F472635

General Info

Members Datasets Scaffolds Average Seq Length
651 356 594 284

Family's Representative Sequence

Representative Sequence 3300049568|Ga0501031_0015138|Ga0501031_0015138_2401_3408
Length 335
Sequence VQTVALLGPAEIRELAERAGVRPTKTLGQNFVLDAGTVRKIVRQADVEPGDRVVEVGPGLGSLTLGLLEAGADVVAVEIDPVLARLLPETVTRHVPGLTIAGDEPEPAGPDGAPVVVLRDADGRDRLTVVTSDALDVRALPGRPPEALVANLPYNVSVPVLLTFLERFDSLARVLVMVQAEVADRLAAPPGSRTYGVPSVKAAWYASARRTATVGRSVFWPAPNVDSALVRLDRRPTPVTTVSREDVFAVVDSAFAQRRKMLRSALAPLAGSADAAERALVAAGVDPQARGERVDVDGFARVAEALAAAGIAASPRPADVPAEEPGGGGPGRVAP

Samples

Sample ID Description Type Environment
1 2554235227 Arthrobacter sp. PAO19 Isolate Rhizosphere
2 2643221613 Oerskovia sp. Root22 Isolate Unclassified
3 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
4 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
5 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
6 2643221697 Aeromicrobium sp. Root495 Isolate Unclassified
7 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
8 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
9 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
10 2654587600 Glutamicibacter halophytocola KLBMP5180 Isolate Unclassified
11 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
12 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
13 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
14 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
15 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
16 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
17 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
18 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
19 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
20 2808606700 Arthrobacter agilis UMCV2 Isolate Rhizosphere
21 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
22 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
23 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
24 2811994880 Cellulomonas sp. SLBN-39 Isolate Unclassified
25 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
26 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
27 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
28 2848551377 Brachybacterium saurashtrense DSM 23186 Isolate Unclassified
29 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
30 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
31 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
32 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
33 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
34 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
35 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
36 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
37 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
38 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
39 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
40 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
41 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
42 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
43 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
44 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
45 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
46 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
47 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
48 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
49 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
50 2946003308 Arthrobacter agilis W3I6 Isolate Rhizosphere
51 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
52 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
53 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
54 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
55 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
56 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
57 3300003285 Grassland soil microbial communities from Hopland, California, USA - Sample H3_Rhizo_39 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
58 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
59 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
60 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
61 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
62 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
63 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
64 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
65 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
66 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
67 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
68 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
69 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
70 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
71 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
72 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
73 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
74 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
75 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
76 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
77 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
78 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
79 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
80 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
81 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
82 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
83 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
84 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
85 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
86 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
87 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
88 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
89 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
90 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
91 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
92 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
93 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
94 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
95 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
96 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
97 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
98 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
99 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
100 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
101 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
102 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
103 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
104 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
105 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
106 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
107 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
108 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
109 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
110 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
111 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
112 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
113 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
114 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
115 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
116 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
117 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
118 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
119 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
120 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
121 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
122 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
123 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
124 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
125 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
126 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
127 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
128 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
129 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
130 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
131 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
132 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
133 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
134 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
135 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
136 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
137 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
138 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
139 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
142 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
143 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
185 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
187 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
188 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
189 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
190 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
191 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
192 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
193 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
194 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
195 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
196 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
197 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
198 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
199 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
200 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
201 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
202 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
203 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
204 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
205 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
206 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
207 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
208 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
209 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
210 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
211 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
212 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
213 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
214 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
215 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
216 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
217 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
218 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
219 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
220 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
221 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
222 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
223 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
224 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
225 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
226 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
227 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
228 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
229 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
230 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
231 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
232 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
233 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
234 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
235 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
236 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
237 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
238 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
239 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
240 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
241 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
242 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
243 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
244 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
245 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
246 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
247 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
248 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
249 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
250 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
251 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
252 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
253 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
254 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
255 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
256 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
257 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
258 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
259 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
260 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
261 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
262 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
263 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
264 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
265 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
266 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
267 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
268 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
269 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
270 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
271 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
272 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
273 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
274 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
275 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
276 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
277 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
278 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
279 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
280 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
281 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
282 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
283 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
284 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
285 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
286 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
287 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
288 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
289 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
290 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
291 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
292 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
293 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
294 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
295 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
296 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
297 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
298 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
300 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
301 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
302 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
303 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
309 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
310 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
311 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
312 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
313 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
314 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
315 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
316 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
317 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
318 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
319 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
320 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
321 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
322 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
323 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
324 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
325 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
326 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
327 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
328 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
329 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
330 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
331 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
332 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
333 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
334 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
335 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
336 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
337 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
338 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
339 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
340 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
341 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
342 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
343 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
344 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
345 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
346 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
347 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
348 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
349 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
350 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
351 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
352 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
353 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
354 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere
355 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere
356 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 90.02
Metatranscriptomes 1.23
Isolates 8.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.22
Nodule 0
Rhizoplane 7.37
Rhizosphere 78.96
Stem 0
Stem Tuber 0
Unclassified 8.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10019648 3300001979 Bacteria 2375
2 JGI25152J39213_1000574 3300002773 Bacteria 19978
3 Ga0007423J48922_100316 3300003285 Bacteria 7621
4 Ga0006562J51391_1031829 3300003578 Bacteria 7110
5 Ga0006562J51391_1099017 3300003578 Bacteria 1520
6 Ga0055539_1000005 3300003752 Bacteria 609598
7 Ga0055542_1012322 3300003762 Bacteria 1482
8 Ga0070658_10000294 3300005327 Bacteria 43582
9 Ga0070658_10005814 3300005327 Bacteria 9994
10 Ga0070658_10039126 3300005327 Bacteria 3825
11 Ga0070658_10154370 3300005327 Bacteria 1924
12 Ga0070670_100137032 3300005331 Bacteria 2115
13 Ga0068869_100011503 3300005334 Bacteria 5805
14 Ga0070666_10019310 3300005335 Bacteria 4397
15 Ga0070666_10032696 3300005335 Bacteria 3437
16 Ga0070680_100306881 3300005336 Bacteria 1346
17 Ga0070682_100030642 3300005337 Bacteria 3249
18 Ga0070682_100107924 3300005337 Bacteria 1850
19 Ga0068868_100003538 3300005338 Bacteria 10886
20 Ga0068868_100073895 3300005338 Bacteria 2722
21 Ga0070660_100047943 3300005339 Bacteria 3280
22 Ga0070660_100143210 3300005339 Bacteria 1919
23 Ga0070660_100149931 3300005339 Bacteria 1875
24 Ga0070660_100301230 3300005339 Bacteria 1314
25 Ga0070692_10011261 3300005345 Bacteria 4101
26 Ga0070668_100107076 3300005347 Bacteria 2222
27 Ga0070669_100011447 3300005353 Bacteria 6297
28 Ga0070669_100074264 3300005353 Bacteria 2521
29 Ga0070675_100003497 3300005354 Bacteria 11915
30 Ga0070675_100232115 3300005354 Bacteria 1610
31 Ga0070659_100011867 3300005366 Bacteria 6449
32 Ga0070659_100015801 3300005366 Bacteria 5658
33 Ga0070659_100164258 3300005366 Bacteria 1816
34 Ga0070659_100256620 3300005366 Bacteria 1450
35 Ga0070703_10022665 3300005406 Bacteria 1845
36 Ga0070713_100614065 3300005436 Bacteria 1034
37 Ga0070700_100292710 3300005441 Bacteria 1185
38 Ga0070694_100067911 3300005444 Bacteria 2448
39 Ga0070708_100001304 3300005445 Bacteria 19131
40 Ga0070708_100142600 3300005445 Bacteria 2223
41 Ga0068867_100112578 3300005459 Bacteria 2093
42 Ga0070706_100160674 3300005467 Bacteria 2098
43 Ga0070706_100224912 3300005467 Bacteria 1752
44 Ga0070706_100418274 3300005467 Bacteria 1247
45 Ga0070707_100006788 3300005468 Bacteria 10596
46 Ga0070707_100112882 3300005468 Bacteria 2636
47 Ga0070698_100013237 3300005471 Bacteria 8728
48 Ga0070699_100042834 3300005518 Bacteria 3917
49 Ga0070679_100161887 3300005530 Bacteria 2212
50 Ga0070686_100168400 3300005544 Bacteria 1548
51 Ga0070695_100043453 3300005545 Bacteria 2857
52 Ga0070696_100046797 3300005546 Bacteria 3000
53 Ga0070693_100117289 3300005547 Bacteria 1646
54 Ga0070665_100014657 3300005548 Bacteria 7867
55 Ga0070665_100177716 3300005548 Bacteria 2129
56 Ga0068855_100108197 3300005563 Bacteria 3193
57 Ga0068855_100117728 3300005563 Bacteria 3043
58 Ga0068857_100000679 3300005577 Bacteria 25267
59 Ga0068857_100155919 3300005577 Bacteria 2070
60 Ga0068856_100196052 3300005614 Bacteria 2034
61 Ga0070702_100005004 3300005615 Bacteria 6121
62 Ga0068852_100018937 3300005616 Bacteria 5437
63 Ga0068852_100026596 3300005616 Bacteria 4706
64 Ga0068859_100220569 3300005617 Bacteria 1984
65 Ga0068864_100165063 3300005618 Bacteria 2015
66 Ga0068861_100372655 3300005719 Bacteria 1259
67 Ga0068851_10000043 3300005834 Bacteria 87775
68 Ga0068863_100200201 3300005841 Bacteria 1921
69 Ga0068858_100051879 3300005842 Bacteria 3795
70 Ga0068862_100096755 3300005844 Bacteria 2577
71 Ga0081539_10000015 3300005985 Bacteria 395781
72 Ga0075365_10005224 3300006038 Bacteria 6984
73 Ga0075368_10090537 3300006042 Bacteria 1251
74 Ga0075364_10010750 3300006051 Bacteria 5538
75 Ga0075364_10028857 3300006051 Bacteria 3554
76 Ga0075432_10000977 3300006058 Bacteria 9031
77 Ga0075432_10003439 3300006058 Bacteria 5359
78 Ga0075367_10015307 3300006178 Bacteria 4165
79 Ga0097621_100045271 3300006237 Bacteria 3553
80 Ga0075370_10013844 3300006353 Bacteria 4292
81 Ga0075370_10075457 3300006353 Bacteria 1933
82 Ga0068871_100069945 3300006358 Bacteria 2884
83 Ga0075428_100000791 3300006844 Bacteria 32968
84 Ga0075433_10072382 3300006852 Bacteria 3030
85 Ga0097620_100220577 3300006931 Bacteria 1984
86 Ga0105251_10009132 3300009011 Bacteria 5895
87 Ga0105244_10003037 3300009036 Bacteria 12319
88 Ga0105244_10182356 3300009036 Bacteria 995
89 Ga0105240_10072773 3300009093 Bacteria 4247
90 Ga0105240_10079439 3300009093 Bacteria 4036
91 Ga0111539_10845254 3300009094 Bacteria 1065
92 Ga0105245_10003821 3300009098 Bacteria 13388
93 Ga0105245_10031931 3300009098 Bacteria 4662
94 Ga0105245_10139913 3300009098 Bacteria 2278
95 Ga0105245_10155757 3300009098 Bacteria 2164
96 Ga0105247_10011158 3300009101 Bacteria 5417
97 Ga0105243_10025612 3300009148 Bacteria 4509
98 Ga0105241_10000427 3300009174 Bacteria 31803
99 Ga0105241_10032180 3300009174 Bacteria 3930
100 Ga0105241_10156890 3300009174 Bacteria 1867
101 Ga0105242_10013233 3300009176 Bacteria 6370
102 Ga0105248_10000796 3300009177 Bacteria 35389
103 Ga0105237_10307351 3300009545 Bacteria 1588
104 Ga0105238_10000990 3300009551 Bacteria 29030
105 Ga0105249_10007621 3300009553 Bacteria 9443
106 Ga0105239_10294439 3300010375 Bacteria 1828
107 Ga0105246_10004339 3300011119 Bacteria 8627
108 Ga0105246_10004787 3300011119 Bacteria 8241
109 Ga0105246_10010371 3300011119 Bacteria 5764
110 Ga0105246_10063634 3300011119 Bacteria 2573
111 Ga0157373_10058774 3300013100 Bacteria 2725
112 Ga0157370_10059863 3300013104 Bacteria 3618
113 Ga0157369_10050315 3300013105 Bacteria 4513
114 Ga0157369_10057551 3300013105 Bacteria 4194
115 Ga0157369_10069146 3300013105 Bacteria 3794
116 Ga0157369_10072394 3300013105 Bacteria 3699
117 Ga0157369_10234635 3300013105 Bacteria 1917
118 Ga0157369_10485482 3300013105 Bacteria 1279
119 Ga0157375_10070964 3300013308 Bacteria 3495
120 Ga0157375_10383042 3300013308 Bacteria 1573
121 Ga0157375_10427317 3300013308 Bacteria 1491
122 Ga0163163_10025760 3300014325 Bacteria 5610
123 Ga0163163_10103726 3300014325 Bacteria 2868
124 Ga0157380_10312073 3300014326 Bacteria 1454
125 Ga0157376_10450498 3300014969 Bacteria 1255
126 Ga0163161_10357160 3300017792 Bacteria 1163
127 Ga0206353_10786700 3300020082 Bacteria 2130
128 Ga0224572_1001011 3300024225 Bacteria 3892
129 Ga0209563_106795 3300025230 Bacteria 1935
130 Ga0209148_1001364 3300025254 Bacteria 12744
131 Ga0209148_1009645 3300025254 Bacteria 1868
132 Ga0209129_1000059 3300025258 Bacteria 250603
133 Ga0209025_1000398 3300025294 Bacteria 89204
134 Ga0209051_1026483 3300025303 Bacteria 2336
135 Ga0207697_10004756 3300025315 Bacteria 6423
136 Ga0207656_10000001 3300025321 Bacteria 1323684
137 Ga0207656_10000003 3300025321 Bacteria 771644
138 Ga0207656_10000004 3300025321 Bacteria 632320
139 Ga0207655_1006307 3300025728 Bacteria 7883
140 Ga0207655_1012056 3300025728 Bacteria 5084
141 Ga0207688_10001644 3300025901 Bacteria 11807
142 Ga0207688_10003497 3300025901 Bacteria 8570
143 Ga0207680_10019837 3300025903 Bacteria 3605
144 Ga0207680_10020065 3300025903 Bacteria 3587
145 Ga0207647_10005591 3300025904 Bacteria 9186
146 Ga0207645_10055333 3300025907 Bacteria 2533
147 Ga0207705_10000417 3300025909 Bacteria 37398
148 Ga0207705_10014168 3300025909 Bacteria 5743
149 Ga0207705_10122173 3300025909 Bacteria 1933
150 Ga0207705_10258268 3300025909 Bacteria 1330
151 Ga0207684_10067177 3300025910 Bacteria 3046
152 Ga0207684_10119354 3300025910 Bacteria 2260
153 Ga0207684_10196167 3300025910 Bacteria 1742
154 Ga0207684_10286740 3300025910 Bacteria 1420
155 Ga0207654_10000003 3300025911 Bacteria 1030378
156 Ga0207707_10305107 3300025912 Bacteria 1376
157 Ga0207695_10007937 3300025913 Bacteria 13393
158 Ga0207671_10000001 3300025914 Bacteria 1318881
159 Ga0207657_10004685 3300025919 Bacteria 14438
160 Ga0207657_10045274 3300025919 Bacteria 3863
161 Ga0207657_10074517 3300025919 Bacteria 2866
162 Ga0207657_10209298 3300025919 Bacteria 1566
163 Ga0207652_10096747 3300025921 Bacteria 2601
164 Ga0207652_10100155 3300025921 Bacteria 2558
165 Ga0207646_10016260 3300025922 Bacteria 6984
166 Ga0207646_10030187 3300025922 Bacteria 4917
167 Ga0207681_10103584 3300025923 Bacteria 2057
168 Ga0207694_10000047 3300025924 Bacteria 163953
169 Ga0207650_10057841 3300025925 Bacteria 2885
170 Ga0207659_10141418 3300025926 Bacteria 1869
171 Ga0207687_10006765 3300025927 Bacteria 7552
172 Ga0207687_10237448 3300025927 Bacteria 1443
173 Ga0207687_10344013 3300025927 Bacteria 1213
174 Ga0207644_10003381 3300025931 Bacteria 10298
175 Ga0207690_10000634 3300025932 Bacteria 22539
176 Ga0207690_10316542 3300025932 Bacteria 1225
177 Ga0207709_10272806 3300025935 Bacteria 1246
178 Ga0207670_10272820 3300025936 Bacteria 1315
179 Ga0207665_10000538 3300025939 Bacteria 25495
180 Ga0207691_10001407 3300025940 Bacteria 24028
181 Ga0207711_10001765 3300025941 Bacteria 19811
182 Ga0207689_10006706 3300025942 Bacteria 10156
183 Ga0207667_10001391 3300025949 Bacteria 30337
184 Ga0207678_10016395 3300026067 Bacteria 6505
185 Ga0207678_10088014 3300026067 Bacteria 2654
186 Ga0207708_10009485 3300026075 Bacteria 7209
187 Ga0207708_10099266 3300026075 Bacteria 2252
188 Ga0207702_10069251 3300026078 Bacteria 3033
189 Ga0207702_10162205 3300026078 Bacteria 2042
190 Ga0207641_10208434 3300026088 Bacteria 1806
191 Ga0207648_10133371 3300026089 Bacteria 2187
192 Ga0207648_10430932 3300026089 Bacteria 1198
193 Ga0207676_10314590 3300026095 Bacteria 1435
194 Ga0207674_10006995 3300026116 Bacteria 13195
195 Ga0207674_10181619 3300026116 Bacteria 2055
196 Ga0207675_100012912 3300026118 Bacteria 7800
197 Ga0207683_10000893 3300026121 Bacteria 27409
198 Ga0207683_10031308 3300026121 Bacteria 4616
199 Ga0207698_10000325 3300026142 Bacteria 28337
200 Ga0207698_10076983 3300026142 Bacteria 2673
201 Ga0207428_10027367 3300027907 Bacteria 4748
202 Ga0268266_10098060 3300028379 Bacteria 2578
203 Ga0307509_10045172 3300031507 Bacteria 4754
204 Ga0307408_100017600 3300031548 Bacteria 4784
205 Ga0307408_100018137 3300031548 Bacteria 4723
206 Ga0307408_100028445 3300031548 Bacteria 3862
207 Ga0307408_100028564 3300031548 Bacteria 3855
208 Ga0307408_100040789 3300031548 Bacteria 3288
209 Ga0307408_100074623 3300031548 Bacteria 2517
210 Ga0307408_100081643 3300031548 Bacteria 2417
211 Ga0307408_100139142 3300031548 Bacteria 1904
212 Ga0307408_100160776 3300031548 Bacteria 1784
213 Ga0307408_100185578 3300031548 Bacteria 1671
214 Ga0307408_100223538 3300031548 Bacteria 1537
215 Ga0316575_10000061 3300031665 Bacteria 26127
216 Ga0307405_10012485 3300031731 Bacteria 4499
217 Ga0307405_10075584 3300031731 Bacteria 2182
218 Ga0307405_10177055 3300031731 Bacteria 1527
219 Ga0307405_10298740 3300031731 Bacteria 1220
220 Ga0307405_10328450 3300031731 Bacteria 1171
221 Ga0307405_10414128 3300031731 Bacteria 1058
222 Ga0307413_10029605 3300031824 Bacteria 3066
223 Ga0307413_10095613 3300031824 Bacteria 1948
224 Ga0307413_10218402 3300031824 Bacteria 1390
225 Ga0307413_10312534 3300031824 Bacteria 1197
226 Ga0307413_10449708 3300031824 Bacteria 1022
227 Ga0307410_10011737 3300031852 Bacteria 5027
228 Ga0307410_10025211 3300031852 Bacteria 3727
229 Ga0307410_10039429 3300031852 Bacteria 3101
230 Ga0307410_10196435 3300031852 Bacteria 1537
231 Ga0307410_10545451 3300031852 Bacteria 960
232 Ga0307410_10575817 3300031852 Bacteria 936
233 Ga0326468_10001828 3300031889 Bacteria 1805
234 Ga0307406_10079316 3300031901 Bacteria 2177
235 Ga0307406_10110129 3300031901 Bacteria 1894
236 Ga0307406_10111794 3300031901 Bacteria 1882
237 Ga0307406_10135826 3300031901 Bacteria 1733
238 Ga0307407_10013057 3300031903 Bacteria 4018
239 Ga0307407_10017155 3300031903 Bacteria 3625
240 Ga0307407_10020389 3300031903 Bacteria 3396
241 Ga0307407_10050304 3300031903 Bacteria 2383
242 Ga0307407_10115355 3300031903 Bacteria 1693
243 Ga0307407_10209722 3300031903 Bacteria 1311
244 Ga0307407_10249006 3300031903 Bacteria 1216
245 Ga0307412_10010488 3300031911 Bacteria 5339
246 Ga0307412_10013288 3300031911 Bacteria 4821
247 Ga0307412_10016632 3300031911 Bacteria 4387
248 Ga0307412_10041173 3300031911 Bacteria 2992
249 Ga0307412_10043435 3300031911 Bacteria 2926
250 Ga0307412_10065915 3300031911 Bacteria 2452
251 Ga0307412_10127394 3300031911 Bacteria 1843
252 Ga0307412_10155982 3300031911 Bacteria 1690
253 Ga0307412_10158358 3300031911 Bacteria 1679
254 Ga0307412_10371765 3300031911 Bacteria 1154
255 Ga0307409_100009471 3300031995 Bacteria 5986
256 Ga0307409_100025026 3300031995 Bacteria 4177
257 Ga0307409_100040406 3300031995 Bacteria 3472
258 Ga0307409_100041738 3300031995 Bacteria 3429
259 Ga0307409_100082709 3300031995 Bacteria 2600
260 Ga0307409_100085917 3300031995 Bacteria 2559
261 Ga0307409_100363558 3300031995 Bacteria 1370
262 Ga0307416_100333248 3300032002 Bacteria 1526
263 Ga0307416_100346855 3300032002 Bacteria 1500
264 Ga0307416_100919382 3300032002 Bacteria 975
265 Ga0307414_10014981 3300032004 Bacteria 4669
266 Ga0307411_10002303 3300032005 Bacteria 8373
267 Ga0307411_10012902 3300032005 Bacteria 4583
268 Ga0307411_10013804 3300032005 Bacteria 4473
269 Ga0307411_10062252 3300032005 Bacteria 2488
270 Ga0307411_10179900 3300032005 Bacteria 1604
271 Ga0307415_100031515 3300032126 Bacteria 3416
272 Ga0307415_100170871 3300032126 Bacteria 1695
273 Ga0307415_100255891 3300032126 Bacteria 1426
274 Ga0307415_100275733 3300032126 Bacteria 1380
275 Ga0373928_0022565 3300035084 Bacteria 1336
276 Ga0373939_0044066 3300035114 Bacteria 1357
277 Ga0373960_0039463 3300035121 Bacteria 1358
278 Ga0395899_0014879 3300037312 Bacteria 5937
279 Ga0395899_0050150 3300037312 Bacteria 3100
280 Ga0395900_0008728 3300037418 Bacteria 10408
281 Ga0395900_0013692 3300037418 Bacteria 8281
282 Ga0395900_0044192 3300037418 Bacteria 4591
283 Ga0395900_0106478 3300037418 Bacteria 2880
284 Ga0395900_0154906 3300037418 Bacteria 2340
285 Ga0395900_0206677 3300037418 Bacteria 1984
286 Ga0395900_0242553 3300037418 Bacteria 1807
287 Ga0395900_0309158 3300037418 Bacteria 1564
288 Ga0395900_0618234 3300037418 Bacteria 1022
289 Ga0395898_0000015 3300037466 Bacteria 439819
290 Ga0395898_0195454 3300037466 Bacteria 1932
291 Ga0395898_0288881 3300037466 Bacteria 1564
292 Ga0395905_0088374 3300037471 Bacteria 2905
293 Ga0395901_0044683 3300038443 Bacteria 4594
294 Ga0395901_0138510 3300038443 Bacteria 2558
295 Ga0395901_0169418 3300038443 Bacteria 2291
296 Ga0395901_0169457 3300038443 Bacteria 2291
297 Ga0395901_0273236 3300038443 Bacteria 1757
298 Ga0395901_0294783 3300038443 Bacteria 1682
299 Ga0439436_0005607 3300041404 Bacteria 3850
300 Ga0439436_0010559 3300041404 Bacteria 2814
301 Ga0439438_006361 3300041405 Bacteria 4182
302 Ga0439438_056638 3300041405 Bacteria 987
303 Ga0439439_0000799 3300041406 Bacteria 5720
304 Ga0439447_035610 3300041407 Bacteria 1233
305 Ga0439461_0000417 3300041410 Bacteria 6124
306 Ga0439466_0007590 3300041411 Bacteria 4098
307 Ga0439466_0028844 3300041411 Bacteria 1912
308 Ga0439465_0007915 3300041413 Bacteria 3368
309 Ga0451791_0418192 3300041451 Bacteria 2372
310 Ga0451800_1105822 3300041459 Bacteria 776
311 Ga0439431_0034262 3300041997 Bacteria 1273
312 Ga0439433_0000206 3300041999 Bacteria 9589
313 Ga0439433_0000289 3300041999 Bacteria 8630
314 Ga0439442_000074 3300042002 Bacteria 23450
315 Ga0439442_000309 3300042002 Bacteria 11736
316 Ga0439432_003609 3300042006 Bacteria 5724
317 Ga0439432_018983 3300042006 Bacteria 2294
318 Ga0439449_0001007 3300042007 Bacteria 11104
319 Ga0439449_0004716 3300042007 Bacteria 5261
320 Ga0439449_0011638 3300042007 Bacteria 3309
321 Ga0439449_0021455 3300042007 Bacteria 2417
322 Ga0439457_002062 3300042014 Bacteria 5884
323 Ga0439457_008285 3300042014 Bacteria 2457
324 Ga0450919_000348 3300042121 Bacteria 5565
325 Ga0450920_003618 3300042122 Bacteria 2691
326 Ga0450920_005271 3300042122 Bacteria 2292
327 Ga0450920_009872 3300042122 Bacteria 1763
328 Ga0450907_000685 3300042146 Bacteria 8773
329 Ga0450907_005422 3300042146 Bacteria 2153
330 Ga0450908_001130 3300042184 Bacteria 5180
331 Ga0439434_0000180 3300042435 Bacteria 17187
332 Ga0439434_0001140 3300042435 Bacteria 7681
333 Ga0439434_0047817 3300042435 Bacteria 1322
334 Ga0450918_002799 3300042531 Bacteria 3275
335 Ga0466969_0000268 3300044656 Bacteria 28572
336 Ga0466972_0015410 3300044658 Bacteria 3821
337 Ga0466972_0049853 3300044658 Bacteria 2022
338 Ga0466972_0065694 3300044658 Bacteria 1735
339 Ga0466965_0009347 3300044683 Bacteria 4556
340 Ga0466965_0051254 3300044683 Bacteria 2047
341 Ga0466966_0011386 3300044684 Bacteria 5900
342 Ga0466966_0157987 3300044684 Bacteria 1381
343 Ga0466961_0006152 3300044693 Bacteria 7618
344 Ga0466971_0012976 3300044719 Bacteria 3655
345 Ga0466968_0029514 3300044735 Bacteria 2268
346 Ga0466968_0050283 3300044735 Bacteria 1778
347 Ga0466970_0004720 3300044765 Bacteria 6731
348 Ga0466970_0010804 3300044765 Bacteria 4643
349 Ga0466970_0111578 3300044765 Bacteria 1493
350 Ga0466970_0182946 3300044765 Bacteria 1163
351 Ga0466960_0040834 3300044901 Bacteria 2195
352 Ga0466960_0082251 3300044901 Bacteria 1625
353 Ga0466959_0000333 3300045049 Bacteria 27831
354 Ga0466959_0010201 3300045049 Bacteria 6707
355 Ga0466959_0271433 3300045049 Bacteria 1166
356 Ga0466967_0112317 3300045976 Bacteria 2505
357 Ga0466967_0747235 3300045976 Bacteria 970
358 Ga0495651_0000707 3300046462 Bacteria 25880
359 Ga0495653_0150395 3300046463 Bacteria 1627
360 Ga0495650_0003728 3300046471 Bacteria 10897
361 Ga0495580_0007457 3300046472 Bacteria 8793
362 Ga0495580_0021576 3300046472 Bacteria 4749
363 Ga0495639_0011473 3300046475 Bacteria 3820
364 Ga0495662_0010414 3300046476 Bacteria 4555
365 Ga0495662_0017521 3300046476 Bacteria 3466
366 Ga0495664_0007121 3300046477 Bacteria 6199
367 Ga0495628_0003340 3300046516 Bacteria 14356
368 Ga0495630_0117299 3300046517 Bacteria 2018
369 Ga0495631_0072610 3300046518 Bacteria 1486
370 Ga0495643_0031916 3300046522 Bacteria 2928
371 Ga0495665_0000584 3300046531 Bacteria 18610
372 Ga0495586_0007797 3300046535 Bacteria 5708
373 Ga0495586_0194597 3300046535 Bacteria 1148
374 Ga0495587_0001644 3300046536 Bacteria 14910
375 Ga0495645_0006410 3300046543 Bacteria 8166
376 Ga0495622_0063894 3300046557 Bacteria 1703
377 Ga0495667_0000447 3300046559 Bacteria 26376
378 Ga0495656_0000881 3300046615 Bacteria 9713
379 Ga0495656_0006359 3300046615 Bacteria 4142
380 Ga0495656_0175416 3300046615 Bacteria 1050
381 Ga0495668_0006344 3300046616 Bacteria 7764
382 Ga0495635_0001469 3300046663 Bacteria 15761
383 Ga0495588_0002202 3300046674 Bacteria 8346
384 Ga0495588_0005545 3300046674 Bacteria 5622
385 Ga0495588_0022176 3300046674 Bacteria 3137
386 Ga0495657_0024693 3300046675 Bacteria 4276
387 Ga0495623_0043500 3300046679 Bacteria 2858
388 Ga0495670_0000915 3300046691 Bacteria 14239
389 Ga0495600_0035163 3300046809 Bacteria 3253
390 Ga0495600_0053174 3300046809 Bacteria 2644
391 Ga0495581_0008259 3300047315 Bacteria 6033
392 Ga0495581_0025673 3300047315 Bacteria 3416
393 Ga0495581_0114058 3300047315 Bacteria 1571
394 Ga0495581_0248464 3300047315 Bacteria 1040
395 Ga0495636_0082010 3300047318 Bacteria 1390
396 Ga0495680_0016371 3300047322 Bacteria 6373
397 Ga0495680_0053400 3300047322 Bacteria 3145
398 Ga0495685_104775 3300047447 Bacteria 933
399 Ga0495684_0247516 3300047471 Bacteria 1298
400 Ga0495593_0005077 3300047673 Bacteria 7783
401 Ga0496100_0019102 3300048903 Bacteria 4081
402 Ga0496101_0084844 3300048904 Bacteria 2346
403 Ga0496101_0087091 3300048904 Bacteria 2317
404 Ga0496101_0388844 3300048904 Bacteria 1098
405 Ga0496101_0396177 3300048904 Bacteria 1087
406 Ga0496101_0467397 3300048904 Bacteria 995
407 Ga0496102_0012978 3300048905 Bacteria 7216
408 Ga0496102_0030958 3300048905 Bacteria 4793
409 Ga0496102_0124555 3300048905 Bacteria 2408
410 Ga0496102_0138551 3300048905 Bacteria 2280
411 Ga0496103_0039961 3300048906 Bacteria 2883
412 Ga0496103_0051860 3300048906 Bacteria 2540
413 Ga0496103_0112062 3300048906 Bacteria 1733
414 Ga0496103_0168267 3300048906 Bacteria 1407
415 Ga0496104_0061203 3300048907 Bacteria 3568
416 Ga0496105_0074534 3300048908 Bacteria 2803
417 Ga0496106_0397548 3300048909 Bacteria 1107
418 Ga0496107_0312524 3300048910 Bacteria 1169
419 Ga0496107_0352838 3300048910 Bacteria 1094
420 Ga0496108_0026032 3300048911 Bacteria 4825
421 Ga0496108_0088684 3300048911 Bacteria 2628
422 Ga0496108_0090363 3300048911 Bacteria 2603
423 Ga0496108_0196431 3300048911 Bacteria 1750
424 Ga0496108_0353425 3300048911 Bacteria 1282
425 Ga0496109_0042257 3300048912 Bacteria 4128
426 Ga0496109_0075703 3300048912 Bacteria 3094
427 Ga0496109_0578551 3300048912 Bacteria 1058
428 Ga0496110_0015868 3300048913 Bacteria 6280
429 Ga0496110_0027468 3300048913 Bacteria 4879
430 Ga0496110_0048377 3300048913 Bacteria 3728
431 Ga0496110_0122654 3300048913 Bacteria 2342
432 Ga0496110_0166897 3300048913 Bacteria 1996
433 Ga0496111_0023603 3300048914 Bacteria 4320
434 Ga0496111_0112063 3300048914 Bacteria 2010
435 Ga0496111_0244775 3300048914 Bacteria 1331
436 Ga0496112_0010337 3300048915 Bacteria 8465
437 Ga0496112_0021726 3300048915 Bacteria 6105
438 Ga0496112_0059452 3300048915 Bacteria 3766
439 Ga0496113_0073825 3300048916 Bacteria 2599
440 Ga0496113_0358927 3300048916 Bacteria 1169
441 Ga0496114_0032121 3300048917 Bacteria 4319
442 Ga0496114_0059859 3300048917 Bacteria 3182
443 Ga0496114_0110486 3300048917 Bacteria 2355
444 Ga0496114_0113504 3300048917 Bacteria 2323
445 Ga0496114_0200241 3300048917 Bacteria 1749
446 Ga0496115_0435635 3300048918 Bacteria 1060
447 Ga0496117_0015667 3300048920 Bacteria 6442
448 Ga0496117_0052217 3300048920 Bacteria 2881
449 Ga0496118_0025612 3300048921 Bacteria 5050
450 Ga0496118_0044670 3300048921 Bacteria 3466
451 Ga0496119_0006819 3300048922 Bacteria 10469
452 Ga0496119_0009092 3300048922 Bacteria 8606
453 Ga0496119_0137093 3300048922 Bacteria 1326
454 Ga0496120_0004918 3300048923 Bacteria 10873
455 Ga0496120_0023475 3300048923 Bacteria 3861
456 Ga0496121_0086997 3300048924 Bacteria 2454
457 Ga0496122_0001925 3300048925 Bacteria 31334
458 Ga0496122_0002333 3300048925 Bacteria 27370
459 Ga0496122_0015418 3300048925 Bacteria 7308
460 Ga0496123_0000172 3300048926 Bacteria 130598
461 Ga0496124_0002762 3300048927 Bacteria 22332
462 Ga0496124_0138777 3300048927 Bacteria 1921
463 Ga0496125_0000015 3300048928 Bacteria 516648
464 Ga0496125_0001307 3300048928 Bacteria 36887
465 Ga0496125_0136034 3300048928 Bacteria 1719
466 Ga0496126_0051450 3300048929 Bacteria 3750
467 Ga0496126_0287006 3300048929 Bacteria 1362
468 Ga0501031_0003781 3300049568 Bacteria 9741
469 Ga0501031_0015138 3300049568 Bacteria 5009
470 Ga0501031_0043706 3300049568 Bacteria 2923
471 Ga0501031_0086918 3300049568 Bacteria 2038
472 Ga0501031_0171724 3300049568 Bacteria 1417
473 Ga0501032_0000302 3300049569 Bacteria 41525
474 Ga0501032_0000979 3300049569 Bacteria 23099
475 Ga0501032_0017670 3300049569 Bacteria 5005
476 Ga0501032_0047607 3300049569 Bacteria 2895
477 Ga0501033_0003369 3300049570 Bacteria 13185
478 Ga0501033_0058360 3300049570 Bacteria 2850
479 Ga0501033_0070474 3300049570 Bacteria 2568
480 Ga0501034_0000069 3300049571 Bacteria 181133
481 Ga0501034_0011189 3300049571 Bacteria 9314
482 Ga0501034_0026967 3300049571 Bacteria 5844
483 Ga0501034_0056828 3300049571 Bacteria 3935
484 Ga0501034_0079025 3300049571 Bacteria 3293
485 Ga0501034_0108966 3300049571 Bacteria 2760
486 Ga0501034_0135942 3300049571 Bacteria 2439
487 Ga0501034_0181685 3300049571 Bacteria 2068
488 Ga0501036_0047355 3300049572 Bacteria 3642
489 Ga0501036_0067953 3300049572 Bacteria 3015
490 Ga0501036_0085772 3300049572 Bacteria 2661
491 Ga0501036_0141186 3300049572 Bacteria 2033
492 Ga0501036_0174398 3300049572 Bacteria 1811
493 Ga0501037_0013267 3300049573 Bacteria 6071
494 Ga0501037_0015218 3300049573 Bacteria 5660
495 Ga0501037_0015228 3300049573 Bacteria 5658
496 Ga0501037_0021455 3300049573 Bacteria 4773
497 Ga0501037_0026685 3300049573 Bacteria 4268
498 Ga0501037_0299713 3300049573 Bacteria 1116
499 Ga0501038_0011689 3300049574 Bacteria 8008
500 Ga0501038_0028836 3300049574 Bacteria 4927
501 Ga0501038_0058905 3300049574 Bacteria 3291
502 Ga0501038_0106279 3300049574 Bacteria 2330
503 Ga0501038_0166181 3300049574 Bacteria 1790
504 Ga0501039_0171666 3300049575 Bacteria 1705
505 Ga0501039_0182803 3300049575 Bacteria 1649
506 Ga0501040_0042170 3300049576 Bacteria 3107
507 Ga0501040_0088427 3300049576 Bacteria 2152
508 Ga0501041_0018395 3300049577 Bacteria 4164
509 Ga0501042_0024174 3300049578 Bacteria 4260
510 Ga0501043_0008178 3300049579 Bacteria 8249
511 Ga0501043_0031113 3300049579 Bacteria 4196
512 Ga0501043_0070230 3300049579 Bacteria 2751
513 Ga0501043_0106064 3300049579 Bacteria 2207
514 Ga0501043_0113183 3300049579 Bacteria 2131
515 Ga0501043_0170230 3300049579 Bacteria 1699
516 Ga0501046_0002697 3300049580 Bacteria 16521
517 Ga0501046_0070287 3300049580 Bacteria 2722
518 Ga0501047_0002907 3300049581 Bacteria 16258
519 Ga0501047_0033662 3300049581 Bacteria 4945
520 Ga0501047_0046170 3300049581 Bacteria 4210
521 Ga0501047_0069081 3300049581 Bacteria 3402
522 Ga0501048_0003585 3300049582 Bacteria 11817
523 Ga0501048_0059865 3300049582 Bacteria 2699
524 Ga0501048_0360004 3300049582 Bacteria 1038
525 Ga0501067_0008863 3300049583 Bacteria 5573
526 Ga0501067_0043277 3300049583 Bacteria 2500
527 Ga0501068_0053778 3300049584 Bacteria 2438
528 Ga0501068_0370570 3300049584 Bacteria 921
529 Ga0501069_0052144 3300049585 Bacteria 2277
530 Ga0501070_0033712 3300049586 Bacteria 4285
531 Ga0501070_0084035 3300049586 Bacteria 2636
532 Ga0501070_0089449 3300049586 Bacteria 2548
533 Ga0501070_0226239 3300049586 Bacteria 1533
534 Ga0501070_0273601 3300049586 Bacteria 1378
535 Ga0501071_0030035 3300049587 Bacteria 3841
536 Ga0501071_0473414 3300049587 Bacteria 960
537 Ga0501072_0024025 3300049588 Bacteria 4738
538 Ga0501072_0061081 3300049588 Bacteria 2971
539 Ga0501072_0383250 3300049588 Bacteria 1116
540 Ga0501073_0000052 3300049589 Bacteria 73681
541 Ga0501073_0022505 3300049589 Bacteria 4538
542 Ga0501073_0096568 3300049589 Bacteria 2052
543 Ga0501073_0114929 3300049589 Bacteria 1865
544 Ga0501074_0139760 3300049590 Bacteria 1732
545 Ga0501076_0091403 3300049592 Bacteria 2448
546 Ga0501077_0080182 3300049593 Bacteria 2068
547 Ga0501079_0041264 3300049741 Bacteria 3561
548 Ga0501080_0069733 3300049742 Bacteria 3270
549 Ga0501083_0012626 3300049744 Bacteria 5909
550 Ga0501083_0034310 3300049744 Bacteria 3470
551 Ga0501035_0007414 3300049822 Bacteria 10246
552 Ga0501035_0025218 3300049822 Bacteria 5450
553 Ga0501035_0098038 3300049822 Bacteria 2573
554 Ga0501044_0003445 3300049823 Bacteria 17814
555 Ga0501044_0007662 3300049823 Bacteria 11872
556 Ga0501044_0041340 3300049823 Bacteria 4798
557 Ga0501044_0054272 3300049823 Bacteria 4120
558 Ga0501044_0056845 3300049823 Bacteria 4017
559 Ga0501044_0270030 3300049823 Bacteria 1637
560 Ga0501045_0144923 3300049824 Bacteria 1766
561 nmdc:mga00v17_12383_c1 3300050491 Bacteria 4706
562 nmdc:mga00v17_311263_c1 3300050491 Bacteria 1023
563 nmdc:mga0yw44_51150_c1 3300050492 Bacteria 2501
564 nmdc:mga0yw44_75153_c1 3300050492 Bacteria 2106
565 nmdc:mga06z11_102957_c1 3300050494 Bacteria 1569
566 nmdc:mga06z11_211832_c1 3300050494 Bacteria 1129
567 nmdc:mga04h51_31858_c1 3300050495 Bacteria 1668
568 nmdc:mga07m45_123473_c1 3300050496 Bacteria 1496
569 nmdc:mga07m45_26587_c1 3300050496 Bacteria 3182
570 nmdc:mga05p37_511036_c1 3300050507 Bacteria 1376
571 nmdc:mga09592_897102_c1 3300050508 Bacteria 745
572 nmdc:mga0qj67_388846_c1 3300050509 Bacteria 1126
573 nmdc:mga06r32_57031_c1 3300050510 Bacteria 3752
574 nmdc:mga0a205_17758_c1 3300050515 Bacteria 6676
575 nmdc:mga0sz30_10037_c1 3300050516 Bacteria 3621
576 nmdc:mga0sz30_96352_c1 3300050516 Bacteria 970
577 Ga0495612_0013418 3300053078 Bacteria 3300
578 Ga0500556_0001349 3300053104 Bacteria 10848
579 Ga0500562_003197 3300053108 Bacteria 4084
580 Ga0500628_030945 3300053129 Bacteria 1161
581 Ga0500655_001344 3300053133 Bacteria 4657
582 Ga0500559_0000462 3300053136 Bacteria 28935
583 Ga0500616_0001033 3300053153 Bacteria 29485
584 Ga0500616_0034816 3300053153 Bacteria 2742
585 Ga0501084_0037200 3300054114 Bacteria 4066
586 Ga0587088_005039 3300059508 Bacteria 1714
587 Ga0587090_011374 3300059510 Bacteria 1250
588 Ga0587106_000709 3300059605 Bacteria 2556
589 Ga0587106_001521 3300059605 Bacteria 2078
590 Ga0501082_0005130 3300060353 Bacteria 11399
591 Ga0501082_0042381 3300060353 Bacteria 3924
592 Ga0466962_0000049 3300061719 Bacteria 48219
593 Ga0530510_0009182 3300061734 Bacteria 6929
594 Ga0530510_0166615 3300061734 Bacteria 1631

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025912 Ga0207707_10305107 Ga0207707_103051072 221
2 3300005327 Ga0070658_10039126 Ga0070658_100391263 222
3 3300005331 Ga0070670_100137032 Ga0070670_1001370322 222
4 3300025901 Ga0207688_10003497 Ga0207688_100034972 222
5 3300050508 nmdc:mga09592_897102_c1 nmdc:mga09592_897102_c1_11_724 226
6 3300041459 Ga0451800_1105822 Ga0451800_1105822_75_764 229
7 3300031889 Ga0326468_10001828 Ga0326468_100018282 241
8 3300044656 Ga0466969_0000268 Ga0466969_0000268_18733_19662 243
9 3300044684 Ga0466966_0011386 Ga0466966_0011386_1860_2789 243
10 3300044693 Ga0466961_0006152 Ga0466961_0006152_5339_6268 243
11 3300044719 Ga0466971_0012976 Ga0466971_0012976_233_1162 243
12 3300045049 Ga0466959_0000333 Ga0466959_0000333_11775_12704 243
13 3300048922 Ga0496119_0009092 Ga0496119_0009092_4135_4875 243
14 3300050509 nmdc:mga0qj67_388846_c1 nmdc:mga0qj67_388846_c1_19_834 243
15 3300061719 Ga0466962_0000049 Ga0466962_0000049_6123_7052 243
16 3300009094 Ga0111539_10845254 Ga0111539_108452541 245
17 3300009098 Ga0105245_10139913 Ga0105245_101399132 245
18 3300009174 Ga0105241_10032180 Ga0105241_100321802 245
19 3300024225 Ga0224572_1001011 Ga0224572_10010113 245
20 3300048904 Ga0496101_0388844 Ga0496101_0388844_218_1060 245
21 3300048916 Ga0496113_0073825 Ga0496113_0073825_1312_2178 245
22 3300005441 Ga0070700_100292710 Ga0070700_1002927101 246
23 3300005617 Ga0068859_100220569 Ga0068859_1002205691 246
24 3300006931 Ga0097620_100220577 Ga0097620_1002205772 246
25 3300025936 Ga0207670_10272820 Ga0207670_102728201 246
26 3300026067 Ga0207678_10088014 Ga0207678_100880142 246
27 3300026075 Ga0207708_10099266 Ga0207708_100992662 246
28 3300026095 Ga0207676_10314590 Ga0207676_103145902 246
29 3300005339 Ga0070660_100047943 Ga0070660_1000479432 247
30 3300005547 Ga0070693_100117289 Ga0070693_1001172892 247
31 3300005548 Ga0070665_100177716 Ga0070665_1001777162 247
32 3300025919 Ga0207657_10045274 Ga0207657_100452743 247
33 3300025921 Ga0207652_10096747 Ga0207652_100967472 247
34 3300025935 Ga0207709_10272806 Ga0207709_102728061 247
35 3300026089 Ga0207648_10430932 Ga0207648_104309321 247
36 3300005445 Ga0070708_100142600 Ga0070708_1001426002 256
37 3300005530 Ga0070679_100161887 Ga0070679_1001618872 257
38 3300025921 Ga0207652_10100155 Ga0207652_101001553 257
39 3300049582 Ga0501048_0360004 Ga0501048_0360004_13_891 257
40 3300049568 Ga0501031_0043706 Ga0501031_0043706_186_1064 258
41 3300049576 Ga0501040_0088427 Ga0501040_0088427_848_1726 258
42 3300005467 Ga0070706_100224912 Ga0070706_1002249122 260
43 3300005468 Ga0070707_100006788 Ga0070707_1000067882 260
44 3300005719 Ga0068861_100372655 Ga0068861_1003726552 260
45 3300025910 Ga0207684_10119354 Ga0207684_101193542 260
46 3300025922 Ga0207646_10016260 Ga0207646_100162602 260
47 3300025927 Ga0207687_10344013 Ga0207687_103440132 261
48 3300005445 Ga0070708_100001304 Ga0070708_1000013048 262
49 3300005467 Ga0070706_100418274 Ga0070706_1004182742 262
50 3300025910 Ga0207684_10067177 Ga0207684_100671773 262
51 3300005468 Ga0070707_100112882 Ga0070707_1001128823 263
52 3300005518 Ga0070699_100042834 Ga0070699_1000428343 263
53 3300025910 Ga0207684_10286740 Ga0207684_102867401 263
54 3300025922 Ga0207646_10030187 Ga0207646_100301873 263
55 3300041405 Ga0439438_006361 Ga0439438_006361_2856_3725 263
56 3300041406 Ga0439439_0000799 Ga0439439_0000799_2445_3284 263
57 3300041407 Ga0439447_035610 Ga0439447_035610_159_998 263
58 3300041410 Ga0439461_0000417 Ga0439461_0000417_3080_3949 263
59 3300041411 Ga0439466_0007590 Ga0439466_0007590_1282_2121 263
60 3300041999 Ga0439433_0000206 Ga0439433_0000206_4610_5449 263
61 3300042006 Ga0439432_003609 Ga0439432_003609_1429_2268 263
62 3300042007 Ga0439449_0021455 Ga0439449_0021455_1445_2284 263
63 3300042014 Ga0439457_002062 Ga0439457_002062_2365_3204 263
64 3300042121 Ga0450919_000348 Ga0450919_000348_70_909 263
65 3300042146 Ga0450907_005422 Ga0450907_005422_816_1655 263
66 3300042184 Ga0450908_001130 Ga0450908_001130_394_1233 263
67 3300042435 Ga0439434_0001140 Ga0439434_0001140_3410_4249 263
68 3300048911 Ga0496108_0088684 Ga0496108_0088684_258_1133 263
69 3300048913 Ga0496110_0166897 Ga0496110_0166897_347_1222 263
70 3300049568 Ga0501031_0086918 Ga0501031_0086918_917_1771 263
71 3300049569 Ga0501032_0017670 Ga0501032_0017670_2696_3550 263
72 3300049570 Ga0501033_0058360 Ga0501033_0058360_651_1505 263
73 3300049571 Ga0501034_0056828 Ga0501034_0056828_2072_2926 263
74 3300049572 Ga0501036_0085772 Ga0501036_0085772_1540_2394 263
75 3300049573 Ga0501037_0026685 Ga0501037_0026685_1065_1919 263
76 3300049574 Ga0501038_0028836 Ga0501038_0028836_1602_2456 263
77 3300049576 Ga0501040_0042170 Ga0501040_0042170_1049_1903 263
78 3300049577 Ga0501041_0018395 Ga0501041_0018395_2944_3798 263
79 3300049578 Ga0501042_0024174 Ga0501042_0024174_213_1067 263
80 3300049579 Ga0501043_0031113 Ga0501043_0031113_2236_3090 263
81 3300049581 Ga0501047_0069081 Ga0501047_0069081_2354_3208 263
82 3300049582 Ga0501048_0003585 Ga0501048_0003585_2072_2926 263
83 3300049583 Ga0501067_0043277 Ga0501067_0043277_1054_1908 263
84 3300049584 Ga0501068_0053778 Ga0501068_0053778_1137_1991 263
85 3300049585 Ga0501069_0052144 Ga0501069_0052144_1156_2010 263
86 3300049586 Ga0501070_0273601 Ga0501070_0273601_268_1122 263
87 3300049587 Ga0501071_0030035 Ga0501071_0030035_1917_2771 263
88 3300049588 Ga0501072_0024025 Ga0501072_0024025_1134_1988 263
89 3300049589 Ga0501073_0114929 Ga0501073_0114929_927_1781 263
90 3300049590 Ga0501074_0139760 Ga0501074_0139760_611_1465 263
91 3300049592 Ga0501076_0091403 Ga0501076_0091403_1307_2161 263
92 3300049593 Ga0501077_0080182 Ga0501077_0080182_395_1249 263
93 3300049741 Ga0501079_0041264 Ga0501079_0041264_1503_2357 263
94 3300049744 Ga0501083_0034310 Ga0501083_0034310_2221_3075 263
95 3300049823 Ga0501044_0054272 Ga0501044_0054272_2350_3204 263
96 3300049824 Ga0501045_0144923 Ga0501045_0144923_483_1337 263
97 3300050494 nmdc:mga06z11_211832_c1 nmdc:mga06z11_211832_c1_81_902 263
98 3300054114 Ga0501084_0037200 Ga0501084_0037200_1296_2150 263
99 3300060353 Ga0501082_0042381 Ga0501082_0042381_2550_3404 263
100 3300061734 Ga0530510_0166615 Ga0530510_0166615_507_1361 263
101 3300049573 Ga0501037_0021455 Ga0501037_0021455_2523_3323 264
102 3300049586 Ga0501070_0089449 Ga0501070_0089449_179_979 264
103 3300049823 Ga0501044_0056845 Ga0501044_0056845_1745_2545 264
104 3300005614 Ga0068856_100196052 Ga0068856_1001960522 265
105 3300006844 Ga0075428_100000791 Ga0075428_10000079128 265
106 3300026078 Ga0207702_10162205 Ga0207702_101622052 265
107 3300049572 Ga0501036_0141186 Ga0501036_0141186_512_1390 265
108 3300050510 nmdc:mga06r32_57031_c1 nmdc:mga06r32_57031_c1_2754_3584 265
109 3300049569 Ga0501032_0000302 Ga0501032_0000302_5425_6306 266
110 3300049571 Ga0501034_0000069 Ga0501034_0000069_159737_160618 266
111 3300049573 Ga0501037_0015218 Ga0501037_0015218_2925_3806 266
112 3300049574 Ga0501038_0166181 Ga0501038_0166181_691_1572 266
113 3300049579 Ga0501043_0170230 Ga0501043_0170230_189_1070 266
114 3300005618 Ga0068864_100165063 Ga0068864_1001650632 267
115 3300031548 Ga0307408_100017600 Ga0307408_1000176004 267
116 3300031548 Ga0307408_100040789 Ga0307408_1000407893 267
117 3300031731 Ga0307405_10075584 Ga0307405_100755843 267
118 3300031824 Ga0307413_10449708 Ga0307413_104497081 267
119 3300031852 Ga0307410_10545451 Ga0307410_105454511 267
120 3300031903 Ga0307407_10017155 Ga0307407_100171552 267
121 3300031903 Ga0307407_10020389 Ga0307407_100203893 267
122 3300031903 Ga0307407_10209722 Ga0307407_102097222 267
123 3300031911 Ga0307412_10127394 Ga0307412_101273941 267
124 3300031911 Ga0307412_10155982 Ga0307412_101559822 267
125 3300031995 Ga0307409_100041738 Ga0307409_1000417383 267
126 3300031995 Ga0307409_100085917 Ga0307409_1000859172 267
127 3300032002 Ga0307416_100346855 Ga0307416_1003468552 267
128 3300032005 Ga0307411_10013804 Ga0307411_100138042 267
129 3300032126 Ga0307415_100031515 Ga0307415_1000315151 267
130 3300041451 Ga0451791_0418192 Ga0451791_0418192_79_945 267
131 3300049574 Ga0501038_0058905 Ga0501038_0058905_255_1136 267
132 3300049579 Ga0501043_0008178 Ga0501043_0008178_6303_7184 267
133 3300002773 JGI25152J39213_1000574 JGI25152J39213_10005747 268
134 3300005327 Ga0070658_10000294 Ga0070658_1000029433 268
135 3300005336 Ga0070680_100306881 Ga0070680_1003068811 268
136 3300006042 Ga0075368_10090537 Ga0075368_100905372 268
137 3300006051 Ga0075364_10028857 Ga0075364_100288572 268
138 3300006353 Ga0075370_10013844 Ga0075370_100138442 268
139 3300013105 Ga0157369_10069146 Ga0157369_100691462 268
140 3300013105 Ga0157369_10072394 Ga0157369_100723943 268
141 3300025258 Ga0209129_1000059 Ga0209129_100005950 268
142 3300025294 Ga0209025_1000398 Ga0209025_100039850 268
143 3300025909 Ga0207705_10000417 Ga0207705_1000041733 268
144 3300037312 Ga0395899_0050150 Ga0395899_0050150_1519_2331 268
145 3300037418 Ga0395900_0242553 Ga0395900_0242553_399_1211 268
146 3300037418 Ga0395900_0309158 Ga0395900_0309158_576_1388 268
147 3300037466 Ga0395898_0288881 Ga0395898_0288881_213_1025 268
148 3300038443 Ga0395901_0294783 Ga0395901_0294783_579_1391 268
149 3300042122 Ga0450920_009872 Ga0450920_009872_58_939 268
150 3300048904 Ga0496101_0084844 Ga0496101_0084844_11_823 268
151 3300048913 Ga0496110_0048377 Ga0496110_0048377_1912_2724 268
152 3300048917 Ga0496114_0113504 Ga0496114_0113504_990_1802 268
153 3300049586 Ga0501070_0084035 Ga0501070_0084035_1689_2537 268
154 3300050494 nmdc:mga06z11_102957_c1 nmdc:mga06z11_102957_c1_588_1436 268
155 3300050495 nmdc:mga04h51_31858_c1 nmdc:mga04h51_31858_c1_153_1001 268
156 3300050496 nmdc:mga07m45_26587_c1 nmdc:mga07m45_26587_c1_1546_2394 268
157 3300009098 Ga0105245_10003821 Ga0105245_1000382110 270
158 3300025927 Ga0207687_10006765 Ga0207687_100067657 270
159 3300048928 Ga0496125_0000015 Ga0496125_0000015_288089_289042 270
160 3300005366 Ga0070659_100256620 Ga0070659_1002566201 271
161 3300005467 Ga0070706_100160674 Ga0070706_1001606742 271
162 3300025910 Ga0207684_10196167 Ga0207684_101961672 271
163 3300045976 Ga0466967_0112317 Ga0466967_0112317_554_1384 271
164 3300046516 Ga0495628_0003340 Ga0495628_0003340_13495_14340 271
165 3300048924 Ga0496121_0086997 Ga0496121_0086997_524_1366 271
166 3300049584 Ga0501068_0370570 Ga0501068_0370570_77_898 271
167 3300049586 Ga0501070_0033712 Ga0501070_0033712_2864_3679 271
168 3300049587 Ga0501071_0473414 Ga0501071_0473414_82_918 271
169 3300049589 Ga0501073_0000052 Ga0501073_0000052_31053_31868 271
170 3300049742 Ga0501080_0069733 Ga0501080_0069733_1889_2704 271
171 3300005548 Ga0070665_100014657 Ga0070665_1000146572 272
172 3300005841 Ga0068863_100200201 Ga0068863_1002002012 272
173 3300025931 Ga0207644_10003381 Ga0207644_100033818 272
174 3300026088 Ga0207641_10208434 Ga0207641_102084342 272
175 3300028379 Ga0268266_10098060 Ga0268266_100980602 272
176 3300049582 Ga0501048_0059865 Ga0501048_0059865_354_1340 272
177 3300005327 Ga0070658_10005814 Ga0070658_1000581410 273
178 3300006038 Ga0075365_10005224 Ga0075365_100052243 273
179 3300006051 Ga0075364_10010750 Ga0075364_100107504 273
180 3300025909 Ga0207705_10122173 Ga0207705_101221732 273
181 3300045049 Ga0466959_0271433 Ga0466959_0271433_206_1105 273
182 3300048929 Ga0496126_0051450 Ga0496126_0051450_1957_2778 273
183 3300049573 Ga0501037_0013267 Ga0501037_0013267_2397_3218 273
184 3300049579 Ga0501043_0070230 Ga0501043_0070230_743_1564 273
185 3300049581 Ga0501047_0002907 Ga0501047_0002907_12123_12944 273
186 3300049822 Ga0501035_0007414 Ga0501035_0007414_5962_6783 273
187 3300049823 Ga0501044_0003445 Ga0501044_0003445_4149_4970 273
188 3300050491 nmdc:mga00v17_12383_c1 nmdc:mga00v17_12383_c1_1542_2363 273
189 3300050491 nmdc:mga00v17_311263_c1 nmdc:mga00v17_311263_c1_10_831 273
190 3300050492 nmdc:mga0yw44_51150_c1 nmdc:mga0yw44_51150_c1_1340_2161 273
191 3300050516 nmdc:mga0sz30_10037_c1 nmdc:mga0sz30_10037_c1_1536_2357 273
192 3300050516 nmdc:mga0sz30_96352_c1 nmdc:mga0sz30_96352_c1_97_918 273
193 3300053104 Ga0500556_0001349 Ga0500556_0001349_6629_7450 273
194 3300053108 Ga0500562_003197 Ga0500562_003197_2746_3567 273
195 3300053133 Ga0500655_001344 Ga0500655_001344_117_938 273
196 3300053136 Ga0500559_0000462 Ga0500559_0000462_14749_15570 273
197 3300053153 Ga0500616_0034816 Ga0500616_0034816_1650_2471 273
198 iso_pu_bacteria 2816332139 2816509539 273
199 3300045976 Ga0466967_0747235 Ga0466967_0747235_83_949 274
200 3300049571 Ga0501034_0108966 Ga0501034_0108966_625_1449 274
201 3300049588 Ga0501072_0061081 Ga0501072_0061081_2135_2959 274
202 3300049589 Ga0501073_0022505 Ga0501073_0022505_158_982 274
203 3300053153 Ga0500616_0001033 Ga0500616_0001033_1908_2732 274
204 3300020082 Ga0206353_10786700 Ga0206353_107867002 275
205 3300044658 Ga0466972_0015410 Ga0466972_0015410_1981_2832 275
206 3300044658 Ga0466972_0065694 Ga0466972_0065694_279_1154 275
207 3300003285 Ga0007423J48922_100316 Ga0007423J48922_1003165 276
208 3300009011 Ga0105251_10009132 Ga0105251_100091323 276
209 3300009036 Ga0105244_10003037 Ga0105244_100030377 276
210 3300009036 Ga0105244_10182356 Ga0105244_101823561 276
211 3300009148 Ga0105243_10025612 Ga0105243_100256123 276
212 3300011119 Ga0105246_10010371 Ga0105246_100103715 276
213 3300011119 Ga0105246_10063634 Ga0105246_100636341 276
214 3300013105 Ga0157369_10234635 Ga0157369_102346352 276
215 3300013308 Ga0157375_10427317 Ga0157375_104273172 276
216 3300014326 Ga0157380_10312073 Ga0157380_103120732 276
217 3300025315 Ga0207697_10004756 Ga0207697_100047564 276
218 3300025728 Ga0207655_1006307 Ga0207655_10063076 276
219 3300031548 Ga0307408_100018137 Ga0307408_1000181373 276
220 3300031548 Ga0307408_100160776 Ga0307408_1001607761 276
221 3300031824 Ga0307413_10029605 Ga0307413_100296053 276
222 3300031824 Ga0307413_10312534 Ga0307413_103125341 276
223 3300031852 Ga0307410_10025211 Ga0307410_100252112 276
224 3300031903 Ga0307407_10115355 Ga0307407_101153552 276
225 3300031911 Ga0307412_10041173 Ga0307412_100411733 276
226 3300031995 Ga0307409_100082709 Ga0307409_1000827092 276
227 3300037418 Ga0395900_0154906 Ga0395900_0154906_1187_2026 276
228 3300038443 Ga0395901_0169418 Ga0395901_0169418_170_1009 276
229 3300046463 Ga0495653_0150395 Ga0495653_0150395_47_886 276
230 3300046472 Ga0495580_0007457 Ga0495580_0007457_6631_7470 276
231 3300046475 Ga0495639_0011473 Ga0495639_0011473_1874_2713 276
232 3300046476 Ga0495662_0010414 Ga0495662_0010414_2993_3832 276
233 3300046477 Ga0495664_0007121 Ga0495664_0007121_3291_4130 276
234 3300046517 Ga0495630_0117299 Ga0495630_0117299_459_1298 276
235 3300046518 Ga0495631_0072610 Ga0495631_0072610_49_888 276
236 3300046522 Ga0495643_0031916 Ga0495643_0031916_1796_2635 276
237 3300046531 Ga0495665_0000584 Ga0495665_0000584_196_1035 276
238 3300046535 Ga0495586_0007797 Ga0495586_0007797_1437_2276 276
239 3300046535 Ga0495586_0194597 Ga0495586_0194597_51_890 276
240 3300046536 Ga0495587_0001644 Ga0495587_0001644_10211_11050 276
241 3300046557 Ga0495622_0063894 Ga0495622_0063894_268_1107 276
242 3300046559 Ga0495667_0000447 Ga0495667_0000447_8222_9061 276
243 3300046615 Ga0495656_0000881 Ga0495656_0000881_323_1162 276
244 3300046615 Ga0495656_0175416 Ga0495656_0175416_195_1034 276
245 3300046616 Ga0495668_0006344 Ga0495668_0006344_4081_4920 276
246 3300046674 Ga0495588_0002202 Ga0495588_0002202_5407_6246 276
247 3300046674 Ga0495588_0005545 Ga0495588_0005545_1225_2064 276
248 3300046674 Ga0495588_0022176 Ga0495588_0022176_825_1664 276
249 3300046675 Ga0495657_0024693 Ga0495657_0024693_3311_4150 276
250 3300046679 Ga0495623_0043500 Ga0495623_0043500_362_1201 276
251 3300046691 Ga0495670_0000915 Ga0495670_0000915_12216_13055 276
252 3300046809 Ga0495600_0053174 Ga0495600_0053174_1676_2515 276
253 3300047315 Ga0495581_0008259 Ga0495581_0008259_1775_2614 276
254 3300047315 Ga0495581_0025673 Ga0495581_0025673_784_1623 276
255 3300047315 Ga0495581_0114058 Ga0495581_0114058_363_1202 276
256 3300047315 Ga0495581_0248464 Ga0495581_0248464_113_952 276
257 3300047318 Ga0495636_0082010 Ga0495636_0082010_390_1229 276
258 3300047322 Ga0495680_0016371 Ga0495680_0016371_2438_3277 276
259 3300047322 Ga0495680_0053400 Ga0495680_0053400_1537_2376 276
260 3300047447 Ga0495685_104775 Ga0495685_104775_59_898 276
261 3300047471 Ga0495684_0247516 Ga0495684_0247516_195_1034 276
262 3300047673 Ga0495593_0005077 Ga0495593_0005077_4655_5494 276
263 3300048903 Ga0496100_0019102 Ga0496100_0019102_500_1339 276
264 3300048904 Ga0496101_0087091 Ga0496101_0087091_204_1043 276
265 3300048904 Ga0496101_0467397 Ga0496101_0467397_66_905 276
266 3300048905 Ga0496102_0138551 Ga0496102_0138551_921_1760 276
267 3300048906 Ga0496103_0112062 Ga0496103_0112062_176_1015 276
268 3300048908 Ga0496105_0074534 Ga0496105_0074534_1764_2603 276
269 3300048909 Ga0496106_0397548 Ga0496106_0397548_161_1000 276
270 3300048910 Ga0496107_0312524 Ga0496107_0312524_282_1121 276
271 3300048911 Ga0496108_0090363 Ga0496108_0090363_1261_2100 276
272 3300048911 Ga0496108_0353425 Ga0496108_0353425_234_1073 276
273 3300048912 Ga0496109_0075703 Ga0496109_0075703_970_1809 276
274 3300048912 Ga0496109_0578551 Ga0496109_0578551_154_993 276
275 3300048913 Ga0496110_0027468 Ga0496110_0027468_2930_3769 276
276 3300048913 Ga0496110_0122654 Ga0496110_0122654_82_921 276
277 3300048914 Ga0496111_0244775 Ga0496111_0244775_27_866 276
278 3300048918 Ga0496115_0435635 Ga0496115_0435635_161_1000 276
279 3300048920 Ga0496117_0015667 Ga0496117_0015667_3167_3997 276
280 3300048921 Ga0496118_0025612 Ga0496118_0025612_2015_2845 276
281 3300048922 Ga0496119_0006819 Ga0496119_0006819_4387_5217 276
282 3300048923 Ga0496120_0004918 Ga0496120_0004918_4677_5507 276
283 3300048927 Ga0496124_0138777 Ga0496124_0138777_50_889 276
284 3300048928 Ga0496125_0136034 Ga0496125_0136034_542_1381 276
285 3300049571 Ga0501034_0181685 Ga0501034_0181685_827_1657 276
286 3300053129 Ga0500628_030945 Ga0500628_030945_266_1096 276
287 3300059508 Ga0587088_005039 Ga0587088_005039_158_997 276
288 3300059605 Ga0587106_000709 Ga0587106_000709_1279_2118 276
289 3300059605 Ga0587106_001521 Ga0587106_001521_244_1083 276
290 iso_pu_bacteria 2643221632 2644182703 276
291 iso_pu_bacteria 2837268691 2837270588 276
292 iso_pu_bacteria 2884994152 2884994286 276
293 3300005471 Ga0070698_100013237 Ga0070698_1000132373 277
294 3300013105 Ga0157369_10485482 Ga0157369_104854821 277
295 3300014325 Ga0163163_10103726 Ga0163163_101037262 277
296 3300031731 Ga0307405_10328450 Ga0307405_103284501 277
297 3300044684 Ga0466966_0157987 Ga0466966_0157987_67_939 277
298 3300044901 Ga0466960_0082251 Ga0466960_0082251_310_1293 277
299 3300046471 Ga0495650_0003728 Ga0495650_0003728_2252_3085 277
300 3300046615 Ga0495656_0006359 Ga0495656_0006359_3054_3890 277
301 3300048915 Ga0496112_0059452 Ga0496112_0059452_749_1588 277
302 3300048925 Ga0496122_0015418 Ga0496122_0015418_4532_5419 277
303 3300049580 Ga0501046_0070287 Ga0501046_0070287_1751_2608 277
304 3300049823 Ga0501044_0270030 Ga0501044_0270030_345_1190 277
305 iso_pu_bacteria 2643221697 2644538701 277
306 iso_pu_bacteria 8056060235 8056060392 277
307 3300003578 Ga0006562J51391_1099017 Ga0006562J51391_10990171 278
308 3300005327 Ga0070658_10154370 Ga0070658_101543702 278
309 3300005335 Ga0070666_10032696 Ga0070666_100326962 278
310 3300005337 Ga0070682_100030642 Ga0070682_1000306422 278
311 3300005406 Ga0070703_10022665 Ga0070703_100226651 278
312 3300005436 Ga0070713_100614065 Ga0070713_1006140651 278
313 3300005544 Ga0070686_100168400 Ga0070686_1001684001 278
314 3300005545 Ga0070695_100043453 Ga0070695_1000434531 278
315 3300005546 Ga0070696_100046797 Ga0070696_1000467972 278
316 3300005563 Ga0068855_100108197 Ga0068855_1001081973 278
317 3300005577 Ga0068857_100000679 Ga0068857_10000067912 278
318 3300005615 Ga0070702_100005004 Ga0070702_1000050044 278
319 3300005616 Ga0068852_100026596 Ga0068852_1000265963 278
320 3300005834 Ga0068851_10000043 Ga0068851_1000004311 278
321 3300005844 Ga0068862_100096755 Ga0068862_1000967551 278
322 3300005985 Ga0081539_10000015 Ga0081539_100000159 278
323 3300006178 Ga0075367_10015307 Ga0075367_100153073 278
324 3300006237 Ga0097621_100045271 Ga0097621_1000452713 278
325 3300006353 Ga0075370_10075457 Ga0075370_100754572 278
326 3300006358 Ga0068871_100069945 Ga0068871_1000699452 278
327 3300009101 Ga0105247_10011158 Ga0105247_100111583 278
328 3300009174 Ga0105241_10156890 Ga0105241_101568902 278
329 3300009177 Ga0105248_10000796 Ga0105248_100007962 278
330 3300009545 Ga0105237_10307351 Ga0105237_103073512 278
331 3300009551 Ga0105238_10000990 Ga0105238_100009907 278
332 3300010375 Ga0105239_10294439 Ga0105239_102944392 278
333 3300013308 Ga0157375_10070964 Ga0157375_100709642 278
334 3300013308 Ga0157375_10383042 Ga0157375_103830422 278
335 3300025321 Ga0207656_10000001 Ga0207656_10000001600 278
336 3300025321 Ga0207656_10000003 Ga0207656_10000003706 278
337 3300025321 Ga0207656_10000004 Ga0207656_10000004563 278
338 3300025903 Ga0207680_10019837 Ga0207680_100198372 278
339 3300025903 Ga0207680_10020065 Ga0207680_100200653 278
340 3300025904 Ga0207647_10005591 Ga0207647_100055918 278
341 3300025909 Ga0207705_10014168 Ga0207705_100141682 278
342 3300025909 Ga0207705_10258268 Ga0207705_102582682 278
343 3300025914 Ga0207671_10000001 Ga0207671_10000001598 278
344 3300025919 Ga0207657_10209298 Ga0207657_102092982 278
345 3300025924 Ga0207694_10000047 Ga0207694_1000004742 278
346 3300025932 Ga0207690_10316542 Ga0207690_103165421 278
347 3300025941 Ga0207711_10001765 Ga0207711_100017655 278
348 3300025949 Ga0207667_10001391 Ga0207667_1000139112 278
349 3300026116 Ga0207674_10006995 Ga0207674_100069955 278
350 3300026121 Ga0207683_10000893 Ga0207683_1000089316 278
351 3300026142 Ga0207698_10000325 Ga0207698_100003258 278
352 3300031995 Ga0307409_100363558 Ga0307409_1003635582 278
353 3300032126 Ga0307415_100170871 Ga0307415_1001708712 278
354 3300037312 Ga0395899_0014879 Ga0395899_0014879_3457_4365 278
355 3300037418 Ga0395900_0013692 Ga0395900_0013692_913_1764 278
356 3300037418 Ga0395900_0106478 Ga0395900_0106478_587_1474 278
357 3300037418 Ga0395900_0206677 Ga0395900_0206677_73_951 278
358 3300037418 Ga0395900_0618234 Ga0395900_0618234_54_962 278
359 3300037466 Ga0395898_0195454 Ga0395898_0195454_211_1119 278
360 3300038443 Ga0395901_0044683 Ga0395901_0044683_2070_2978 278
361 3300038443 Ga0395901_0138510 Ga0395901_0138510_501_1352 278
362 3300038443 Ga0395901_0273236 Ga0395901_0273236_272_1159 278
363 3300044683 Ga0466965_0009347 Ga0466965_0009347_2008_2895 278
364 3300046476 Ga0495662_0017521 Ga0495662_0017521_210_1091 278
365 3300048906 Ga0496103_0051860 Ga0496103_0051860_880_1740 278
366 3300048907 Ga0496104_0061203 Ga0496104_0061203_2084_2944 278
367 3300048910 Ga0496107_0352838 Ga0496107_0352838_59_919 278
368 3300048911 Ga0496108_0026032 Ga0496108_0026032_3068_3928 278
369 3300048912 Ga0496109_0042257 Ga0496109_0042257_342_1202 278
370 3300048913 Ga0496110_0015868 Ga0496110_0015868_4679_5539 278
371 3300048914 Ga0496111_0023603 Ga0496111_0023603_3177_4037 278
372 3300048915 Ga0496112_0010337 Ga0496112_0010337_5177_6037 278
373 3300048917 Ga0496114_0032121 Ga0496114_0032121_1420_2280 278
374 3300048917 Ga0496114_0200241 Ga0496114_0200241_48_986 278
375 3300048923 Ga0496120_0023475 Ga0496120_0023475_736_1572 278
376 3300049568 Ga0501031_0171724 Ga0501031_0171724_343_1215 278
377 3300049569 Ga0501032_0047607 Ga0501032_0047607_2035_2883 278
378 3300049570 Ga0501033_0070474 Ga0501033_0070474_37_885 278
379 3300049571 Ga0501034_0011189 Ga0501034_0011189_6408_7244 278
380 3300049571 Ga0501034_0026967 Ga0501034_0026967_2206_3066 278
381 3300049572 Ga0501036_0047355 Ga0501036_0047355_1920_2789 278
382 3300049573 Ga0501037_0015228 Ga0501037_0015228_421_1257 278
383 3300049574 Ga0501038_0106279 Ga0501038_0106279_319_1167 278
384 3300049575 Ga0501039_0171666 Ga0501039_0171666_258_1106 278
385 3300049579 Ga0501043_0113183 Ga0501043_0113183_414_1262 278
386 3300049581 Ga0501047_0046170 Ga0501047_0046170_2757_3593 278
387 3300049583 Ga0501067_0008863 Ga0501067_0008863_941_1816 278
388 3300049586 Ga0501070_0226239 Ga0501070_0226239_210_1058 278
389 3300049588 Ga0501072_0383250 Ga0501072_0383250_149_1009 278
390 3300049589 Ga0501073_0096568 Ga0501073_0096568_900_1748 278
391 3300049823 Ga0501044_0007662 Ga0501044_0007662_4614_5450 278
392 3300050496 nmdc:mga07m45_123473_c1 nmdc:mga07m45_123473_c1_202_1071 278
393 iso_pu_bacteria 2643221690 2644504985 278
394 iso_pu_bacteria 2773857762 2774394709 278
395 iso_pu_bacteria 2808606439 2809194447 278
396 iso_pu_bacteria 2811994874 2812331308 278
397 iso_pu_bacteria 2811994878 2812349196 278
398 iso_pu_bacteria 2811994880 2812362412 278
399 iso_pu_bacteria 2848551377 2848552189 278
400 iso_pu_bacteria 2891968417 2891973093 278
401 iso_pu_bacteria 2919051321 2919052857 278
402 3300005334 Ga0068869_100011503 Ga0068869_1000115033 279
403 3300005335 Ga0070666_10019310 Ga0070666_100193103 279
404 3300005338 Ga0068868_100003538 Ga0068868_1000035383 279
405 3300005338 Ga0068868_100073895 Ga0068868_1000738953 279
406 3300005339 Ga0070660_100143210 Ga0070660_1001432102 279
407 3300005339 Ga0070660_100149931 Ga0070660_1001499312 279
408 3300005339 Ga0070660_100301230 Ga0070660_1003012302 279
409 3300005345 Ga0070692_10011261 Ga0070692_100112613 279
410 3300005347 Ga0070668_100107076 Ga0070668_1001070762 279
411 3300005353 Ga0070669_100011447 Ga0070669_1000114472 279
412 3300005353 Ga0070669_100074264 Ga0070669_1000742642 279
413 3300005354 Ga0070675_100003497 Ga0070675_1000034976 279
414 3300005354 Ga0070675_100232115 Ga0070675_1002321152 279
415 3300005366 Ga0070659_100011867 Ga0070659_1000118677 279
416 3300005366 Ga0070659_100015801 Ga0070659_1000158012 279
417 3300005366 Ga0070659_100164258 Ga0070659_1001642581 279
418 3300005444 Ga0070694_100067911 Ga0070694_1000679112 279
419 3300005459 Ga0068867_100112578 Ga0068867_1001125782 279
420 3300005563 Ga0068855_100117728 Ga0068855_1001177282 279
421 3300005577 Ga0068857_100155919 Ga0068857_1001559191 279
422 3300005842 Ga0068858_100051879 Ga0068858_1000518792 279
423 3300006058 Ga0075432_10000977 Ga0075432_100009773 279
424 3300006058 Ga0075432_10003439 Ga0075432_100034393 279
425 3300006852 Ga0075433_10072382 Ga0075433_100723822 279
426 3300009093 Ga0105240_10072773 Ga0105240_100727734 279
427 3300009098 Ga0105245_10155757 Ga0105245_101557572 279
428 3300009176 Ga0105242_10013233 Ga0105242_100132335 279
429 3300009553 Ga0105249_10007621 Ga0105249_1000762112 279
430 3300011119 Ga0105246_10004339 Ga0105246_100043395 279
431 3300011119 Ga0105246_10004787 Ga0105246_100047875 279
432 3300013100 Ga0157373_10058774 Ga0157373_100587742 279
433 3300013104 Ga0157370_10059863 Ga0157370_100598635 279
434 3300013105 Ga0157369_10050315 Ga0157369_100503153 279
435 3300014969 Ga0157376_10450498 Ga0157376_104504982 279
436 3300017792 Ga0163161_10357160 Ga0163161_103571602 279
437 3300025254 Ga0209148_1009645 Ga0209148_10096452 279
438 3300025303 Ga0209051_1026483 Ga0209051_10264832 279
439 3300025728 Ga0207655_1012056 Ga0207655_10120565 279
440 3300025901 Ga0207688_10001644 Ga0207688_100016449 279
441 3300025907 Ga0207645_10055333 Ga0207645_100553331 279
442 3300025919 Ga0207657_10004685 Ga0207657_1000468511 279
443 3300025919 Ga0207657_10074517 Ga0207657_100745172 279
444 3300025923 Ga0207681_10103584 Ga0207681_101035841 279
445 3300025925 Ga0207650_10057841 Ga0207650_100578412 279
446 3300025926 Ga0207659_10141418 Ga0207659_101414182 279
447 3300025932 Ga0207690_10000634 Ga0207690_100006344 279
448 3300025939 Ga0207665_10000538 Ga0207665_1000053813 279
449 3300025940 Ga0207691_10001407 Ga0207691_100014073 279
450 3300025942 Ga0207689_10006706 Ga0207689_100067066 279
451 3300026067 Ga0207678_10016395 Ga0207678_100163954 279
452 3300026075 Ga0207708_10009485 Ga0207708_100094855 279
453 3300026089 Ga0207648_10133371 Ga0207648_101333712 279
454 3300026118 Ga0207675_100012912 Ga0207675_1000129123 279
455 3300026121 Ga0207683_10031308 Ga0207683_100313083 279
456 3300026142 Ga0207698_10076983 Ga0207698_100769832 279
457 3300027907 Ga0207428_10027367 Ga0207428_100273672 279
458 3300031507 Ga0307509_10045172 Ga0307509_100451722 279
459 3300031548 Ga0307408_100028445 Ga0307408_1000284452 279
460 3300031548 Ga0307408_100028564 Ga0307408_1000285643 279
461 3300031548 Ga0307408_100074623 Ga0307408_1000746232 279
462 3300031548 Ga0307408_100081643 Ga0307408_1000816432 279
463 3300031548 Ga0307408_100139142 Ga0307408_1001391422 279
464 3300031548 Ga0307408_100185578 Ga0307408_1001855782 279
465 3300031548 Ga0307408_100223538 Ga0307408_1002235382 279
466 3300031731 Ga0307405_10012485 Ga0307405_100124854 279
467 3300031731 Ga0307405_10177055 Ga0307405_101770552 279
468 3300031731 Ga0307405_10298740 Ga0307405_102987401 279
469 3300031731 Ga0307405_10414128 Ga0307405_104141281 279
470 3300031824 Ga0307413_10095613 Ga0307413_100956132 279
471 3300031824 Ga0307413_10218402 Ga0307413_102184021 279
472 3300031852 Ga0307410_10011737 Ga0307410_100117372 279
473 3300031852 Ga0307410_10039429 Ga0307410_100394292 279
474 3300031852 Ga0307410_10196435 Ga0307410_101964352 279
475 3300031852 Ga0307410_10575817 Ga0307410_105758171 279
476 3300031901 Ga0307406_10079316 Ga0307406_100793162 279
477 3300031901 Ga0307406_10110129 Ga0307406_101101291 279
478 3300031901 Ga0307406_10111794 Ga0307406_101117942 279
479 3300031901 Ga0307406_10135826 Ga0307406_101358262 279
480 3300031903 Ga0307407_10013057 Ga0307407_100130573 279
481 3300031903 Ga0307407_10050304 Ga0307407_100503042 279
482 3300031903 Ga0307407_10249006 Ga0307407_102490062 279
483 3300031911 Ga0307412_10010488 Ga0307412_100104882 279
484 3300031911 Ga0307412_10013288 Ga0307412_100132883 279
485 3300031911 Ga0307412_10016632 Ga0307412_100166322 279
486 3300031911 Ga0307412_10043435 Ga0307412_100434352 279
487 3300031911 Ga0307412_10065915 Ga0307412_100659152 279
488 3300031911 Ga0307412_10158358 Ga0307412_101583582 279
489 3300031911 Ga0307412_10371765 Ga0307412_103717652 279
490 3300031995 Ga0307409_100009471 Ga0307409_1000094714 279
491 3300031995 Ga0307409_100025026 Ga0307409_1000250262 279
492 3300031995 Ga0307409_100040406 Ga0307409_1000404063 279
493 3300032002 Ga0307416_100333248 Ga0307416_1003332481 279
494 3300032002 Ga0307416_100919382 Ga0307416_1009193821 279
495 3300032004 Ga0307414_10014981 Ga0307414_100149812 279
496 3300032005 Ga0307411_10002303 Ga0307411_100023033 279
497 3300032005 Ga0307411_10012902 Ga0307411_100129022 279
498 3300032005 Ga0307411_10062252 Ga0307411_100622522 279
499 3300032005 Ga0307411_10179900 Ga0307411_101799001 279
500 3300032126 Ga0307415_100255891 Ga0307415_1002558911 279
501 3300032126 Ga0307415_100275733 Ga0307415_1002757332 279
502 3300035084 Ga0373928_0022565 Ga0373928_0022565_439_1302 279
503 3300035114 Ga0373939_0044066 Ga0373939_0044066_259_1122 279
504 3300035121 Ga0373960_0039463 Ga0373960_0039463_293_1171 279
505 3300037418 Ga0395900_0044192 Ga0395900_0044192_1039_1926 279
506 3300037471 Ga0395905_0088374 Ga0395905_0088374_285_1172 279
507 3300038443 Ga0395901_0169457 Ga0395901_0169457_417_1304 279
508 3300041404 Ga0439436_0005607 Ga0439436_0005607_2321_3208 279
509 3300041404 Ga0439436_0010559 Ga0439436_0010559_894_1766 279
510 3300041405 Ga0439438_056638 Ga0439438_056638_39_911 279
511 3300041411 Ga0439466_0028844 Ga0439466_0028844_109_996 279
512 3300041413 Ga0439465_0007915 Ga0439465_0007915_379_1266 279
513 3300041997 Ga0439431_0034262 Ga0439431_0034262_109_996 279
514 3300041999 Ga0439433_0000289 Ga0439433_0000289_4656_5543 279
515 3300042002 Ga0439442_000074 Ga0439442_000074_8975_9847 279
516 3300042002 Ga0439442_000309 Ga0439442_000309_1254_2126 279
517 3300042006 Ga0439432_018983 Ga0439432_018983_1272_2144 279
518 3300042007 Ga0439449_0001007 Ga0439449_0001007_1818_2705 279
519 3300042007 Ga0439449_0004716 Ga0439449_0004716_1029_1901 279
520 3300042007 Ga0439449_0011638 Ga0439449_0011638_603_1490 279
521 3300042014 Ga0439457_008285 Ga0439457_008285_859_1731 279
522 3300042122 Ga0450920_003618 Ga0450920_003618_1564_2436 279
523 3300042122 Ga0450920_005271 Ga0450920_005271_19_891 279
524 3300042146 Ga0450907_000685 Ga0450907_000685_2662_3534 279
525 3300042435 Ga0439434_0000180 Ga0439434_0000180_12680_13552 279
526 3300042435 Ga0439434_0047817 Ga0439434_0047817_196_1083 279
527 3300042531 Ga0450918_002799 Ga0450918_002799_1821_2693 279
528 3300044735 Ga0466968_0029514 Ga0466968_0029514_171_1022 279
529 3300044765 Ga0466970_0004720 Ga0466970_0004720_1056_1901 279
530 3300044765 Ga0466970_0010804 Ga0466970_0010804_2278_3198 279
531 3300044765 Ga0466970_0182946 Ga0466970_0182946_201_1052 279
532 3300044901 Ga0466960_0040834 Ga0466960_0040834_933_1778 279
533 3300046462 Ga0495651_0000707 Ga0495651_0000707_22614_23549 279
534 3300046472 Ga0495580_0021576 Ga0495580_0021576_2065_2946 279
535 3300046543 Ga0495645_0006410 Ga0495645_0006410_220_1152 279
536 3300046663 Ga0495635_0001469 Ga0495635_0001469_2481_3413 279
537 3300046809 Ga0495600_0035163 Ga0495600_0035163_551_1483 279
538 3300048904 Ga0496101_0396177 Ga0496101_0396177_151_1032 279
539 3300048905 Ga0496102_0012978 Ga0496102_0012978_4114_4995 279
540 3300048905 Ga0496102_0124555 Ga0496102_0124555_956_1843 279
541 3300048906 Ga0496103_0039961 Ga0496103_0039961_1181_2068 279
542 3300048906 Ga0496103_0168267 Ga0496103_0168267_469_1350 279
543 3300048911 Ga0496108_0196431 Ga0496108_0196431_573_1493 279
544 3300048915 Ga0496112_0021726 Ga0496112_0021726_3694_4575 279
545 3300048916 Ga0496113_0358927 Ga0496113_0358927_167_1039 279
546 3300048921 Ga0496118_0044670 Ga0496118_0044670_815_1768 279
547 3300048922 Ga0496119_0137093 Ga0496119_0137093_19_972 279
548 3300048925 Ga0496122_0001925 Ga0496122_0001925_13522_14472 279
549 3300048925 Ga0496122_0002333 Ga0496122_0002333_21128_22081 279
550 3300048926 Ga0496123_0000172 Ga0496123_0000172_90908_91858 279
551 3300048927 Ga0496124_0002762 Ga0496124_0002762_7474_8424 279
552 3300048928 Ga0496125_0001307 Ga0496125_0001307_6965_7933 279
553 3300048929 Ga0496126_0287006 Ga0496126_0287006_86_1111 279
554 3300049568 Ga0501031_0003781 Ga0501031_0003781_288_1130 279
555 3300049568 Ga0501031_0015138 Ga0501031_0015138_2401_3408 279
556 3300049569 Ga0501032_0000979 Ga0501032_0000979_3140_4147 279
557 3300049570 Ga0501033_0003369 Ga0501033_0003369_9806_10648 279
558 3300049571 Ga0501034_0079025 Ga0501034_0079025_1076_1918 279
559 3300049572 Ga0501036_0067953 Ga0501036_0067953_1811_2653 279
560 3300049573 Ga0501037_0299713 Ga0501037_0299713_204_1046 279
561 3300049574 Ga0501038_0011689 Ga0501038_0011689_3952_4959 279
562 3300049575 Ga0501039_0182803 Ga0501039_0182803_676_1518 279
563 3300049579 Ga0501043_0106064 Ga0501043_0106064_1171_2178 279
564 3300049580 Ga0501046_0002697 Ga0501046_0002697_10762_11769 279
565 3300049581 Ga0501047_0033662 Ga0501047_0033662_797_1804 279
566 3300049744 Ga0501083_0012626 Ga0501083_0012626_3184_4191 279
567 3300049822 Ga0501035_0025218 Ga0501035_0025218_3840_4847 279
568 3300049822 Ga0501035_0098038 Ga0501035_0098038_987_1829 279
569 3300049823 Ga0501044_0041340 Ga0501044_0041340_2186_3193 279
570 3300050492 nmdc:mga0yw44_75153_c1 nmdc:mga0yw44_75153_c1_1029_1892 279
571 3300050507 nmdc:mga05p37_511036_c1 nmdc:mga05p37_511036_c1_29_916 279
572 3300050515 nmdc:mga0a205_17758_c1 nmdc:mga0a205_17758_c1_165_1028 279
573 3300053078 Ga0495612_0013418 Ga0495612_0013418_1179_2111 279
574 3300059510 Ga0587090_011374 Ga0587090_011374_105_986 279
575 3300060353 Ga0501082_0005130 Ga0501082_0005130_304_1311 279
576 iso_pu_bacteria 2554235227 2555229689 279
577 iso_pu_bacteria 2643221613 2644080693 279
578 iso_pu_bacteria 2643221694 2644527276 279
579 iso_pu_bacteria 2643221722 2644667685 279
580 iso_pu_bacteria 2643221961 2645722545 279
581 iso_pu_bacteria 2643221962 2645725516 279
582 iso_pu_bacteria 2654587600 2655031714 279
583 iso_pu_bacteria 2690315906 2691513259 279
584 iso_pu_bacteria 2775506735 2775656380 279
585 iso_pu_bacteria 2808606357 2808830502 279
586 iso_pu_bacteria 2808606360 2808851697 279
587 iso_pu_bacteria 2808606366 2808875823 279
588 iso_pu_bacteria 2808606370 2808894766 279
589 iso_pu_bacteria 2808606371 2808895717 279
590 iso_pu_bacteria 2808606700 2810363326 279
591 iso_pu_bacteria 2811994871 2812317740 279
592 iso_pu_bacteria 2844849076 2844852028 279
593 iso_pu_bacteria 2857740372 2857740452 279
594 iso_pu_bacteria 2904497146 2904499406 279
595 iso_pu_bacteria 2904776348 2904778509 279
596 iso_pu_bacteria 2905926851 2905928241 279
597 iso_pu_bacteria 2910809715 2910813683 279
598 iso_pu_bacteria 2919034639 2919035866 279
599 iso_pu_bacteria 2919059106 2919060562 279
600 iso_pu_bacteria 2919391150 2919392188 279
601 iso_pu_bacteria 2919538618 2919538922 279
602 iso_pu_bacteria 2932426870 2932427503 279
603 iso_pu_bacteria 2933418574 2933418908 279
604 iso_pu_bacteria 2939598168 2939599813 279
605 iso_pu_bacteria 2939647034 2939648162 279
606 iso_pu_bacteria 2939674588 2939677081 279
607 iso_pu_bacteria 2945916053 2945919808 279
608 iso_pu_bacteria 2945920336 2945924290 279
609 iso_pu_bacteria 2945941187 2945943992 279
610 iso_pu_bacteria 2945956166 2945957826 279
611 iso_pu_bacteria 2946003308 2946003795 279
612 iso_pu_bacteria 2946037020 2946039946 279
613 iso_pu_bacteria 2946059875 2946063533 279
614 iso_pu_bacteria 2953998280 2954001178 279
615 iso_pu_bacteria 2974302888 2974303440 279
616 iso_pu_bacteria 8054107350 8054111714 279
617 3300005337 Ga0070682_100107924 Ga0070682_1001079242 280
618 3300009098 Ga0105245_10031931 Ga0105245_100319312 280
619 3300025927 Ga0207687_10237448 Ga0207687_102374481 280
620 3300026116 Ga0207674_10181619 Ga0207674_101816193 280
621 3300031665 Ga0316575_10000061 Ga0316575_1000006114 280
622 3300048914 Ga0496111_0112063 Ga0496111_0112063_421_1305 280
623 3300048917 Ga0496114_0059859 Ga0496114_0059859_90_974 280
624 3300048920 Ga0496117_0052217 Ga0496117_0052217_1702_2601 280
625 3300049572 Ga0501036_0174398 Ga0501036_0174398_833_1687 280
626 3300061734 Ga0530510_0009182 Ga0530510_0009182_819_1685 280
627 3300003762 Ga0055542_1012322 Ga0055542_10123221 281
628 3300005616 Ga0068852_100018937 Ga0068852_1000189372 281
629 3300009093 Ga0105240_10079439 Ga0105240_100794393 281
630 3300009174 Ga0105241_10000427 Ga0105241_1000042720 281
631 3300013105 Ga0157369_10057551 Ga0157369_100575512 281
632 3300014325 Ga0163163_10025760 Ga0163163_100257602 281
633 3300025254 Ga0209148_1001364 Ga0209148_100136410 281
634 3300025911 Ga0207654_10000003 Ga0207654_10000003890 281
635 3300025913 Ga0207695_10007937 Ga0207695_100079379 281
636 3300026078 Ga0207702_10069251 Ga0207702_100692513 281
637 3300037418 Ga0395900_0008728 Ga0395900_0008728_4026_4871 281
638 3300037466 Ga0395898_0000015 Ga0395898_0000015_425581_426426 281
639 3300048917 Ga0496114_0110486 Ga0496114_0110486_909_1796 281
640 iso_pu_bacteria 8056037122 8056039022 281
641 3300044658 Ga0466972_0049853 Ga0466972_0049853_695_1543 282
642 3300044683 Ga0466965_0051254 Ga0466965_0051254_861_1709 282
643 3300044735 Ga0466968_0050283 Ga0466968_0050283_634_1482 282
644 3300048905 Ga0496102_0030958 Ga0496102_0030958_375_1223 282
645 3300049571 Ga0501034_0135942 Ga0501034_0135942_1403_2317 282
646 3300001979 JGI24740J21852_10019648 JGI24740J21852_100196482 283
647 3300003578 Ga0006562J51391_1031829 Ga0006562J51391_10318295 283
648 3300003752 Ga0055539_1000005 Ga0055539_1000005288 283
649 3300025230 Ga0209563_106795 Ga0209563_1067952 283
650 3300044765 Ga0466970_0111578 Ga0466970_0111578_454_1305 283
651 3300045049 Ga0466959_0010201 Ga0466959_0010201_5268_6119 283

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00398

RrnaAD

Ribosomal RNA adenine dimethylase

21

104

0.93

PF00398

RrnaAD

Ribosomal RNA adenine dimethylase

115

308

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
4jxj-assembly1.cif.gz_A crystal structure of ribosomal rna small subunit methyltransferase a from rickettsia bellii determined by iodide sad phasing 0.9325 31 279
4jxj-assembly1.cif.gz_A crystal structure of ribosomal rna small subunit methyltransferase a from rickettsia bellii determined by iodide sad phasing 0.9179 31 279
3tqs-assembly2.cif.gz_B structure of the dimethyladenosine transferase (ksga) from coxiella burnetii 0.9031 29 279
3tqs-assembly2.cif.gz_B structure of the dimethyladenosine transferase (ksga) from coxiella burnetii 0.8891 29 279
6ifv-assembly2.cif.gz_B c-terminal truncated ksga from bacillus subtilis 168 0.8889 5 209
ID Description Score Start End Superfamily
af_P9WH07_6_221_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9906 4 210 3.40.50.150
af_Q54QK7_28_214_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.947 24 212 3.40.50.150
af_P9WH07_6_221_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9452 4 210 3.40.50.150
af_Q54QK7_28_214_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9324 24 212 3.40.50.150
af_Q4D3E1_216_398_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9176 33 83 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A399SMV7-F1-model_v4 16S rRNA (Adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase RsmA (EC 2.1.1.182) 0.9902 36 282 GO:0003723
GO:0005829
GO:0052908
AF-A0A3N1J2K5-F1-model_v4 Ribosomal RNA small subunit methyltransferase A (EC 2.1.1.182) (16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase) (16S rRNA dimethyladenosine transferase) (16S rRNA dimethylase) (S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase) 0.9852 6 282 GO:0003723
GO:0005829
GO:0052908
AF-A0A6M4WP77-F1-model_v4 Ribosomal RNA small subunit methyltransferase A (EC 2.1.1.182) (16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase) (16S rRNA dimethyladenosine transferase) (16S rRNA dimethylase) (S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase) 0.9781 6 280 GO:0003723
GO:0005829
GO:0052908
AF-A0A3P1SBI2-F1-model_v4 Ribosomal RNA small subunit methyltransferase A (EC 2.1.1.182) (16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase) (16S rRNA dimethyladenosine transferase) (16S rRNA dimethylase) (S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase) 0.9778 6 282 GO:0003723
GO:0005829
GO:0052908
AF-A0A1C4KSZ8-F1-model_v4 deleted 0.9777 5 280

Feature Viewer

pLDDT pTM Quality
94.42 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map