Bacteria 2163
147 Ga0105246_10275888 3300011119 Bacteria 1346
148 Ga0105246_10814700 3300011119 Bacteria 830
149 Ga0157318_1008524 3300012482 Bacteria 722
150 Ga0157370_10684822 3300013104 Bacteria 936
151 Ga0163162_10018511 3300013306 Bacteria 6824
152 Ga0157372_10007692 3300013307 Bacteria 11465
153 Ga0157372_10570005 3300013307 Bacteria 1319
154 Ga0157372_10706639 3300013307 Bacteria 1173
155 Ga0157372_11014759 3300013307 Bacteria 961
156 Ga0163163_10184891 3300014325 Bacteria 2132
157 Ga0163163_10302785 3300014325 Bacteria 1651
158 Ga0163163_10417360 3300014325 Bacteria 1401
159 Ga0157380_10232072 3300014326 Bacteria 1658
160 Ga0182008_10074703 3300014497 Bacteria 1668
161 Ga0182008_10086116 3300014497 Bacteria 1547
162 Ga0157377_10072866 3300014745 Bacteria 1989
163 Ga0157377_10399493 3300014745 Bacteria 936
164 Ga0182006_1202842 3300015261 Bacteria 657
165 Ga0163161_10093911 3300017792 Bacteria 2223
166 Ga0163161_10304698 3300017792 Bacteria 1256
167 Ga0197907_10065901 3300020069 Bacteria 1180
168 Ga0197907_10248495 3300020069 Bacteria 2620
169 Ga0197907_10744107 3300020069 Bacteria 1620
170 Ga0206349_1753929 3300020075 Bacteria 956
171 Ga0206351_10862294 3300020077 Bacteria 2089
172 Ga0206351_10876275 3300020077 Bacteria 738
173 Ga0206352_10249820 3300020078 Bacteria 1433
174 Ga0206350_10362717 3300020080 Bacteria 990
175 Ga0206350_10529565 3300020080 Bacteria 2540
176 Ga0206350_11029862 3300020080 Bacteria 1005
177 Ga0206350_11314634 3300020080 Bacteria 1524
178 Ga0206354_10987867 3300020081 Bacteria 3719
179 Ga0206354_11720080 3300020081 Bacteria 873
180 Ga0206353_10193799 3300020082 Bacteria 1353
181 Ga0206353_10445806 3300020082 Bacteria 9670
182 Ga0206353_10770605 3300020082 Bacteria 2041
183 Ga0206353_11162229 3300020082 Bacteria 2132
184 Ga0224712_10029028 3300022467 Bacteria 1983
185 Ga0224712_10060181 3300022467 Bacteria 1510
186 Ga0207642_10286585 3300025899 Bacteria 949
187 Ga0207647_10108457 3300025904 Bacteria 1642
188 Ga0207647_10124994 3300025904 Bacteria 1514
189 Ga0207643_10104365 3300025908 Bacteria 1664
190 Ga0207705_10159576 3300025909 Bacteria 1694
191 Ga0207705_10273384 3300025909 Bacteria 1292
192 Ga0207707_10713873 3300025912 Bacteria 841
193 Ga0207671_10166077 3300025914 Bacteria 1711
194 Ga0207671_10599599 3300025914 Bacteria 878
195 Ga0207693_10195969 3300025915 Bacteria 1589
196 Ga0207657_10015319 3300025919 Bacteria 7432
197 Ga0207657_10045545 3300025919 Bacteria 3849
198 Ga0207657_10104445 3300025919 Bacteria 2347
199 Ga0207652_10045754 3300025921 Bacteria 3731
200 Ga0207687_10023055 3300025927 Bacteria 4146
201 Ga0207687_10519515 3300025927 Bacteria 996
202 Ga0207700_10060662 3300025928 Bacteria 2865
203 Ga0207664_10004124 3300025929 Bacteria 9806
204 Ga0207690_10012748 3300025932 Bacteria 5037
205 Ga0207690_10076392 3300025932 Bacteria 2326
206 Ga0207690_10465059 3300025932 Bacteria 1018
207 Ga0207690_10511179 3300025932 Bacteria 972
208 Ga0207709_10766383 3300025935 Bacteria 777
209 Ga0207704_10108866 3300025938 Bacteria 1867
210 Ga0207704_10384721 3300025938 Bacteria 1102
211 Ga0207691_10128940 3300025940 Bacteria 2236
212 Ga0207661_10094156 3300025944 Bacteria 2501
213 Ga0207661_10331391 3300025944 Bacteria 1370
214 Ga0207661_10420201 3300025944 Bacteria 1214
215 Ga0207679_10368361 3300025945 Bacteria 1257
216 Ga0207667_10086092 3300025949 Bacteria 3253
217 Ga0207667_10529841 3300025949 Bacteria 1193
218 Ga0207668_10290896 3300025972 Bacteria 1344
219 Ga0207658_10710672 3300025986 Bacteria 909
220 Ga0207677_10121398 3300026023 Bacteria 1966
221 Ga0207677_10201621 3300026023 Bacteria 1582
222 Ga0207703_10031783 3300026035 Bacteria 4175
223 Ga0207678_10078899 3300026067 Bacteria 2820
224 Ga0207678_10414918 3300026067 Bacteria 1167
225 Ga0207678_10661122 3300026067 Bacteria 918
226 Ga0207708_10095591 3300026075 Bacteria 2295
227 Ga0207702_10062128 3300026078 Bacteria 3188
228 Ga0207702_10137949 3300026078 Bacteria 2203
229 Ga0207702_10163106 3300026078 Bacteria 2037
230 Ga0207702_10334151 3300026078 Bacteria 1446
231 Ga0207648_10577247 3300026089 Bacteria 1035
232 Ga0207676_10015967 3300026095 Bacteria 5432
233 Ga0207674_10008329 3300026116 Bacteria 11994
234 Ga0207674_10026516 3300026116 Bacteria 6151
235 Ga0207674_10263124 3300026116 Bacteria 1672
236 Ga0207674_10385830 3300026116 Bacteria 1354
237 Ga0207675_100487453 3300026118 Bacteria 1226
238 Ga0207675_100621618 3300026118 Bacteria 1085
239 Ga0207698_10208937 3300026142 Bacteria 1755
240 Ga0209813_10041175 3300027866 Bacteria 1407
241 Ga0209813_10048606 3300027866 Bacteria 1318
242 Ga0209813_10130699 3300027866 Bacteria 883
243 Ga0207428_10002497 3300027907 Bacteria 18376
244 Ga0207428_10063797 3300027907 Bacteria 2910
245 Ga0268266_10001282 3300028379 Bacteria 30666
246 Ga0268266_10558861 3300028379 Bacteria 1097
247 Ga0268265_10252949 3300028380 Bacteria 1562
248 Ga0268265_10404403 3300028380 Bacteria 1263
249 Ga0268264_10395811 3300028381 Bacteria 1326
250 Ga0316182_1448023 3300030745 Bacteria 1627
251 Ga0307508_10207708 3300031616 Bacteria 1559
252 Ga0307405_10087831 3300031731 Bacteria 2050
253 Ga0307413_10023910 3300031824 Bacteria 3320
254 Ga0307413_10137167 3300031824 Bacteria 1684
255 Ga0307410_10024462 3300031852 Bacteria 3773
256 Ga0307410_10138671 3300031852 Bacteria 1796
257 Ga0307406_10008723 3300031901 Bacteria 5666
258 Ga0307407_10108680 3300031903 Bacteria 1737
259 Ga0307407_10186959 3300031903 Bacteria 1377
260 Ga0307407_10323950 3300031903 Bacteria 1082
261 Ga0307407_10420183 3300031903 Bacteria 963
262 Ga0307412_10403692 3300031911 Bacteria 1113
263 Ga0307409_100011064 3300031995 Bacteria 5661
264 Ga0307409_100026236 3300031995 Bacteria 4105
265 Ga0307409_100029113 3300031995 Bacteria 3948
266 Ga0307409_100032879 3300031995 Bacteria 3767
267 Ga0307409_100534273 3300031995 Bacteria 1148
268 Ga0307409_101084422 3300031995 Bacteria 821
269 Ga0307409_101327462 3300031995 Bacteria 745
270 Ga0307416_100001535 3300032002 Bacteria 12624
271 Ga0307416_100114735 3300032002 Bacteria 2384
272 Ga0307416_100390019 3300032002 Bacteria 1426
273 Ga0307416_100752172 3300032002 Bacteria 1067
274 Ga0307416_101080769 3300032002 Bacteria 906
275 Ga0307414_10132737 3300032004 Bacteria 1936
276 Ga0307414_10720906 3300032004 Bacteria 904
277 Ga0307414_10919158 3300032004 Bacteria 803
278 Ga0307411_10644809 3300032005 Bacteria 916
279 Ga0307415_100000465 3300032126 Bacteria 17499
280 Ga0307415_100048248 3300032126 Bacteria 2872
281 Ga0307415_100055185 3300032126 Bacteria 2717
282 Ga0307415_100191196 3300032126 Bacteria 1615
283 Ga0307415_100497243 3300032126 Bacteria 1065
284 Ga0307415_101223437 3300032126 Bacteria 708
285 Ga0373951_0095391 3300035091 Bacteria 785
286 Ga0395899_0110088 3300037312 Bacteria 1981
287 Ga0395900_0184133 3300037418 Bacteria 2121
288 Ga0395900_0365605 3300037418 Bacteria 1413
289 Ga0395898_0506280 3300037466 Bacteria 1148
290 Ga0395905_0046796 3300037471 Bacteria 4056
291 Ga0436364_0879964 3300037853 Bacteria 1406
292 Ga0395901_0133003 3300038443 Bacteria 2614
293 Ga0395901_0799229 3300038443 Bacteria 932
294 Ga0436360_0772751 3300039438 Bacteria 643
295 Ga0439465_0016986 3300041413 Bacteria 2271
296 Ga0439465_0031090 3300041413 Bacteria 1700
297 Ga0451833_0134092 3300041491 Bacteria 2920
298 Ga0451833_0146647 3300041491 Bacteria 5377
299 Ga0451833_0592120 3300041491 Bacteria 928
300 Ga0451837_0003726 3300041494 Bacteria 5607
301 Ga0451839_1035743 3300041496 Bacteria 4422
302 Ga0451853_1057058 3300041512 Bacteria 9964
303 Ga0451853_2374902 3300041512 Bacteria 1779
304 Ga0451853_3299735 3300041512 Bacteria 747
305 Ga0439431_0009456 3300041997 Bacteria 2202
306 Ga0439431_0070108 3300041997 Bacteria 933
307 Ga0439445_0004717 3300042004 Bacteria 3092
308 Ga0439445_0024862 3300042004 Bacteria 1525
309 Ga0439432_081351 3300042006 Bacteria 981
310 Ga0439449_0090825 3300042007 Bacteria 1128
311 Ga0439446_0004746 3300042156 Bacteria 3458
312 Ga0439434_0011486 3300042435 Bacteria 2618
313 Ga0439434_0012802 3300042435 Bacteria 2486
314 Ga0439434_0136034 3300042435 Bacteria 808
315 Ga0439464_0030151 3300042439 Bacteria 1518
316 Ga0466969_0077935 3300044656 Bacteria 1585
317 Ga0466972_0002214 3300044658 Bacteria 9547
318 Ga0466972_0046852 3300044658 Bacteria 2092
319 Ga0466972_0145681 3300044658 Bacteria 1114
320 Ga0466972_0231069 3300044658 Bacteria 865
321 Ga0466965_0020176 3300044683 Bacteria 3202
322 Ga0466965_0042954 3300044683 Bacteria 2231
323 Ga0466965_0164162 3300044683 Bacteria 1166
324 Ga0466965_0303765 3300044683 Bacteria 866
325 Ga0466966_0002073 3300044684 Bacteria 12998
326 Ga0466961_0021468 3300044693 Bacteria 4155
327 Ga0466963_0000954 3300044694 Bacteria 14852
328 Ga0466963_0024025 3300044694 Bacteria 3877
329 Ga0466963_0064596 3300044694 Bacteria 2452
330 Ga0466963_0225129 3300044694 Bacteria 1314
331 Ga0466963_0318635 3300044694 Bacteria 1094
332 Ga0466964_0207092 3300044706 Bacteria 945
333 Ga0466971_0005350 3300044719 Bacteria 5565
334 Ga0466971_0043121 3300044719 Bacteria 2027
335 Ga0466971_0076470 3300044719 Bacteria 1523
336 Ga0466968_0028294 3300044735 Bacteria 2311
337 Ga0466968_0257346 3300044735 Bacteria 830
338 Ga0466970_0004978 3300044765 Bacteria 6565
339 Ga0466970_0014684 3300044765 Bacteria 4023
340 Ga0466970_0025594 3300044765 Bacteria 3090
341 Ga0466970_0080583 3300044765 Bacteria 1759
342 Ga0466970_0124192 3300044765 Bacteria 1415
343 Ga0466970_0255213 3300044765 Bacteria 983
344 Ga0466970_0278956 3300044765 Bacteria 940
345 Ga0466970_0379498 3300044765 Bacteria 804
346 Ga0466957_0067880 3300044842 Bacteria 2200
347 Ga0466957_0271270 3300044842 Bacteria 1133
348 Ga0466960_0008169 3300044901 Bacteria 4278
349 Ga0466960_0072768 3300044901 Bacteria 1714
350 Ga0466960_0102482 3300044901 Bacteria 1476
351 Ga0466960_0156558 3300044901 Bacteria 1220
352 Ga0466960_0223382 3300044901 Bacteria 1037
353 Ga0466960_0374746 3300044901 Bacteria 816
354 Ga0466959_0044099 3300045049 Bacteria 3286
355 Ga0466959_0156306 3300045049 Bacteria 1605
356 Ga0466959_0323594 3300045049 Bacteria 1054
357 Ga0466967_0001480 3300045976 Bacteria 13704
358 Ga0466967_0026752 3300045976 Bacteria 4785
359 Ga0466967_0027395 3300045976 Bacteria 4739
360 Ga0466967_0033913 3300045976 Bacteria 4326
361 Ga0466967_0044313 3300045976 Bacteria 3858
362 Ga0466967_0162319 3300045976 Bacteria 2098
363 Ga0466967_0287850 3300045976 Bacteria 1578
364 Ga0466967_0291867 3300045976 Bacteria 1567
365 Ga0466967_0335570 3300045976 Bacteria 1461
366 Ga0466967_0391882 3300045976 Bacteria 1350
367 Ga0466967_0705762 3300045976 Bacteria 999
368 Ga0495627_043083 3300046453 Bacteria 1381
369 Ga0495630_0369157 3300046517 Bacteria 1099
370 Ga0495635_0401429 3300046663 Bacteria 911
371 Ga0495624_0453977 3300046690 Bacteria 768
372 Ga0495649_0355987 3300046694 Bacteria 739
373 Ga0495600_0215736 3300046809 Bacteria 1229
374 Ga0495581_0075245 3300047315 Bacteria 1954
375 Ga0496100_0249389 3300048903 Bacteria 1313
376 Ga0496100_0486540 3300048903 Bacteria 949
377 Ga0496101_0136594 3300048904 Bacteria 1866
378 Ga0496102_0022378 3300048905 Bacteria 5600
379 Ga0496102_0035621 3300048905 Bacteria 4480
380 Ga0496102_0102588 3300048905 Bacteria 2659
381 Ga0496102_0448933 3300048905 Bacteria 1210
382 Ga0496103_0127528 3300048906 Bacteria 1623
383 Ga0496103_0139888 3300048906 Bacteria 1548
384 Ga0496103_0223947 3300048906 Bacteria 1209
385 Ga0496104_0747006 3300048907 Bacteria 885
386 Ga0496105_0121474 3300048908 Bacteria 2154
387 Ga0496106_0019110 3300048909 Bacteria 5079
388 Ga0496106_0023995 3300048909 Bacteria 4532
389 Ga0496107_0041937 3300048910 Bacteria 3287
390 Ga0496108_0004318 3300048911 Bacteria 11429
391 Ga0496108_0142909 3300048911 Bacteria 2062
392 Ga0496108_0222238 3300048911 Bacteria 1641
393 Ga0496108_0610218 3300048911 Bacteria 950
394 Ga0496109_0043342 3300048912 Bacteria 4078
395 Ga0496109_0139415 3300048912 Bacteria 2267
396 Ga0496109_0640982 3300048912 Bacteria 999
397 Ga0496109_0648846 3300048912 Bacteria 992
398 Ga0496110_0002633 3300048913 Bacteria 13519
399 Ga0496110_0046611 3300048913 Bacteria 3792
400 Ga0496110_0124378 3300048913 Bacteria 2326
401 Ga0496110_0204196 3300048913 Bacteria 1796
402 Ga0496111_0001296 3300048914 Bacteria 14025
403 Ga0496111_0195009 3300048914 Bacteria 1505
404 Ga0496112_0110054 3300048915 Bacteria 2725
405 Ga0496112_0516588 3300048915 Bacteria 1129
406 Ga0496114_0061011 3300048917 Bacteria 3153
407 Ga0496114_0093556 3300048917 Bacteria 2556
408 Ga0496114_0095344 3300048917 Bacteria 2532
409 Ga0496114_0116564 3300048917 Bacteria 2293
410 Ga0496114_0213313 3300048917 Bacteria 1694
411 Ga0496114_0301861 3300048917 Bacteria 1414
412 Ga0496114_0414614 3300048917 Bacteria 1193
413 Ga0496114_0457082 3300048917 Bacteria 1130
414 Ga0496123_0037516 3300048926 Bacteria 3420
415 Ga0496124_0068545 3300048927 Bacteria 2948
416 Ga0496126_0540812 3300048929 Bacteria 926
417 Ga0501031_0018376 3300049568 Bacteria 4551
418 Ga0501031_0061422 3300049568 Bacteria 2449
419 Ga0501031_0073255 3300049568 Bacteria 2230
420 Ga0501031_0112484 3300049568 Bacteria 1778
421 Ga0501031_0297567 3300049568 Bacteria 1046
422 Ga0501031_0343369 3300049568 Bacteria 966
423 Ga0501032_0145527 3300049569 Bacteria 1560
424 Ga0501033_0002738 3300049570 Bacteria 14781
425 Ga0501033_0137487 3300049570 Bacteria 1768
426 Ga0501034_0003420 3300049571 Bacteria 18127
427 Ga0501034_0009364 3300049571 Bacteria 10262
428 Ga0501034_0041305 3300049571 Bacteria 4666
429 Ga0501034_0065126 3300049571 Bacteria 3657
430 Ga0501034_0220200 3300049571 Bacteria 1851
431 Ga0501036_0022050 3300049572 Bacteria 5356
432 Ga0501036_0063225 3300049572 Bacteria 3134
433 Ga0501036_0095534 3300049572 Bacteria 2512
434 Ga0501036_0207058 3300049572 Bacteria 1649
435 Ga0501036_0256933 3300049572 Bacteria 1464
436 Ga0501036_0268815 3300049572 Bacteria 1428
437 Ga0501037_0002685 3300049573 Bacteria 12837
438 Ga0501037_0059501 3300049573 Bacteria 2787
439 Ga0501037_0122570 3300049573 Bacteria 1868
440 Ga0501037_0146437 3300049573 Bacteria 1689
441 Ga0501037_0307026 3300049573 Bacteria 1101
442 Ga0501038_0008939 3300049574 Bacteria 9190
443 Ga0501038_0106431 3300049574 Bacteria 2328
444 Ga0501038_0334261 3300049574 Bacteria 1183
445 Ga0501039_0003723 3300049575 Bacteria 11454
446 Ga0501039_0019805 3300049575 Bacteria 5158
447 Ga0501039_0031977 3300049575 Bacteria 4056
448 Ga0501039_0108252 3300049575 Bacteria 2172
449 Ga0501039_0236017 3300049575 Bacteria 1438
450 Ga0501039_0429867 3300049575 Bacteria 1037
451 Ga0501040_0015306 3300049576 Bacteria 5071
452 Ga0501040_0087395 3300049576 Bacteria 2165
453 Ga0501041_0008092 3300049577 Bacteria 6189
454 Ga0501041_0046586 3300049577 Bacteria 2638
455 Ga0501041_0137536 3300049577 Bacteria 1523
456 Ga0501041_0163769 3300049577 Bacteria 1391
457 Ga0501042_0005584 3300049578 Bacteria 8106
458 Ga0501042_0030049 3300049578 Bacteria 3836
459 Ga0501042_0042004 3300049578 Bacteria 3253
460 Ga0501042_0113731 3300049578 Bacteria 1949
461 Ga0501042_0163977 3300049578 Bacteria 1603
462 Ga0501042_0179673 3300049578 Bacteria 1527
463 Ga0501043_0012296 3300049579 Bacteria 6691
464 Ga0501043_0015277 3300049579 Bacteria 6014
465 Ga0501043_0203455 3300049579 Bacteria 1536
466 Ga0501043_0417909 3300049579 Bacteria 1011
467 Ga0501046_0001565 3300049580 Bacteria 21864
468 Ga0501046_0005428 3300049580 Bacteria 11393
469 Ga0501046_0092828 3300049580 Bacteria 2320
470 Ga0501047_0024486 3300049581 Bacteria 5792
471 Ga0501047_0045310 3300049581 Bacteria 4252
472 Ga0501047_0590957 3300049581 Bacteria 932
473 Ga0501047_0624514 3300049581 Bacteria 898
474 Ga0501048_0009344 3300049582 Bacteria 7362
475 Ga0501048_0016709 3300049582 Bacteria 5409
476 Ga0501048_0109316 3300049582 Bacteria 1952
477 Ga0501048_0165290 3300049582 Bacteria 1567
478 Ga0501067_0001120 3300049583 Bacteria 14498
479 Ga0501067_0001382 3300049583 Bacteria 13158
480 Ga0501067_0014065 3300049583 Bacteria 4434
481 Ga0501067_0083831 3300049583 Bacteria 1768
482 Ga0501067_0084124 3300049583 Bacteria 1765
483 Ga0501067_0353025 3300049583 Bacteria 820
484 Ga0501068_0001745 3300049584 Bacteria 11565
485 Ga0501068_0023545 3300049584 Bacteria 3609
486 Ga0501068_0038296 3300049584 Bacteria 2872
487 Ga0501068_0061218 3300049584 Bacteria 2287
488 Ga0501069_0210357 3300049585 Bacteria 1129
489 Ga0501069_0412920 3300049585 Bacteria 799
490 Ga0501070_0001013 3300049586 Bacteria 25211
491 Ga0501070_0015547 3300049586 Bacteria 6401
492 Ga0501070_0021607 3300049586 Bacteria 5397
493 Ga0501070_0062168 3300049586 Bacteria 3093
494 Ga0501070_0064022 3300049586 Bacteria 3046
495 Ga0501070_0144844 3300049586 Bacteria 1961
496 Ga0501070_0274095 3300049586 Bacteria 1377
497 Ga0501070_0322823 3300049586 Bacteria 1255
498 Ga0501070_0706348 3300049586 Bacteria 797
499 Ga0501071_0001200 3300049587 Bacteria 14638
500 Ga0501071_0003370 3300049587 Bacteria 9979
501 Ga0501071_0035796 3300049587 Bacteria 3537
502 Ga0501071_0090031 3300049587 Bacteria 2253
503 Ga0501071_0090630 3300049587 Bacteria 2245
504 Ga0501071_0258757 3300049587 Bacteria 1314
505 Ga0501071_0439582 3300049587 Bacteria 998
506 Ga0501072_0005237 3300049588 Bacteria 9873
507 Ga0501072_0009652 3300049588 Bacteria 7341
508 Ga0501072_0013040 3300049588 Bacteria 6362
509 Ga0501072_0086600 3300049588 Bacteria 2486
510 Ga0501072_0108359 3300049588 Bacteria 2210
511 Ga0501072_0680679 3300049588 Bacteria 809
512 Ga0501073_0001891 3300049589 Bacteria 15599
513 Ga0501073_0012139 3300049589 Bacteria 6290
514 Ga0501073_0028226 3300049589 Bacteria 4010
515 Ga0501074_0000418 3300049590 Bacteria 25404
516 Ga0501074_0001793 3300049590 Bacteria 14692
517 Ga0501074_0030618 3300049590 Bacteria 3900
518 Ga0501074_0036185 3300049590 Bacteria 3577
519 Ga0501074_0067315 3300049590 Bacteria 2576
520 Ga0501075_0031735 3300049591 Bacteria 3923
521 Ga0501075_0151238 3300049591 Bacteria 1769
522 Ga0501075_0176292 3300049591 Bacteria 1631
523 Ga0501076_0009331 3300049592 Bacteria 7240
524 Ga0501076_0036315 3300049592 Bacteria 3861
525 Ga0501076_0453357 3300049592 Bacteria 1056
526 Ga0501077_0120113 3300049593 Bacteria 1665
527 Ga0501077_0144610 3300049593 Bacteria 1508
528 Ga0501079_0002456 3300049741 Bacteria 13459
529 Ga0501079_0006491 3300049741 Bacteria 8784
530 Ga0501079_0016089 3300049741 Bacteria 5716
531 Ga0501079_0413504 3300049741 Bacteria 1058
532 Ga0501080_0019863 3300049742 Bacteria 6221
533 Ga0501080_0049943 3300049742 Bacteria 3893
534 Ga0501081_0043743 3300049743 Bacteria 3073
535 Ga0501081_0083119 3300049743 Bacteria 2244
536 Ga0501081_0253423 3300049743 Bacteria 1285
537 Ga0501083_0001662 3300049744 Bacteria 15178
538 Ga0501083_0101244 3300049744 Bacteria 1900
539 Ga0501083_0366360 3300049744 Bacteria 937
540 Ga0501035_0115490 3300049822 Bacteria 2349
541 Ga0501035_0197548 3300049822 Bacteria 1727
542 Ga0501035_0339215 3300049822 Bacteria 1260
543 Ga0501044_0049433 3300049823 Bacteria 4341
544 Ga0501044_0177412 3300049823 Bacteria 2099
545 Ga0501044_0388769 3300049823 Bacteria 1309
546 Ga0501045_0023480 3300049824 Bacteria 4422
547 Ga0501045_0035738 3300049824 Bacteria 3608
548 Ga0501045_0149430 3300049824 Bacteria 1738
549 Ga0501045_0166986 3300049824 Bacteria 1639
550 Ga0501045_0409960 3300049824 Bacteria 1008
551 nmdc:mga03n38_225245_c1 3300050490 Bacteria 981
552 nmdc:mga03n38_48099_c1 3300050490 Bacteria 1891
553 nmdc:mga03n38_71215_c1 3300050490 Bacteria 1610
554 nmdc:mga00v17_130334_c1 3300050491 Bacteria 1607
555 nmdc:mga00v17_134216_c1 3300050491 Bacteria 1584
556 nmdc:mga00v17_185951_c1 3300050491 Bacteria 1341
557 nmdc:mga00v17_259731_c1 3300050491 Bacteria 1127
558 nmdc:mga00v17_292452_c1 3300050491 Bacteria 1058
559 nmdc:mga00v17_3307_c2 3300050491 Bacteria 4601
560 nmdc:mga0yw44_12417_c1 3300050492 Bacteria 4439
561 nmdc:mga0yw44_13212_c1 3300050492 Bacteria 4338
562 nmdc:mga0yw44_307386_c1 3300050492 Bacteria 1063
563 nmdc:mga0yw44_3266_c1 3300050492 Bacteria 7157
564 nmdc:mga0yw44_335316_c1 3300050492 Bacteria 1017
565 nmdc:mga0yw44_475816_c1 3300050492 Bacteria 847
566 nmdc:mga0yw44_60139_c1 3300050492 Bacteria 2327
567 nmdc:mga0yw44_73941_c1 3300050492 Bacteria 2122
568 nmdc:mga0yw44_87157_c1 3300050492 Bacteria 1968
569 nmdc:mga0yw44_9816_c1 3300050492 Bacteria 4861
570 nmdc:mga06z11_100912_c1 3300050494 Bacteria 1583
571 nmdc:mga06z11_105290_c1 3300050494 Bacteria 1554
572 nmdc:mga06z11_38699_c1 3300050494 Bacteria 2369
573 nmdc:mga04h51_11516_c1 3300050495 Bacteria 2457
574 nmdc:mga04h51_56431_c1 3300050495 Bacteria 1333
575 nmdc:mga04h51_5683_c1 3300050495 Bacteria 3189
576 nmdc:mga07m45_25281_c1 3300050496 Bacteria 3256
577 nmdc:mga07m45_411813_c1 3300050496 Bacteria 784
578 nmdc:mga07m45_477578_c1 3300050496 Bacteria 722
579 nmdc:mga07m45_50818_c1 3300050496 Bacteria 2337
580 nmdc:mga07m45_52629_c1 3300050496 Bacteria 2299
581 nmdc:mga05p37_24408_c1 3300050507 Bacteria 7347
582 nmdc:mga05p37_440_c1 3300050507 Bacteria 45174
583 nmdc:mga09592_242576_c1 3300050508 Bacteria 1561
584 nmdc:mga09592_278_c1 3300050508 Bacteria 37149
585 nmdc:mga09592_861389_c1 3300050508 Bacteria 764
586 nmdc:mga0qj67_228450_c1 3300050509 Bacteria 1510
587 nmdc:mga0qj67_2876_c1 3300050509 Bacteria 12357
588 nmdc:mga06r32_153455_c1 3300050510 Bacteria 2283
589 nmdc:mga06r32_4205_c1 3300050510 Bacteria 12899
590 nmdc:mga06r32_434_c1 3300050510 Bacteria 35341
591 nmdc:mga08y16_35992_c1 3300050511 Bacteria 5199
592 nmdc:mga08y16_780046_c1 3300050511 Bacteria 950
593 nmdc:mga08y16_9696_c1 3300050511 Bacteria 10110
594 nmdc:mga0n895_691812_c1 3300050512 Bacteria 1016
595 nmdc:mga0sz30_8758_c1 3300050516 Bacteria 3829
596 Ga0495601_0048827 3300053077 Bacteria 2666
597 Ga0495612_0084608 3300053078 Bacteria 1336
598 Ga0495655_0063804 3300053083 Bacteria 1012
599 Ga0495619_0384202 3300053085 Bacteria 970
600 Ga0500644_0000011 3300053088 Bacteria 125595
601 Ga0500641_0003416 3300053096 Bacteria 5612
602 Ga0500556_0003615 3300053104 Bacteria 4503
603 Ga0500593_000249 3300053117 Bacteria 22097
604 Ga0500573_0019858 3300053140 Bacteria 3846
605 Ga0501084_0013682 3300054114 Bacteria 6717
606 Ga0501084_0029488 3300054114 Bacteria 4589
607 Ga0501084_0076260 3300054114 Bacteria 2810
608 Ga0501084_0364341 3300054114 Bacteria 1221
609 Ga0501084_0629458 3300054114 Bacteria 906
610 Ga0587077_092344 3300059493 Bacteria 714
611 Ga0587082_070715 3300059504 Bacteria 708
612 Ga0587091_096821 3300059511 Bacteria 686
613 Ga0501082_0021928 3300060353 Bacteria 5506
614 Ga0501082_0041150 3300060353 Bacteria 3984
615 Ga0501082_0331863 3300060353 Bacteria 1325
616 Ga0501082_0412656 3300060353 Bacteria 1179
617 Ga0501082_0775645 3300060353 Bacteria 839
618 Ga0501082_0919170 3300060353 Bacteria 765
619 Ga0466962_0011797 3300061719 Bacteria 4208
620 Ga0466962_0119682 3300061719 Bacteria 1270
621 Ga0530510_0086659 3300061734 Bacteria 2282
622 Ga0530510_0100948 3300061734 Bacteria 2110
623 Ga0530510_0237165 3300061734 Bacteria 1357
624 2643893472 2643221576 Bacteria 5214352
625 2643962522 2643221590 Bacteria 5214697
626 2644035478 2643221604 Bacteria 5014917
627 2644089194 2643221615 Bacteria 5487866
628 2644101711 2643221617 Bacteria 5139111
629 2644115773 2643221620 Bacteria 5134593
630 2644230463 2643221641 Bacteria 4490190
631 2644319039 2643221657 Bacteria 5490246
632 2644456979 2643221681 Bacteria 3707866
633 2644609741 2643221711 Bacteria 4865335
634 2645719717 2643221961 Bacteria 3919167
635 2645726605 2643221962 Bacteria 3874254
636 2738868453 2738541305 Bacteria 4910150
637 2740168870 2739367898 Bacteria 4367674
638 2774392740 2773857762 Bacteria 5971770
639 2809196540 2808606439 Bacteria 5952208
640 2812332918 2811994874 Bacteria 5367947
641 2812351308 2811994878 Bacteria 5992952
642 2816425555 2816332119 Bacteria 8120218
643 2855387314 2855386786 Bacteria 4752232
644 2857482167 2857481737 Bacteria 4761446
645 2873319998 2873314349 Bacteria 8512634
646 2891971079 2891968417 Bacteria 5821697
647 2984580186 2984576629 Bacteria 4248407
648 2984594845 2984592036 Bacteria 3670284
649 2990259036 2990256926 Bacteria 4252839
650 8054611323 8054609563 Bacteria 5170090
651 8055066080 8055066027 Bacteria 9479577
652 Ga0501083_0020870
653 LJQas_1003731
654 JGI24740J21852_10024066
655 JGI24739J22299_10008156
656 JGI24737J22298_10008836
657 JGI24735J21928_10027133
658 JGI24735J21928_10043611
659 JGI25407J50210_10022274
660 Ga0006562J51391_1050600
661 Ga0006562J51391_1050602
662 Ga0058862_12652283
663 Ga0070683_100003740
664 Ga0070683_100074850
665 Ga0070683_100119383
666 Ga0070683_100231775
667 Ga0070683_100435434
668 Ga0070682_100025384
669 Ga0070682_100072157
670 Ga0070682_100253115
671 Ga0068868_100316386
672 Ga0070660_100011867
673 Ga0070660_100162212
674 Ga0070689_100301495
675 Ga0070692_10184768
676 Ga0070692_10352561
677 Ga0070668_100201306
678 Ga0070674_100628427
679 Ga0070659_100008263
680 Ga0070659_100166845
681 Ga0070667_100307718
682 Ga0070667_100922706
683 Ga0070714_100005337
684 Ga0070713_100070762
685 Ga0070701_10512628
686 Ga0070700_100247387
687 Ga0070663_100172459
688 Ga0070678_100695316
689 Ga0070662_100049420
690 Ga0070681_10122084
691 Ga0068867_100622443
692 Ga0070698_100006744
693 Ga0070679_100014118
694 Ga0070684_100003215
695 Ga0070684_100093938
696 Ga0070684_100103686
697 Ga0070684_100108037
698 Ga0070684_100521094
699 Ga0070672_100261385
700 Ga0070665_100000718
701 Ga0070665_101220385
702 Ga0068855_100166448
703 Ga0068855_100512877
704 Ga0070664_100842084
705 Ga0068857_100033027
706 Ga0068857_100055612
707 Ga0068857_100293425
708 Ga0068856_100023421
709 Ga0068856_100322966
710 Ga0068856_100558796
711 Ga0068856_100633197
712 Ga0070702_100020628
713 Ga0068852_100375884
714 Ga0068852_100742075
715 Ga0068852_100754076
716 Ga0068864_100043411
717 Ga0068866_10471802
718 Ga0068861_100280875
719 Ga0068861_100377605
720 Ga0068858_100059911
721 Ga0068860_100000795
722 Ga0081455_10002473
723 Ga0081455_10008841
724 Ga0081455_10030284
725 Ga0081455_10094549
726 Ga0081538_10000036
727 Ga0081538_10020962
728 Ga0075365_10031881
729 Ga0075365_10032136
730 Ga0075365_10064813
731 Ga0075365_10065898
732 Ga0075365_10084937
733 Ga0075365_10156267
734 Ga0075365_10212788
735 Ga0075365_10217728
736 Ga0075365_10256019
737 Ga0075365_10266244
738 Ga0075365_10413257
739 Ga0075365_10510682
740 Ga0075368_10000651
741 Ga0075368_10000759
742 Ga0075368_10110381
743 Ga0075363_100008166
744 Ga0075363_100073334
745 Ga0075363_100166080
746 Ga0075363_100393527
747 Ga0075364_10015661
748 Ga0075364_10048931
749 Ga0075364_10167762
750 Ga0075364_10252190
751 Ga0075364_10484613
752 Ga0070712_100163138
753 Ga0075362_10100951
754 Ga0075367_10016017
755 Ga0075367_10076401
756 Ga0075367_10093513
757 Ga0075367_10126344
758 Ga0075367_10152289
759 Ga0075369_10116084
760 Ga0097621_100152868
761 Ga0097621_100386406
762 Ga0075370_10008207
763 Ga0075370_10024266
764 Ga0075370_10482815
765 Ga0075428_100001304
766 Ga0075428_100018522
767 Ga0075430_100006263
768 Ga0075431_100005941
769 Ga0075431_100008250
770 Ga0075431_100012367
771 Ga0075434_100890735
772 Ga0075429_100001324
773 Ga0075429_100005562
774 Ga0068865_100053158
775 Ga0068865_100194027
776 Ga0068865_100458910
777 Ga0105245_10030002
778 Ga0105245_10467629
779 Ga0105245_10897724
780 Ga0114129_10005577
781 Ga0114129_10334294
782 Ga0105243_10091798
783 Ga0105243_10816057
784 Ga0105242_10340246
785 Ga0105242_10387425
786 Ga0105242_11386923
787 Ga0105248_10526386
788 Ga0105237_10076087
789 Ga0105237_10377184
790 Ga0105237_10414944
791 Ga0105237_10799357
792 Ga0105238_10232288
793 Ga0105249_10176113
794 Ga0105249_10736884
795 Ga0105239_10007348
796 Ga0105239_10043400
797 Ga0105246_10094437
798 Ga0105246_10275888
799 Ga0105246_10814700
800 Ga0157318_1008524
801 Ga0157370_10684822
802 Ga0163162_10018511
803 Ga0157372_10007692
804 Ga0157372_10570005
805 Ga0157372_10706639
806 Ga0157372_11014759
807 Ga0163163_10184891
808 Ga0163163_10302785
809 Ga0163163_10417360
810 Ga0157380_10232072
811 Ga0182008_10074703
812 Ga0182008_10086116
813 Ga0157377_10072866
814 Ga0157377_10399493
815 Ga0182006_1202842
816 Ga0163161_10093911
817 Ga0163161_10304698
818 Ga0197907_10065901
819 Ga0197907_10248495
820 Ga0197907_10744107
821 Ga0206349_1753929
822 Ga0206351_10862294
823 Ga0206351_10876275
824 Ga0206352_10249820
825 Ga0206350_10362717
826 Ga0206350_10529565
827 Ga0206350_11029862
828 Ga0206350_11314634
829 Ga0206354_10987867
830 Ga0206354_11720080
831 Ga0206353_10193799
832 Ga0206353_10445806
833 Ga0206353_10770605
834 Ga0206353_11162229
835 Ga0224712_10029028
836 Ga0224712_10060181
837 Ga0207642_10286585
838 Ga0207647_10108457
839 Ga0207647_10124994
840 Ga0207643_10104365
841 Ga0207705_10159576
842 Ga0207705_10273384
843 Ga0207707_10713873
844 Ga0207671_10166077
845 Ga0207671_10599599
846 Ga0207693_10195969
847 Ga0207657_10015319
848 Ga0207657_10045545
849 Ga0207657_10104445
850 Ga0207652_10045754
851 Ga0207687_10023055
852 Ga0207687_10519515
853 Ga0207700_10060662
854 Ga0207664_10004124
855 Ga0207690_10012748
856 Ga0207690_10076392
857 Ga0207690_10465059
858 Ga0207690_10511179
859 Ga0207709_10766383
860 Ga0207704_10108866
861 Ga0207704_10384721
862 Ga0207691_10128940
863 Ga0207661_10094156
864 Ga0207661_10331391
865 Ga0207661_10420201
866 Ga0207679_10368361
867 Ga0207667_10086092
868 Ga0207667_10529841
869 Ga0207668_10290896
870 Ga0207658_10710672
871 Ga0207677_10121398
872 Ga0207677_10201621
873 Ga0207703_10031783
874 Ga0207678_10078899
875 Ga0207678_10414918
876 Ga0207678_10661122
877 Ga0207708_10095591
878 Ga0207702_10062128
879 Ga0207702_10137949
880 Ga0207702_10163106
881 Ga0207702_10334151
882 Ga0207648_10577247
883 Ga0207676_10015967
884 Ga0207674_10008329
885 Ga0207674_10026516
886 Ga0207674_10263124
887 Ga0207674_10385830
888 Ga0207675_100487453
889 Ga0207675_100621618
890 Ga0207698_10208937
891 Ga0209813_10041175
892 Ga0209813_10048606
893 Ga0209813_10130699
894 Ga0207428_10002497
895 Ga0207428_10063797
896 Ga0268266_10001282
897 Ga0268266_10558861
898 Ga0268265_10252949
899 Ga0268265_10404403
900 Ga0268264_10395811
901 Ga0316182_1448023
902 Ga0307508_10207708
903 Ga0307405_10087831
904 Ga0307413_10023910
905 Ga0307413_10137167
906 Ga0307410_10024462
907 Ga0307410_10138671
908 Ga0307406_10008723
909 Ga0307407_10108680
910 Ga0307407_10186959
911 Ga0307407_10323950
912 Ga0307407_10420183
913 Ga0307412_10403692
914 Ga0307409_100011064
915 Ga0307409_100026236
916 Ga0307409_100029113
917 Ga0307409_100032879
918 Ga0307409_100534273
919 Ga0307409_101084422
920 Ga0307409_101327462
921 Ga0307416_100001535
922 Ga0307416_100114735
923 Ga0307416_100390019
924 Ga0307416_100752172
925 Ga0307416_101080769
926 Ga0307414_10132737
927 Ga0307414_10720906
928 Ga0307414_10919158
929 Ga0307411_10644809
930 Ga0307415_100000465
931 Ga0307415_100048248
932 Ga0307415_100055185
933 Ga0307415_100191196
934 Ga0307415_100497243
935 Ga0307415_101223437
936 Ga0373951_0095391
937 Ga0395899_0110088
938 Ga0395900_0184133
939 Ga0395900_0365605
940 Ga0395898_0506280
941 Ga0395905_0046796
942 Ga0436364_0879964
943 Ga0395901_0133003
944 Ga0395901_0799229
945 Ga0436360_0772751
946 Ga0439465_0016986
947 Ga0439465_0031090
948 Ga0451833_0134092
949 Ga0451833_0146647
950 Ga0451833_0592120
951 Ga0451837_0003726
952 Ga0451839_1035743
953 Ga0451853_1057058
954 Ga0451853_2374902
955 Ga0451853_3299735
956 Ga0439431_0009456
957 Ga0439431_0070108
958 Ga0439445_0004717
959 Ga0439445_0024862
960 Ga0439432_081351
961 Ga0439449_0090825
962 Ga0439446_0004746
963 Ga0439434_0011486
964 Ga0439434_0012802
965 Ga0439434_0136034
966 Ga0439464_0030151
967 Ga0466969_0077935
968 Ga0466972_0002214
969 Ga0466972_0046852
970 Ga0466972_0145681
971 Ga0466972_0231069
972 Ga0466965_0020176
973 Ga0466965_0042954
974 Ga0466965_0164162
975 Ga0466965_0303765
976 Ga0466966_0002073
977 Ga0466961_0021468
978 Ga0466963_0000954
979 Ga0466963_0024025
980 Ga0466963_0064596
981 Ga0466963_0225129
982 Ga0466963_0318635
983 Ga0466964_0207092
984 Ga0466971_0005350
985 Ga0466971_0043121
986 Ga0466971_0076470
987 Ga0466968_0028294
988 Ga0466968_0257346
989 Ga0466970_0004978
990 Ga0466970_0014684
991 Ga0466970_0025594
992 Ga0466970_0080583
993 Ga0466970_0124192
994 Ga0466970_0255213
995 Ga0466970_0278956
996 Ga0466970_0379498
997 Ga0466957_0067880
998 Ga0466957_0271270
999 Ga0466960_0008169
1000 Ga0466960_0072768
1001 Ga0466960_0102482
1002 Ga0466960_0156558
1003 Ga0466960_0223382
1004 Ga0466960_0374746
1005 Ga0466959_0044099
1006 Ga0466959_0156306
1007 Ga0466959_0323594
1008 Ga0466967_0001480
1009 Ga0466967_0026752
1010 Ga0466967_0027395
1011 Ga0466967_0033913
1012 Ga0466967_0044313
1013 Ga0466967_0162319
1014 Ga0466967_0287850
1015 Ga0466967_0291867
1016 Ga0466967_0335570
1017 Ga0466967_0391882
1018 Ga0466967_0705762
1019 Ga0495627_043083
1020 Ga0495630_0369157
1021 Ga0495635_0401429
1022 Ga0495624_0453977
1023 Ga0495649_0355987
1024 Ga0495600_0215736
1025 Ga0495581_0075245
1026 Ga0496100_0249389
1027 Ga0496100_0486540
1028 Ga0496101_0136594
1029 Ga0496102_0022378
1030 Ga0496102_0035621
1031 Ga0496102_0102588
1032 Ga0496102_0448933
1033 Ga0496103_0127528
1034 Ga0496103_0139888
1035 Ga0496103_0223947
1036 Ga0496104_0747006
1037 Ga0496105_0121474
1038 Ga0496106_0019110
1039 Ga0496106_0023995
1040 Ga0496107_0041937
1041 Ga0496108_0004318
1042 Ga0496108_0142909
1043 Ga0496108_0222238
1044 Ga0496108_0610218
1045 Ga0496109_0043342
1046 Ga0496109_0139415
1047 Ga0496109_0640982
1048 Ga0496109_0648846
1049 Ga0496110_0002633
1050 Ga0496110_0046611
1051 Ga0496110_0124378
1052 Ga0496110_0204196
1053 Ga0496111_0001296
1054 Ga0496111_0195009
1055 Ga0496112_0110054
1056 Ga0496112_0516588
1057 Ga0496114_0061011
1058 Ga0496114_0093556
1059 Ga0496114_0095344
1060 Ga0496114_0116564
1061 Ga0496114_0213313
1062 Ga0496114_0301861
1063 Ga0496114_0414614
1064 Ga0496114_0457082
1065 Ga0496123_0037516
1066 Ga0496124_0068545
1067 Ga0496126_0540812
1068 Ga0501031_0018376
1069 Ga0501031_0061422
1070 Ga0501031_0073255
1071 Ga0501031_0112484
1072 Ga0501031_0297567
1073 Ga0501031_0343369
1074 Ga0501032_0145527
1075 Ga0501033_0002738
1076 Ga0501033_0137487
1077 Ga0501034_0003420
1078 Ga0501034_0009364
1079 Ga0501034_0041305
1080 Ga0501034_0065126
1081 Ga0501034_0220200
1082 Ga0501036_0022050
1083 Ga0501036_0063225
1084 Ga0501036_0095534
1085 Ga0501036_0207058
1086 Ga0501036_0256933
1087 Ga0501036_0268815
1088 Ga0501037_0002685
1089 Ga0501037_0059501
1090 Ga0501037_0122570
1091 Ga0501037_0146437
1092 Ga0501037_0307026
1093 Ga0501038_0008939
1094 Ga0501038_0106431
1095 Ga0501038_0334261
1096 Ga0501039_0003723
1097 Ga0501039_0019805
1098 Ga0501039_0031977
1099 Ga0501039_0108252
1100 Ga0501039_0236017
1101 Ga0501039_0429867
1102 Ga0501040_0015306
1103 Ga0501040_0087395
1104 Ga0501041_0008092
1105 Ga0501041_0046586
1106 Ga0501041_0137536
1107 Ga0501041_0163769
1108 Ga0501042_0005584
1109 Ga0501042_0030049
1110 Ga0501042_0042004
1111 Ga0501042_0113731
1112 Ga0501042_0163977
1113 Ga0501042_0179673
1114 Ga0501043_0012296
1115 Ga0501043_0015277
1116 Ga0501043_0203455
1117 Ga0501043_0417909
1118 Ga0501046_0001565
1119 Ga0501046_0005428
1120 Ga0501046_0092828
1121 Ga0501047_0024486
1122 Ga0501047_0045310
1123 Ga0501047_0590957
1124 Ga0501047_0624514
1125 Ga0501048_0009344
1126 Ga0501048_0016709
1127 Ga0501048_0109316
1128 Ga0501048_0165290
1129 Ga0501067_0001120
1130 Ga0501067_0001382
1131 Ga0501067_0014065
1132 Ga0501067_0083831
1133 Ga0501067_0084124
1134 Ga0501067_0353025
1135 Ga0501068_0001745
1136 Ga0501068_0023545
1137 Ga0501068_0038296
1138 Ga0501068_0061218
1139 Ga0501069_0210357
1140 Ga0501069_0412920
1141 Ga0501070_0001013
1142 Ga0501070_0015547
1143 Ga0501070_0021607
1144 Ga0501070_0062168
1145 Ga0501070_0064022
1146 Ga0501070_0144844
1147 Ga0501070_0274095
1148 Ga0501070_0322823
1149 Ga0501070_0706348
1150 Ga0501071_0001200
1151 Ga0501071_0003370
1152 Ga0501071_0035796
1153 Ga0501071_0090031
1154 Ga0501071_0090630
1155 Ga0501071_0258757
1156 Ga0501071_0439582
1157 Ga0501072_0005237
1158 Ga0501072_0009652
1159 Ga0501072_0013040
1160 Ga0501072_0086600
1161 Ga0501072_0108359
1162 Ga0501072_0680679
1163 Ga0501073_0001891
1164 Ga0501073_0012139
1165 Ga0501073_0028226
1166 Ga0501074_0000418
1167 Ga0501074_0001793
1168 Ga0501074_0030618
1169 Ga0501074_0036185
1170 Ga0501074_0067315
1171 Ga0501075_0031735
1172 Ga0501075_0151238
1173 Ga0501075_0176292
1174 Ga0501076_0009331
1175 Ga0501076_0036315
1176 Ga0501076_0453357
1177 Ga0501077_0120113
1178 Ga0501077_0144610
1179 Ga0501079_0002456
1180 Ga0501079_0006491
1181 Ga0501079_0016089
1182 Ga0501079_0413504
1183 Ga0501080_0019863
1184 Ga0501080_0049943
1185 Ga0501081_0043743
1186 Ga0501081_0083119
1187 Ga0501081_0253423
1188 Ga0501083_0001662
1189 Ga0501083_0101244
1190 Ga0501083_0366360
1191 Ga0501035_0115490
1192 Ga0501035_0197548
1193 Ga0501035_0339215
1194 Ga0501044_0049433
1195 Ga0501044_0177412
1196 Ga0501044_0388769
1197 Ga0501045_0023480
1198 Ga0501045_0035738
1199 Ga0501045_0149430
1200 Ga0501045_0166986
1201 Ga0501045_0409960
1202 nmdc:mga03n38_225245_c1
1203 nmdc:mga03n38_48099_c1
1204 nmdc:mga03n38_71215_c1
1205 nmdc:mga00v17_130334_c1
1206 nmdc:mga00v17_134216_c1
1207 nmdc:mga00v17_185951_c1
1208 nmdc:mga00v17_259731_c1
1209 nmdc:mga00v17_292452_c1
1210 nmdc:mga00v17_3307_c2
1211 nmdc:mga0yw44_12417_c1
1212 nmdc:mga0yw44_13212_c1
1213 nmdc:mga0yw44_307386_c1
1214 nmdc:mga0yw44_3266_c1
1215 nmdc:mga0yw44_335316_c1
1216 nmdc:mga0yw44_475816_c1
1217 nmdc:mga0yw44_60139_c1
1218 nmdc:mga0yw44_73941_c1
1219 nmdc:mga0yw44_87157_c1
1220 nmdc:mga0yw44_9816_c1
1221 nmdc:mga06z11_100912_c1
1222 nmdc:mga06z11_105290_c1
1223 nmdc:mga06z11_38699_c1
1224 nmdc:mga04h51_11516_c1
1225 nmdc:mga04h51_56431_c1
1226 nmdc:mga04h51_5683_c1
1227 nmdc:mga07m45_25281_c1
1228 nmdc:mga07m45_411813_c1
1229 nmdc:mga07m45_477578_c1
1230 nmdc:mga07m45_50818_c1
1231 nmdc:mga07m45_52629_c1
1232 nmdc:mga05p37_24408_c1
1233 nmdc:mga05p37_440_c1
1234 nmdc:mga09592_242576_c1
1235 nmdc:mga09592_278_c1
1236 nmdc:mga09592_861389_c1
1237 nmdc:mga0qj67_228450_c1
1238 nmdc:mga0qj67_2876_c1
1239 nmdc:mga06r32_153455_c1
1240 nmdc:mga06r32_4205_c1
1241 nmdc:mga06r32_434_c1
1242 nmdc:mga08y16_35992_c1
1243 nmdc:mga08y16_780046_c1
1244 nmdc:mga08y16_9696_c1
1245 nmdc:mga0n895_691812_c1
1246 nmdc:mga0sz30_8758_c1
1247 Ga0495601_0048827
1248 Ga0495612_0084608
1249 Ga0495655_0063804
1250 Ga0495619_0384202
1251 Ga0500644_0000011
1252 Ga0500641_0003416
1253 Ga0500556_0003615
1254 Ga0500593_000249
1255 Ga0500573_0019858
1256 Ga0501084_0013682
1257 Ga0501084_0029488
1258 Ga0501084_0076260
1259 Ga0501084_0364341
1260 Ga0501084_0629458
1261 Ga0587077_092344
1262 Ga0587082_070715
1263 Ga0587091_096821
1264 Ga0501082_0021928
1265 Ga0501082_0041150
1266 Ga0501082_0331863
1267 Ga0501082_0412656
1268 Ga0501082_0775645
1269 Ga0501082_0919170
1270 Ga0466962_0011797
1271 Ga0466962_0119682
1272 Ga0530510_0086659
1273 Ga0530510_0100948
1274 Ga0530510_0237165
1275 2643893472
1276 2643962522
1277 2644035478
1278 2644089194
1279 2644101711
1280 2644115773
1281 2644230463
1282 2644319039
1283 2644456979
1284 2644609741
1285 2645719717
1286 2645726605
1287 2738868453
1288 2740168870
1289 2774392740
1290 2809196540
1291 2812332918
1292 2812351308
1293 2816425555
1294 2855387314
1295 2857482167
1296 2873319998
1297 2891971079
1298 2984580186
1299 2984594845
1300 2990259036
1301 8054611323
1302 8055066080

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13411

MerR_1

MerR HTH family regulatory protein

67

139

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
6jni-assembly2.cif.gz_D crystal structure of the transcriptional regulator cadr from p. putida in complex with zinc(ii) and dna 0.8907 41 111
7tea-assembly2.cif.gz_C crystal structure of s. aureus glnr-dna complex 0.8803 39 111
3qao-assembly1.cif.gz_A-2 the crystal structure of the n-terminal domain of a merr-like transcriptional regulator from listeria monocytogenes egd-e 0.8712 40 108
2dg6-assembly1.cif.gz_A-2 crystal structure of the putative transcriptional regulator sco5550 from streptomyces coelicolor a3(2) 0.8586 41 112
4r24-assembly1.cif.gz_B complete dissection of b. subtilis nitrogen homeostatic circuitry 0.8364 37 116
ID Description Score Start End Superfamily
af_P33358_1_73_1.10.1660.10 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.8802 40 113 1.10.1660.10
af_O06302_4_79_1.10.1660.10 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.876 40 107 1.10.1660.10
3qaoA00 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.8577 44 108 1.10.1660.10
3hh0C01 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.8508 40 113 1.10.1660.10
af_P33358_1_73_1.10.1660.10 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.8473 40 113 1.10.1660.10
ID Description Score Start End GO Terms
AF-A0A6N8KTY5-F1-model_v4 MerR family transcriptional regulator 0.9032 41 115 GO:0003677
GO:0003700
AF-A0A4V5KJQ0-F1-model_v4 MerR family transcriptional regulator 0.9015 38 111 GO:0003677
GO:0003700
AF-A0A7X1L7F5-F1-model_v4 MerR family transcriptional regulator 0.9006 40 112 GO:0003677
GO:0003700
AF-A0A2T2WUV0-F1-model_v4 MerR family transcriptional regulator 0.8852 40 172 GO:0003677
GO:0003700
AF-A0A7C1P3L5-F1-model_v4 MerR family transcriptional regulator 0.8829 40 170 GO:0003677
GO:0003700

Map