F472635
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 651 | 356 | 594 | 284 |
Family's Representative Sequence
| Representative Sequence | 3300049568|Ga0501031_0015138|Ga0501031_0015138_2401_3408 |
| Length | 335 |
| Sequence | VQTVALLGPAEIRELAERAGVRPTKTLGQNFVLDAGTVRKIVRQADVEPGDRVVEVGPGLGSLTLGLLEAGADVVAVEIDPVLARLLPETVTRHVPGLTIAGDEPEPAGPDGAPVVVLRDADGRDRLTVVTSDALDVRALPGRPPEALVANLPYNVSVPVLLTFLERFDSLARVLVMVQAEVADRLAAPPGSRTYGVPSVKAAWYASARRTATVGRSVFWPAPNVDSALVRLDRRPTPVTTVSREDVFAVVDSAFAQRRKMLRSALAPLAGSADAAERALVAAGVDPQARGERVDVDGFARVAEALAAAGIAASPRPADVPAEEPGGGGPGRVAP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2554235227 | Arthrobacter sp. PAO19 | Isolate | Rhizosphere |
| 2 | 2643221613 | Oerskovia sp. Root22 | Isolate | Unclassified |
| 3 | 2643221632 | Leifsonia sp. Root112D2 | Isolate | Unclassified |
| 4 | 2643221690 | Cellulomonas sp. Root485 | Isolate | Unclassified |
| 5 | 2643221694 | Cellulomonas sp. Root137 | Isolate | Unclassified |
| 6 | 2643221697 | Aeromicrobium sp. Root495 | Isolate | Unclassified |
| 7 | 2643221722 | Cellulomonas sp. Root930 | Isolate | Unclassified |
| 8 | 2643221961 | Aeromicrobium sp. Root236 | Isolate | Unclassified |
| 9 | 2643221962 | Aeromicrobium sp. Root344 | Isolate | Unclassified |
| 10 | 2654587600 | Glutamicibacter halophytocola KLBMP5180 | Isolate | Unclassified |
| 11 | 2690315906 | Arthrobacter sp. OY3WO11 | Isolate | Unclassified |
| 12 | 2773857762 | Nocardioides sp. SAI-095 | Isolate | Unclassified |
| 13 | 2775506735 | Arthrobacter sp. S95 1704 | Isolate | Unclassified |
| 14 | 2808606357 | Arthrobacter sp. SLBN-122 | Isolate | Unclassified |
| 15 | 2808606360 | Arthrobacter sp. SLBN-112 | Isolate | Unclassified |
| 16 | 2808606366 | Arthrobacter sp. SLBN-83 | Isolate | Unclassified |
| 17 | 2808606370 | Arthrobacter sp. SLBN-100 | Isolate | Unclassified |
| 18 | 2808606371 | Arthrobacter sp. SLBN-53 | Isolate | Unclassified |
| 19 | 2808606439 | Nocardioides sp. SLBN-172 | Isolate | Unclassified |
| 20 | 2808606700 | Arthrobacter agilis UMCV2 | Isolate | Rhizosphere |
| 21 | 2811994871 | Arthrobacter sp. SLBN-179 | Isolate | Unclassified |
| 22 | 2811994874 | Nocardioides sp. SLBN-35 | Isolate | Unclassified |
| 23 | 2811994878 | Nocardioides sp. SLBN-169 | Isolate | Unclassified |
| 24 | 2811994880 | Cellulomonas sp. SLBN-39 | Isolate | Unclassified |
| 25 | 2816332139 | Pseudonocardia kunmingensis DSM 45301 | Isolate | Unclassified |
| 26 | 2837268691 | Jiangella endophytica KE2-3 | Isolate | Rhizosphere |
| 27 | 2844849076 | Arthrobacter cupressi DSM 24664 | Isolate | Rhizosphere |
| 28 | 2848551377 | Brachybacterium saurashtrense DSM 23186 | Isolate | Unclassified |
| 29 | 2857740372 | Paenarthrobacter sp. R-74611 | Isolate | Unclassified |
| 30 | 2884994152 | Cellulomonas sp. H30R-01 | Isolate | Rhizosphere |
| 31 | 2891968417 | Nocardioides luteus SAI-037 | Isolate | Unclassified |
| 32 | 2904497146 | Arthrobacter sp. 1276 | Isolate | Rhizosphere |
| 33 | 2904776348 | Paenarthrobacter sp. 1092 | Isolate | Rhizosphere |
| 34 | 2905926851 | Arthrobacter sedimenti MIC A30 | Isolate | Rhizosphere |
| 35 | 2910809715 | Paenarthrobacter sp. CM16 | Isolate | Unclassified |
| 36 | 2919034639 | Paenarthrobacter nitroguajacolicus 247 | Isolate | Rhizosphere |
| 37 | 2919051321 | Sinomonas atrocyanea 1003 | Isolate | Rhizosphere |
| 38 | 2919059106 | Arthrobacter sp. 1088 | Isolate | Rhizosphere |
| 39 | 2919391150 | Arthrobacter ipis 2973 | Isolate | Unclassified |
| 40 | 2919538618 | Paenarthrobacter nitroguajacolicus 3945 | Isolate | Unclassified |
| 41 | 2932426870 | Paenarthrobacter sp. 4246 | Isolate | Rhizosphere |
| 42 | 2933418574 | Jeotgalibacillus campisalis 4120 | Isolate | Rhizosphere |
| 43 | 2939598168 | Arthrobacter sp. 754 | Isolate | Rhizosphere |
| 44 | 2939647034 | Arthrobacter sp. 2762 | Isolate | Rhizosphere |
| 45 | 2939674588 | Arthrobacter bambusae 3552 | Isolate | Rhizosphere |
| 46 | 2945916053 | Arthrobacter ulcerisalmonis W1I2 | Isolate | Rhizosphere |
| 47 | 2945920336 | Pseudarthrobacter siccitolerans W1I3 | Isolate | Rhizosphere |
| 48 | 2945941187 | Arthrobacter pascens W1I14 | Isolate | Rhizosphere |
| 49 | 2945956166 | Arthrobacter globiformus W2I3 | Isolate | Rhizosphere |
| 50 | 2946003308 | Arthrobacter agilis W3I6 | Isolate | Rhizosphere |
| 51 | 2946037020 | Arthrobacter sp. W4I7 | Isolate | Rhizosphere |
| 52 | 2946059875 | Arthrobacter sp. SLBN-112 | Isolate | Rhizosphere |
| 53 | 2953998280 | Pseudarthrobacter sp. W1I19 | Isolate | Rhizosphere |
| 54 | 2974302888 | Pseudarthrobacter sp. SORGH_AS 212 | Isolate | Unclassified |
| 55 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 56 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 57 | 3300003285 | Grassland soil microbial communities from Hopland, California, USA - Sample H3_Rhizo_39 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 58 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 59 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 60 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 61 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 64 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 66 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 68 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 80 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 83 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 85 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 86 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 87 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 91 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 92 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 93 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 95 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 96 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 97 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 98 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 99 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 100 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 101 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 102 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 103 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 104 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 105 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 106 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 107 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 108 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 110 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 111 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 112 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 113 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 138 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 139 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 142 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 185 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 187 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 188 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 189 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 190 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 191 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 192 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 193 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 194 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 195 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 196 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 197 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 198 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 199 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 200 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 201 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 202 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 203 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 204 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 205 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 206 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 207 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 208 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 209 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 210 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 211 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 212 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 213 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 214 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 215 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 216 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 217 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 218 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 219 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 220 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 221 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 222 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 223 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 224 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 225 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 226 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 227 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 228 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 229 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 230 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 231 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 232 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 233 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 234 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 235 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 236 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 237 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 238 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 239 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 240 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 241 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 273 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 274 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 275 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 276 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 277 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 278 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 279 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 280 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 281 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 282 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 283 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 284 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 285 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 286 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 287 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 288 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 289 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 290 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 291 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 292 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 293 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 294 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 295 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 296 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 297 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 298 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 329 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 330 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 331 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 332 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 333 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 334 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 335 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 336 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 337 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 338 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 339 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 340 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 342 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 343 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 344 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 345 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 346 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 347 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 349 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 350 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 351 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 353 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 354 | 8054107350 | Arthrobacter rhizosphaerae CCNWLXL 1-35 | Isolate | Rhizosphere |
| 355 | 8056037122 | Herbiconiux gentiana CPCC 205716 | Isolate | Rhizosphere |
| 356 | 8056060235 | Nocardiopsis endophytica RSe5-2 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.02 |
| Metatranscriptomes | 1.23 |
| Isolates | 8.76 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.22 |
| Nodule | 0 |
| Rhizoplane | 7.37 |
| Rhizosphere | 78.96 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.45 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10019648 | 3300001979 | Bacteria | 2375 |
| 2 | JGI25152J39213_1000574 | 3300002773 | Bacteria | 19978 |
| 3 | Ga0007423J48922_100316 | 3300003285 | Bacteria | 7621 |
| 4 | Ga0006562J51391_1031829 | 3300003578 | Bacteria | 7110 |
| 5 | Ga0006562J51391_1099017 | 3300003578 | Bacteria | 1520 |
| 6 | Ga0055539_1000005 | 3300003752 | Bacteria | 609598 |
| 7 | Ga0055542_1012322 | 3300003762 | Bacteria | 1482 |
| 8 | Ga0070658_10000294 | 3300005327 | Bacteria | 43582 |
| 9 | Ga0070658_10005814 | 3300005327 | Bacteria | 9994 |
| 10 | Ga0070658_10039126 | 3300005327 | Bacteria | 3825 |
| 11 | Ga0070658_10154370 | 3300005327 | Bacteria | 1924 |
| 12 | Ga0070670_100137032 | 3300005331 | Bacteria | 2115 |
| 13 | Ga0068869_100011503 | 3300005334 | Bacteria | 5805 |
| 14 | Ga0070666_10019310 | 3300005335 | Bacteria | 4397 |
| 15 | Ga0070666_10032696 | 3300005335 | Bacteria | 3437 |
| 16 | Ga0070680_100306881 | 3300005336 | Bacteria | 1346 |
| 17 | Ga0070682_100030642 | 3300005337 | Bacteria | 3249 |
| 18 | Ga0070682_100107924 | 3300005337 | Bacteria | 1850 |
| 19 | Ga0068868_100003538 | 3300005338 | Bacteria | 10886 |
| 20 | Ga0068868_100073895 | 3300005338 | Bacteria | 2722 |
| 21 | Ga0070660_100047943 | 3300005339 | Bacteria | 3280 |
| 22 | Ga0070660_100143210 | 3300005339 | Bacteria | 1919 |
| 23 | Ga0070660_100149931 | 3300005339 | Bacteria | 1875 |
| 24 | Ga0070660_100301230 | 3300005339 | Bacteria | 1314 |
| 25 | Ga0070692_10011261 | 3300005345 | Bacteria | 4101 |
| 26 | Ga0070668_100107076 | 3300005347 | Bacteria | 2222 |
| 27 | Ga0070669_100011447 | 3300005353 | Bacteria | 6297 |
| 28 | Ga0070669_100074264 | 3300005353 | Bacteria | 2521 |
| 29 | Ga0070675_100003497 | 3300005354 | Bacteria | 11915 |
| 30 | Ga0070675_100232115 | 3300005354 | Bacteria | 1610 |
| 31 | Ga0070659_100011867 | 3300005366 | Bacteria | 6449 |
| 32 | Ga0070659_100015801 | 3300005366 | Bacteria | 5658 |
| 33 | Ga0070659_100164258 | 3300005366 | Bacteria | 1816 |
| 34 | Ga0070659_100256620 | 3300005366 | Bacteria | 1450 |
| 35 | Ga0070703_10022665 | 3300005406 | Bacteria | 1845 |
| 36 | Ga0070713_100614065 | 3300005436 | Bacteria | 1034 |
| 37 | Ga0070700_100292710 | 3300005441 | Bacteria | 1185 |
| 38 | Ga0070694_100067911 | 3300005444 | Bacteria | 2448 |
| 39 | Ga0070708_100001304 | 3300005445 | Bacteria | 19131 |
| 40 | Ga0070708_100142600 | 3300005445 | Bacteria | 2223 |
| 41 | Ga0068867_100112578 | 3300005459 | Bacteria | 2093 |
| 42 | Ga0070706_100160674 | 3300005467 | Bacteria | 2098 |
| 43 | Ga0070706_100224912 | 3300005467 | Bacteria | 1752 |
| 44 | Ga0070706_100418274 | 3300005467 | Bacteria | 1247 |
| 45 | Ga0070707_100006788 | 3300005468 | Bacteria | 10596 |
| 46 | Ga0070707_100112882 | 3300005468 | Bacteria | 2636 |
| 47 | Ga0070698_100013237 | 3300005471 | Bacteria | 8728 |
| 48 | Ga0070699_100042834 | 3300005518 | Bacteria | 3917 |
| 49 | Ga0070679_100161887 | 3300005530 | Bacteria | 2212 |
| 50 | Ga0070686_100168400 | 3300005544 | Bacteria | 1548 |
| 51 | Ga0070695_100043453 | 3300005545 | Bacteria | 2857 |
| 52 | Ga0070696_100046797 | 3300005546 | Bacteria | 3000 |
| 53 | Ga0070693_100117289 | 3300005547 | Bacteria | 1646 |
| 54 | Ga0070665_100014657 | 3300005548 | Bacteria | 7867 |
| 55 | Ga0070665_100177716 | 3300005548 | Bacteria | 2129 |
| 56 | Ga0068855_100108197 | 3300005563 | Bacteria | 3193 |
| 57 | Ga0068855_100117728 | 3300005563 | Bacteria | 3043 |
| 58 | Ga0068857_100000679 | 3300005577 | Bacteria | 25267 |
| 59 | Ga0068857_100155919 | 3300005577 | Bacteria | 2070 |
| 60 | Ga0068856_100196052 | 3300005614 | Bacteria | 2034 |
| 61 | Ga0070702_100005004 | 3300005615 | Bacteria | 6121 |
| 62 | Ga0068852_100018937 | 3300005616 | Bacteria | 5437 |
| 63 | Ga0068852_100026596 | 3300005616 | Bacteria | 4706 |
| 64 | Ga0068859_100220569 | 3300005617 | Bacteria | 1984 |
| 65 | Ga0068864_100165063 | 3300005618 | Bacteria | 2015 |
| 66 | Ga0068861_100372655 | 3300005719 | Bacteria | 1259 |
| 67 | Ga0068851_10000043 | 3300005834 | Bacteria | 87775 |
| 68 | Ga0068863_100200201 | 3300005841 | Bacteria | 1921 |
| 69 | Ga0068858_100051879 | 3300005842 | Bacteria | 3795 |
| 70 | Ga0068862_100096755 | 3300005844 | Bacteria | 2577 |
| 71 | Ga0081539_10000015 | 3300005985 | Bacteria | 395781 |
| 72 | Ga0075365_10005224 | 3300006038 | Bacteria | 6984 |
| 73 | Ga0075368_10090537 | 3300006042 | Bacteria | 1251 |
| 74 | Ga0075364_10010750 | 3300006051 | Bacteria | 5538 |
| 75 | Ga0075364_10028857 | 3300006051 | Bacteria | 3554 |
| 76 | Ga0075432_10000977 | 3300006058 | Bacteria | 9031 |
| 77 | Ga0075432_10003439 | 3300006058 | Bacteria | 5359 |
| 78 | Ga0075367_10015307 | 3300006178 | Bacteria | 4165 |
| 79 | Ga0097621_100045271 | 3300006237 | Bacteria | 3553 |
| 80 | Ga0075370_10013844 | 3300006353 | Bacteria | 4292 |
| 81 | Ga0075370_10075457 | 3300006353 | Bacteria | 1933 |
| 82 | Ga0068871_100069945 | 3300006358 | Bacteria | 2884 |
| 83 | Ga0075428_100000791 | 3300006844 | Bacteria | 32968 |
| 84 | Ga0075433_10072382 | 3300006852 | Bacteria | 3030 |
| 85 | Ga0097620_100220577 | 3300006931 | Bacteria | 1984 |
| 86 | Ga0105251_10009132 | 3300009011 | Bacteria | 5895 |
| 87 | Ga0105244_10003037 | 3300009036 | Bacteria | 12319 |
| 88 | Ga0105244_10182356 | 3300009036 | Bacteria | 995 |
| 89 | Ga0105240_10072773 | 3300009093 | Bacteria | 4247 |
| 90 | Ga0105240_10079439 | 3300009093 | Bacteria | 4036 |
| 91 | Ga0111539_10845254 | 3300009094 | Bacteria | 1065 |
| 92 | Ga0105245_10003821 | 3300009098 | Bacteria | 13388 |
| 93 | Ga0105245_10031931 | 3300009098 | Bacteria | 4662 |
| 94 | Ga0105245_10139913 | 3300009098 | Bacteria | 2278 |
| 95 | Ga0105245_10155757 | 3300009098 | Bacteria | 2164 |
| 96 | Ga0105247_10011158 | 3300009101 | Bacteria | 5417 |
| 97 | Ga0105243_10025612 | 3300009148 | Bacteria | 4509 |
| 98 | Ga0105241_10000427 | 3300009174 | Bacteria | 31803 |
| 99 | Ga0105241_10032180 | 3300009174 | Bacteria | 3930 |
| 100 | Ga0105241_10156890 | 3300009174 | Bacteria | 1867 |
| 101 | Ga0105242_10013233 | 3300009176 | Bacteria | 6370 |
| 102 | Ga0105248_10000796 | 3300009177 | Bacteria | 35389 |
| 103 | Ga0105237_10307351 | 3300009545 | Bacteria | 1588 |
| 104 | Ga0105238_10000990 | 3300009551 | Bacteria | 29030 |
| 105 | Ga0105249_10007621 | 3300009553 | Bacteria | 9443 |
| 106 | Ga0105239_10294439 | 3300010375 | Bacteria | 1828 |
| 107 | Ga0105246_10004339 | 3300011119 | Bacteria | 8627 |
| 108 | Ga0105246_10004787 | 3300011119 | Bacteria | 8241 |
| 109 | Ga0105246_10010371 | 3300011119 | Bacteria | 5764 |
| 110 | Ga0105246_10063634 | 3300011119 | Bacteria | 2573 |
| 111 | Ga0157373_10058774 | 3300013100 | Bacteria | 2725 |
| 112 | Ga0157370_10059863 | 3300013104 | Bacteria | 3618 |
| 113 | Ga0157369_10050315 | 3300013105 | Bacteria | 4513 |
| 114 | Ga0157369_10057551 | 3300013105 | Bacteria | 4194 |
| 115 | Ga0157369_10069146 | 3300013105 | Bacteria | 3794 |
| 116 | Ga0157369_10072394 | 3300013105 | Bacteria | 3699 |
| 117 | Ga0157369_10234635 | 3300013105 | Bacteria | 1917 |
| 118 | Ga0157369_10485482 | 3300013105 | Bacteria | 1279 |
| 119 | Ga0157375_10070964 | 3300013308 | Bacteria | 3495 |
| 120 | Ga0157375_10383042 | 3300013308 | Bacteria | 1573 |
| 121 | Ga0157375_10427317 | 3300013308 | Bacteria | 1491 |
| 122 | Ga0163163_10025760 | 3300014325 | Bacteria | 5610 |
| 123 | Ga0163163_10103726 | 3300014325 | Bacteria | 2868 |
| 124 | Ga0157380_10312073 | 3300014326 | Bacteria | 1454 |
| 125 | Ga0157376_10450498 | 3300014969 | Bacteria | 1255 |
| 126 | Ga0163161_10357160 | 3300017792 | Bacteria | 1163 |
| 127 | Ga0206353_10786700 | 3300020082 | Bacteria | 2130 |
| 128 | Ga0224572_1001011 | 3300024225 | Bacteria | 3892 |
| 129 | Ga0209563_106795 | 3300025230 | Bacteria | 1935 |
| 130 | Ga0209148_1001364 | 3300025254 | Bacteria | 12744 |
| 131 | Ga0209148_1009645 | 3300025254 | Bacteria | 1868 |
| 132 | Ga0209129_1000059 | 3300025258 | Bacteria | 250603 |
| 133 | Ga0209025_1000398 | 3300025294 | Bacteria | 89204 |
| 134 | Ga0209051_1026483 | 3300025303 | Bacteria | 2336 |
| 135 | Ga0207697_10004756 | 3300025315 | Bacteria | 6423 |
| 136 | Ga0207656_10000001 | 3300025321 | Bacteria | 1323684 |
| 137 | Ga0207656_10000003 | 3300025321 | Bacteria | 771644 |
| 138 | Ga0207656_10000004 | 3300025321 | Bacteria | 632320 |
| 139 | Ga0207655_1006307 | 3300025728 | Bacteria | 7883 |
| 140 | Ga0207655_1012056 | 3300025728 | Bacteria | 5084 |
| 141 | Ga0207688_10001644 | 3300025901 | Bacteria | 11807 |
| 142 | Ga0207688_10003497 | 3300025901 | Bacteria | 8570 |
| 143 | Ga0207680_10019837 | 3300025903 | Bacteria | 3605 |
| 144 | Ga0207680_10020065 | 3300025903 | Bacteria | 3587 |
| 145 | Ga0207647_10005591 | 3300025904 | Bacteria | 9186 |
| 146 | Ga0207645_10055333 | 3300025907 | Bacteria | 2533 |
| 147 | Ga0207705_10000417 | 3300025909 | Bacteria | 37398 |
| 148 | Ga0207705_10014168 | 3300025909 | Bacteria | 5743 |
| 149 | Ga0207705_10122173 | 3300025909 | Bacteria | 1933 |
| 150 | Ga0207705_10258268 | 3300025909 | Bacteria | 1330 |
| 151 | Ga0207684_10067177 | 3300025910 | Bacteria | 3046 |
| 152 | Ga0207684_10119354 | 3300025910 | Bacteria | 2260 |
| 153 | Ga0207684_10196167 | 3300025910 | Bacteria | 1742 |
| 154 | Ga0207684_10286740 | 3300025910 | Bacteria | 1420 |
| 155 | Ga0207654_10000003 | 3300025911 | Bacteria | 1030378 |
| 156 | Ga0207707_10305107 | 3300025912 | Bacteria | 1376 |
| 157 | Ga0207695_10007937 | 3300025913 | Bacteria | 13393 |
| 158 | Ga0207671_10000001 | 3300025914 | Bacteria | 1318881 |
| 159 | Ga0207657_10004685 | 3300025919 | Bacteria | 14438 |
| 160 | Ga0207657_10045274 | 3300025919 | Bacteria | 3863 |
| 161 | Ga0207657_10074517 | 3300025919 | Bacteria | 2866 |
| 162 | Ga0207657_10209298 | 3300025919 | Bacteria | 1566 |
| 163 | Ga0207652_10096747 | 3300025921 | Bacteria | 2601 |
| 164 | Ga0207652_10100155 | 3300025921 | Bacteria | 2558 |
| 165 | Ga0207646_10016260 | 3300025922 | Bacteria | 6984 |
| 166 | Ga0207646_10030187 | 3300025922 | Bacteria | 4917 |
| 167 | Ga0207681_10103584 | 3300025923 | Bacteria | 2057 |
| 168 | Ga0207694_10000047 | 3300025924 | Bacteria | 163953 |
| 169 | Ga0207650_10057841 | 3300025925 | Bacteria | 2885 |
| 170 | Ga0207659_10141418 | 3300025926 | Bacteria | 1869 |
| 171 | Ga0207687_10006765 | 3300025927 | Bacteria | 7552 |
| 172 | Ga0207687_10237448 | 3300025927 | Bacteria | 1443 |
| 173 | Ga0207687_10344013 | 3300025927 | Bacteria | 1213 |
| 174 | Ga0207644_10003381 | 3300025931 | Bacteria | 10298 |
| 175 | Ga0207690_10000634 | 3300025932 | Bacteria | 22539 |
| 176 | Ga0207690_10316542 | 3300025932 | Bacteria | 1225 |
| 177 | Ga0207709_10272806 | 3300025935 | Bacteria | 1246 |
| 178 | Ga0207670_10272820 | 3300025936 | Bacteria | 1315 |
| 179 | Ga0207665_10000538 | 3300025939 | Bacteria | 25495 |
| 180 | Ga0207691_10001407 | 3300025940 | Bacteria | 24028 |
| 181 | Ga0207711_10001765 | 3300025941 | Bacteria | 19811 |
| 182 | Ga0207689_10006706 | 3300025942 | Bacteria | 10156 |
| 183 | Ga0207667_10001391 | 3300025949 | Bacteria | 30337 |
| 184 | Ga0207678_10016395 | 3300026067 | Bacteria | 6505 |
| 185 | Ga0207678_10088014 | 3300026067 | Bacteria | 2654 |
| 186 | Ga0207708_10009485 | 3300026075 | Bacteria | 7209 |
| 187 | Ga0207708_10099266 | 3300026075 | Bacteria | 2252 |
| 188 | Ga0207702_10069251 | 3300026078 | Bacteria | 3033 |
| 189 | Ga0207702_10162205 | 3300026078 | Bacteria | 2042 |
| 190 | Ga0207641_10208434 | 3300026088 | Bacteria | 1806 |
| 191 | Ga0207648_10133371 | 3300026089 | Bacteria | 2187 |
| 192 | Ga0207648_10430932 | 3300026089 | Bacteria | 1198 |
| 193 | Ga0207676_10314590 | 3300026095 | Bacteria | 1435 |
| 194 | Ga0207674_10006995 | 3300026116 | Bacteria | 13195 |
| 195 | Ga0207674_10181619 | 3300026116 | Bacteria | 2055 |
| 196 | Ga0207675_100012912 | 3300026118 | Bacteria | 7800 |
| 197 | Ga0207683_10000893 | 3300026121 | Bacteria | 27409 |
| 198 | Ga0207683_10031308 | 3300026121 | Bacteria | 4616 |
| 199 | Ga0207698_10000325 | 3300026142 | Bacteria | 28337 |
| 200 | Ga0207698_10076983 | 3300026142 | Bacteria | 2673 |
| 201 | Ga0207428_10027367 | 3300027907 | Bacteria | 4748 |
| 202 | Ga0268266_10098060 | 3300028379 | Bacteria | 2578 |
| 203 | Ga0307509_10045172 | 3300031507 | Bacteria | 4754 |
| 204 | Ga0307408_100017600 | 3300031548 | Bacteria | 4784 |
| 205 | Ga0307408_100018137 | 3300031548 | Bacteria | 4723 |
| 206 | Ga0307408_100028445 | 3300031548 | Bacteria | 3862 |
| 207 | Ga0307408_100028564 | 3300031548 | Bacteria | 3855 |
| 208 | Ga0307408_100040789 | 3300031548 | Bacteria | 3288 |
| 209 | Ga0307408_100074623 | 3300031548 | Bacteria | 2517 |
| 210 | Ga0307408_100081643 | 3300031548 | Bacteria | 2417 |
| 211 | Ga0307408_100139142 | 3300031548 | Bacteria | 1904 |
| 212 | Ga0307408_100160776 | 3300031548 | Bacteria | 1784 |
| 213 | Ga0307408_100185578 | 3300031548 | Bacteria | 1671 |
| 214 | Ga0307408_100223538 | 3300031548 | Bacteria | 1537 |
| 215 | Ga0316575_10000061 | 3300031665 | Bacteria | 26127 |
| 216 | Ga0307405_10012485 | 3300031731 | Bacteria | 4499 |
| 217 | Ga0307405_10075584 | 3300031731 | Bacteria | 2182 |
| 218 | Ga0307405_10177055 | 3300031731 | Bacteria | 1527 |
| 219 | Ga0307405_10298740 | 3300031731 | Bacteria | 1220 |
| 220 | Ga0307405_10328450 | 3300031731 | Bacteria | 1171 |
| 221 | Ga0307405_10414128 | 3300031731 | Bacteria | 1058 |
| 222 | Ga0307413_10029605 | 3300031824 | Bacteria | 3066 |
| 223 | Ga0307413_10095613 | 3300031824 | Bacteria | 1948 |
| 224 | Ga0307413_10218402 | 3300031824 | Bacteria | 1390 |
| 225 | Ga0307413_10312534 | 3300031824 | Bacteria | 1197 |
| 226 | Ga0307413_10449708 | 3300031824 | Bacteria | 1022 |
| 227 | Ga0307410_10011737 | 3300031852 | Bacteria | 5027 |
| 228 | Ga0307410_10025211 | 3300031852 | Bacteria | 3727 |
| 229 | Ga0307410_10039429 | 3300031852 | Bacteria | 3101 |
| 230 | Ga0307410_10196435 | 3300031852 | Bacteria | 1537 |
| 231 | Ga0307410_10545451 | 3300031852 | Bacteria | 960 |
| 232 | Ga0307410_10575817 | 3300031852 | Bacteria | 936 |
| 233 | Ga0326468_10001828 | 3300031889 | Bacteria | 1805 |
| 234 | Ga0307406_10079316 | 3300031901 | Bacteria | 2177 |
| 235 | Ga0307406_10110129 | 3300031901 | Bacteria | 1894 |
| 236 | Ga0307406_10111794 | 3300031901 | Bacteria | 1882 |
| 237 | Ga0307406_10135826 | 3300031901 | Bacteria | 1733 |
| 238 | Ga0307407_10013057 | 3300031903 | Bacteria | 4018 |
| 239 | Ga0307407_10017155 | 3300031903 | Bacteria | 3625 |
| 240 | Ga0307407_10020389 | 3300031903 | Bacteria | 3396 |
| 241 | Ga0307407_10050304 | 3300031903 | Bacteria | 2383 |
| 242 | Ga0307407_10115355 | 3300031903 | Bacteria | 1693 |
| 243 | Ga0307407_10209722 | 3300031903 | Bacteria | 1311 |
| 244 | Ga0307407_10249006 | 3300031903 | Bacteria | 1216 |
| 245 | Ga0307412_10010488 | 3300031911 | Bacteria | 5339 |
| 246 | Ga0307412_10013288 | 3300031911 | Bacteria | 4821 |
| 247 | Ga0307412_10016632 | 3300031911 | Bacteria | 4387 |
| 248 | Ga0307412_10041173 | 3300031911 | Bacteria | 2992 |
| 249 | Ga0307412_10043435 | 3300031911 | Bacteria | 2926 |
| 250 | Ga0307412_10065915 | 3300031911 | Bacteria | 2452 |
| 251 | Ga0307412_10127394 | 3300031911 | Bacteria | 1843 |
| 252 | Ga0307412_10155982 | 3300031911 | Bacteria | 1690 |
| 253 | Ga0307412_10158358 | 3300031911 | Bacteria | 1679 |
| 254 | Ga0307412_10371765 | 3300031911 | Bacteria | 1154 |
| 255 | Ga0307409_100009471 | 3300031995 | Bacteria | 5986 |
| 256 | Ga0307409_100025026 | 3300031995 | Bacteria | 4177 |
| 257 | Ga0307409_100040406 | 3300031995 | Bacteria | 3472 |
| 258 | Ga0307409_100041738 | 3300031995 | Bacteria | 3429 |
| 259 | Ga0307409_100082709 | 3300031995 | Bacteria | 2600 |
| 260 | Ga0307409_100085917 | 3300031995 | Bacteria | 2559 |
| 261 | Ga0307409_100363558 | 3300031995 | Bacteria | 1370 |
| 262 | Ga0307416_100333248 | 3300032002 | Bacteria | 1526 |
| 263 | Ga0307416_100346855 | 3300032002 | Bacteria | 1500 |
| 264 | Ga0307416_100919382 | 3300032002 | Bacteria | 975 |
| 265 | Ga0307414_10014981 | 3300032004 | Bacteria | 4669 |
| 266 | Ga0307411_10002303 | 3300032005 | Bacteria | 8373 |
| 267 | Ga0307411_10012902 | 3300032005 | Bacteria | 4583 |
| 268 | Ga0307411_10013804 | 3300032005 | Bacteria | 4473 |
| 269 | Ga0307411_10062252 | 3300032005 | Bacteria | 2488 |
| 270 | Ga0307411_10179900 | 3300032005 | Bacteria | 1604 |
| 271 | Ga0307415_100031515 | 3300032126 | Bacteria | 3416 |
| 272 | Ga0307415_100170871 | 3300032126 | Bacteria | 1695 |
| 273 | Ga0307415_100255891 | 3300032126 | Bacteria | 1426 |
| 274 | Ga0307415_100275733 | 3300032126 | Bacteria | 1380 |
| 275 | Ga0373928_0022565 | 3300035084 | Bacteria | 1336 |
| 276 | Ga0373939_0044066 | 3300035114 | Bacteria | 1357 |
| 277 | Ga0373960_0039463 | 3300035121 | Bacteria | 1358 |
| 278 | Ga0395899_0014879 | 3300037312 | Bacteria | 5937 |
| 279 | Ga0395899_0050150 | 3300037312 | Bacteria | 3100 |
| 280 | Ga0395900_0008728 | 3300037418 | Bacteria | 10408 |
| 281 | Ga0395900_0013692 | 3300037418 | Bacteria | 8281 |
| 282 | Ga0395900_0044192 | 3300037418 | Bacteria | 4591 |
| 283 | Ga0395900_0106478 | 3300037418 | Bacteria | 2880 |
| 284 | Ga0395900_0154906 | 3300037418 | Bacteria | 2340 |
| 285 | Ga0395900_0206677 | 3300037418 | Bacteria | 1984 |
| 286 | Ga0395900_0242553 | 3300037418 | Bacteria | 1807 |
| 287 | Ga0395900_0309158 | 3300037418 | Bacteria | 1564 |
| 288 | Ga0395900_0618234 | 3300037418 | Bacteria | 1022 |
| 289 | Ga0395898_0000015 | 3300037466 | Bacteria | 439819 |
| 290 | Ga0395898_0195454 | 3300037466 | Bacteria | 1932 |
| 291 | Ga0395898_0288881 | 3300037466 | Bacteria | 1564 |
| 292 | Ga0395905_0088374 | 3300037471 | Bacteria | 2905 |
| 293 | Ga0395901_0044683 | 3300038443 | Bacteria | 4594 |
| 294 | Ga0395901_0138510 | 3300038443 | Bacteria | 2558 |
| 295 | Ga0395901_0169418 | 3300038443 | Bacteria | 2291 |
| 296 | Ga0395901_0169457 | 3300038443 | Bacteria | 2291 |
| 297 | Ga0395901_0273236 | 3300038443 | Bacteria | 1757 |
| 298 | Ga0395901_0294783 | 3300038443 | Bacteria | 1682 |
| 299 | Ga0439436_0005607 | 3300041404 | Bacteria | 3850 |
| 300 | Ga0439436_0010559 | 3300041404 | Bacteria | 2814 |
| 301 | Ga0439438_006361 | 3300041405 | Bacteria | 4182 |
| 302 | Ga0439438_056638 | 3300041405 | Bacteria | 987 |
| 303 | Ga0439439_0000799 | 3300041406 | Bacteria | 5720 |
| 304 | Ga0439447_035610 | 3300041407 | Bacteria | 1233 |
| 305 | Ga0439461_0000417 | 3300041410 | Bacteria | 6124 |
| 306 | Ga0439466_0007590 | 3300041411 | Bacteria | 4098 |
| 307 | Ga0439466_0028844 | 3300041411 | Bacteria | 1912 |
| 308 | Ga0439465_0007915 | 3300041413 | Bacteria | 3368 |
| 309 | Ga0451791_0418192 | 3300041451 | Bacteria | 2372 |
| 310 | Ga0451800_1105822 | 3300041459 | Bacteria | 776 |
| 311 | Ga0439431_0034262 | 3300041997 | Bacteria | 1273 |
| 312 | Ga0439433_0000206 | 3300041999 | Bacteria | 9589 |
| 313 | Ga0439433_0000289 | 3300041999 | Bacteria | 8630 |
| 314 | Ga0439442_000074 | 3300042002 | Bacteria | 23450 |
| 315 | Ga0439442_000309 | 3300042002 | Bacteria | 11736 |
| 316 | Ga0439432_003609 | 3300042006 | Bacteria | 5724 |
| 317 | Ga0439432_018983 | 3300042006 | Bacteria | 2294 |
| 318 | Ga0439449_0001007 | 3300042007 | Bacteria | 11104 |
| 319 | Ga0439449_0004716 | 3300042007 | Bacteria | 5261 |
| 320 | Ga0439449_0011638 | 3300042007 | Bacteria | 3309 |
| 321 | Ga0439449_0021455 | 3300042007 | Bacteria | 2417 |
| 322 | Ga0439457_002062 | 3300042014 | Bacteria | 5884 |
| 323 | Ga0439457_008285 | 3300042014 | Bacteria | 2457 |
| 324 | Ga0450919_000348 | 3300042121 | Bacteria | 5565 |
| 325 | Ga0450920_003618 | 3300042122 | Bacteria | 2691 |
| 326 | Ga0450920_005271 | 3300042122 | Bacteria | 2292 |
| 327 | Ga0450920_009872 | 3300042122 | Bacteria | 1763 |
| 328 | Ga0450907_000685 | 3300042146 | Bacteria | 8773 |
| 329 | Ga0450907_005422 | 3300042146 | Bacteria | 2153 |
| 330 | Ga0450908_001130 | 3300042184 | Bacteria | 5180 |
| 331 | Ga0439434_0000180 | 3300042435 | Bacteria | 17187 |
| 332 | Ga0439434_0001140 | 3300042435 | Bacteria | 7681 |
| 333 | Ga0439434_0047817 | 3300042435 | Bacteria | 1322 |
| 334 | Ga0450918_002799 | 3300042531 | Bacteria | 3275 |
| 335 | Ga0466969_0000268 | 3300044656 | Bacteria | 28572 |
| 336 | Ga0466972_0015410 | 3300044658 | Bacteria | 3821 |
| 337 | Ga0466972_0049853 | 3300044658 | Bacteria | 2022 |
| 338 | Ga0466972_0065694 | 3300044658 | Bacteria | 1735 |
| 339 | Ga0466965_0009347 | 3300044683 | Bacteria | 4556 |
| 340 | Ga0466965_0051254 | 3300044683 | Bacteria | 2047 |
| 341 | Ga0466966_0011386 | 3300044684 | Bacteria | 5900 |
| 342 | Ga0466966_0157987 | 3300044684 | Bacteria | 1381 |
| 343 | Ga0466961_0006152 | 3300044693 | Bacteria | 7618 |
| 344 | Ga0466971_0012976 | 3300044719 | Bacteria | 3655 |
| 345 | Ga0466968_0029514 | 3300044735 | Bacteria | 2268 |
| 346 | Ga0466968_0050283 | 3300044735 | Bacteria | 1778 |
| 347 | Ga0466970_0004720 | 3300044765 | Bacteria | 6731 |
| 348 | Ga0466970_0010804 | 3300044765 | Bacteria | 4643 |
| 349 | Ga0466970_0111578 | 3300044765 | Bacteria | 1493 |
| 350 | Ga0466970_0182946 | 3300044765 | Bacteria | 1163 |
| 351 | Ga0466960_0040834 | 3300044901 | Bacteria | 2195 |
| 352 | Ga0466960_0082251 | 3300044901 | Bacteria | 1625 |
| 353 | Ga0466959_0000333 | 3300045049 | Bacteria | 27831 |
| 354 | Ga0466959_0010201 | 3300045049 | Bacteria | 6707 |
| 355 | Ga0466959_0271433 | 3300045049 | Bacteria | 1166 |
| 356 | Ga0466967_0112317 | 3300045976 | Bacteria | 2505 |
| 357 | Ga0466967_0747235 | 3300045976 | Bacteria | 970 |
| 358 | Ga0495651_0000707 | 3300046462 | Bacteria | 25880 |
| 359 | Ga0495653_0150395 | 3300046463 | Bacteria | 1627 |
| 360 | Ga0495650_0003728 | 3300046471 | Bacteria | 10897 |
| 361 | Ga0495580_0007457 | 3300046472 | Bacteria | 8793 |
| 362 | Ga0495580_0021576 | 3300046472 | Bacteria | 4749 |
| 363 | Ga0495639_0011473 | 3300046475 | Bacteria | 3820 |
| 364 | Ga0495662_0010414 | 3300046476 | Bacteria | 4555 |
| 365 | Ga0495662_0017521 | 3300046476 | Bacteria | 3466 |
| 366 | Ga0495664_0007121 | 3300046477 | Bacteria | 6199 |
| 367 | Ga0495628_0003340 | 3300046516 | Bacteria | 14356 |
| 368 | Ga0495630_0117299 | 3300046517 | Bacteria | 2018 |
| 369 | Ga0495631_0072610 | 3300046518 | Bacteria | 1486 |
| 370 | Ga0495643_0031916 | 3300046522 | Bacteria | 2928 |
| 371 | Ga0495665_0000584 | 3300046531 | Bacteria | 18610 |
| 372 | Ga0495586_0007797 | 3300046535 | Bacteria | 5708 |
| 373 | Ga0495586_0194597 | 3300046535 | Bacteria | 1148 |
| 374 | Ga0495587_0001644 | 3300046536 | Bacteria | 14910 |
| 375 | Ga0495645_0006410 | 3300046543 | Bacteria | 8166 |
| 376 | Ga0495622_0063894 | 3300046557 | Bacteria | 1703 |
| 377 | Ga0495667_0000447 | 3300046559 | Bacteria | 26376 |
| 378 | Ga0495656_0000881 | 3300046615 | Bacteria | 9713 |
| 379 | Ga0495656_0006359 | 3300046615 | Bacteria | 4142 |
| 380 | Ga0495656_0175416 | 3300046615 | Bacteria | 1050 |
| 381 | Ga0495668_0006344 | 3300046616 | Bacteria | 7764 |
| 382 | Ga0495635_0001469 | 3300046663 | Bacteria | 15761 |
| 383 | Ga0495588_0002202 | 3300046674 | Bacteria | 8346 |
| 384 | Ga0495588_0005545 | 3300046674 | Bacteria | 5622 |
| 385 | Ga0495588_0022176 | 3300046674 | Bacteria | 3137 |
| 386 | Ga0495657_0024693 | 3300046675 | Bacteria | 4276 |
| 387 | Ga0495623_0043500 | 3300046679 | Bacteria | 2858 |
| 388 | Ga0495670_0000915 | 3300046691 | Bacteria | 14239 |
| 389 | Ga0495600_0035163 | 3300046809 | Bacteria | 3253 |
| 390 | Ga0495600_0053174 | 3300046809 | Bacteria | 2644 |
| 391 | Ga0495581_0008259 | 3300047315 | Bacteria | 6033 |
| 392 | Ga0495581_0025673 | 3300047315 | Bacteria | 3416 |
| 393 | Ga0495581_0114058 | 3300047315 | Bacteria | 1571 |
| 394 | Ga0495581_0248464 | 3300047315 | Bacteria | 1040 |
| 395 | Ga0495636_0082010 | 3300047318 | Bacteria | 1390 |
| 396 | Ga0495680_0016371 | 3300047322 | Bacteria | 6373 |
| 397 | Ga0495680_0053400 | 3300047322 | Bacteria | 3145 |
| 398 | Ga0495685_104775 | 3300047447 | Bacteria | 933 |
| 399 | Ga0495684_0247516 | 3300047471 | Bacteria | 1298 |
| 400 | Ga0495593_0005077 | 3300047673 | Bacteria | 7783 |
| 401 | Ga0496100_0019102 | 3300048903 | Bacteria | 4081 |
| 402 | Ga0496101_0084844 | 3300048904 | Bacteria | 2346 |
| 403 | Ga0496101_0087091 | 3300048904 | Bacteria | 2317 |
| 404 | Ga0496101_0388844 | 3300048904 | Bacteria | 1098 |
| 405 | Ga0496101_0396177 | 3300048904 | Bacteria | 1087 |
| 406 | Ga0496101_0467397 | 3300048904 | Bacteria | 995 |
| 407 | Ga0496102_0012978 | 3300048905 | Bacteria | 7216 |
| 408 | Ga0496102_0030958 | 3300048905 | Bacteria | 4793 |
| 409 | Ga0496102_0124555 | 3300048905 | Bacteria | 2408 |
| 410 | Ga0496102_0138551 | 3300048905 | Bacteria | 2280 |
| 411 | Ga0496103_0039961 | 3300048906 | Bacteria | 2883 |
| 412 | Ga0496103_0051860 | 3300048906 | Bacteria | 2540 |
| 413 | Ga0496103_0112062 | 3300048906 | Bacteria | 1733 |
| 414 | Ga0496103_0168267 | 3300048906 | Bacteria | 1407 |
| 415 | Ga0496104_0061203 | 3300048907 | Bacteria | 3568 |
| 416 | Ga0496105_0074534 | 3300048908 | Bacteria | 2803 |
| 417 | Ga0496106_0397548 | 3300048909 | Bacteria | 1107 |
| 418 | Ga0496107_0312524 | 3300048910 | Bacteria | 1169 |
| 419 | Ga0496107_0352838 | 3300048910 | Bacteria | 1094 |
| 420 | Ga0496108_0026032 | 3300048911 | Bacteria | 4825 |
| 421 | Ga0496108_0088684 | 3300048911 | Bacteria | 2628 |
| 422 | Ga0496108_0090363 | 3300048911 | Bacteria | 2603 |
| 423 | Ga0496108_0196431 | 3300048911 | Bacteria | 1750 |
| 424 | Ga0496108_0353425 | 3300048911 | Bacteria | 1282 |
| 425 | Ga0496109_0042257 | 3300048912 | Bacteria | 4128 |
| 426 | Ga0496109_0075703 | 3300048912 | Bacteria | 3094 |
| 427 | Ga0496109_0578551 | 3300048912 | Bacteria | 1058 |
| 428 | Ga0496110_0015868 | 3300048913 | Bacteria | 6280 |
| 429 | Ga0496110_0027468 | 3300048913 | Bacteria | 4879 |
| 430 | Ga0496110_0048377 | 3300048913 | Bacteria | 3728 |
| 431 | Ga0496110_0122654 | 3300048913 | Bacteria | 2342 |
| 432 | Ga0496110_0166897 | 3300048913 | Bacteria | 1996 |
| 433 | Ga0496111_0023603 | 3300048914 | Bacteria | 4320 |
| 434 | Ga0496111_0112063 | 3300048914 | Bacteria | 2010 |
| 435 | Ga0496111_0244775 | 3300048914 | Bacteria | 1331 |
| 436 | Ga0496112_0010337 | 3300048915 | Bacteria | 8465 |
| 437 | Ga0496112_0021726 | 3300048915 | Bacteria | 6105 |
| 438 | Ga0496112_0059452 | 3300048915 | Bacteria | 3766 |
| 439 | Ga0496113_0073825 | 3300048916 | Bacteria | 2599 |
| 440 | Ga0496113_0358927 | 3300048916 | Bacteria | 1169 |
| 441 | Ga0496114_0032121 | 3300048917 | Bacteria | 4319 |
| 442 | Ga0496114_0059859 | 3300048917 | Bacteria | 3182 |
| 443 | Ga0496114_0110486 | 3300048917 | Bacteria | 2355 |
| 444 | Ga0496114_0113504 | 3300048917 | Bacteria | 2323 |
| 445 | Ga0496114_0200241 | 3300048917 | Bacteria | 1749 |
| 446 | Ga0496115_0435635 | 3300048918 | Bacteria | 1060 |
| 447 | Ga0496117_0015667 | 3300048920 | Bacteria | 6442 |
| 448 | Ga0496117_0052217 | 3300048920 | Bacteria | 2881 |
| 449 | Ga0496118_0025612 | 3300048921 | Bacteria | 5050 |
| 450 | Ga0496118_0044670 | 3300048921 | Bacteria | 3466 |
| 451 | Ga0496119_0006819 | 3300048922 | Bacteria | 10469 |
| 452 | Ga0496119_0009092 | 3300048922 | Bacteria | 8606 |
| 453 | Ga0496119_0137093 | 3300048922 | Bacteria | 1326 |
| 454 | Ga0496120_0004918 | 3300048923 | Bacteria | 10873 |
| 455 | Ga0496120_0023475 | 3300048923 | Bacteria | 3861 |
| 456 | Ga0496121_0086997 | 3300048924 | Bacteria | 2454 |
| 457 | Ga0496122_0001925 | 3300048925 | Bacteria | 31334 |
| 458 | Ga0496122_0002333 | 3300048925 | Bacteria | 27370 |
| 459 | Ga0496122_0015418 | 3300048925 | Bacteria | 7308 |
| 460 | Ga0496123_0000172 | 3300048926 | Bacteria | 130598 |
| 461 | Ga0496124_0002762 | 3300048927 | Bacteria | 22332 |
| 462 | Ga0496124_0138777 | 3300048927 | Bacteria | 1921 |
| 463 | Ga0496125_0000015 | 3300048928 | Bacteria | 516648 |
| 464 | Ga0496125_0001307 | 3300048928 | Bacteria | 36887 |
| 465 | Ga0496125_0136034 | 3300048928 | Bacteria | 1719 |
| 466 | Ga0496126_0051450 | 3300048929 | Bacteria | 3750 |
| 467 | Ga0496126_0287006 | 3300048929 | Bacteria | 1362 |
| 468 | Ga0501031_0003781 | 3300049568 | Bacteria | 9741 |
| 469 | Ga0501031_0015138 | 3300049568 | Bacteria | 5009 |
| 470 | Ga0501031_0043706 | 3300049568 | Bacteria | 2923 |
| 471 | Ga0501031_0086918 | 3300049568 | Bacteria | 2038 |
| 472 | Ga0501031_0171724 | 3300049568 | Bacteria | 1417 |
| 473 | Ga0501032_0000302 | 3300049569 | Bacteria | 41525 |
| 474 | Ga0501032_0000979 | 3300049569 | Bacteria | 23099 |
| 475 | Ga0501032_0017670 | 3300049569 | Bacteria | 5005 |
| 476 | Ga0501032_0047607 | 3300049569 | Bacteria | 2895 |
| 477 | Ga0501033_0003369 | 3300049570 | Bacteria | 13185 |
| 478 | Ga0501033_0058360 | 3300049570 | Bacteria | 2850 |
| 479 | Ga0501033_0070474 | 3300049570 | Bacteria | 2568 |
| 480 | Ga0501034_0000069 | 3300049571 | Bacteria | 181133 |
| 481 | Ga0501034_0011189 | 3300049571 | Bacteria | 9314 |
| 482 | Ga0501034_0026967 | 3300049571 | Bacteria | 5844 |
| 483 | Ga0501034_0056828 | 3300049571 | Bacteria | 3935 |
| 484 | Ga0501034_0079025 | 3300049571 | Bacteria | 3293 |
| 485 | Ga0501034_0108966 | 3300049571 | Bacteria | 2760 |
| 486 | Ga0501034_0135942 | 3300049571 | Bacteria | 2439 |
| 487 | Ga0501034_0181685 | 3300049571 | Bacteria | 2068 |
| 488 | Ga0501036_0047355 | 3300049572 | Bacteria | 3642 |
| 489 | Ga0501036_0067953 | 3300049572 | Bacteria | 3015 |
| 490 | Ga0501036_0085772 | 3300049572 | Bacteria | 2661 |
| 491 | Ga0501036_0141186 | 3300049572 | Bacteria | 2033 |
| 492 | Ga0501036_0174398 | 3300049572 | Bacteria | 1811 |
| 493 | Ga0501037_0013267 | 3300049573 | Bacteria | 6071 |
| 494 | Ga0501037_0015218 | 3300049573 | Bacteria | 5660 |
| 495 | Ga0501037_0015228 | 3300049573 | Bacteria | 5658 |
| 496 | Ga0501037_0021455 | 3300049573 | Bacteria | 4773 |
| 497 | Ga0501037_0026685 | 3300049573 | Bacteria | 4268 |
| 498 | Ga0501037_0299713 | 3300049573 | Bacteria | 1116 |
| 499 | Ga0501038_0011689 | 3300049574 | Bacteria | 8008 |
| 500 | Ga0501038_0028836 | 3300049574 | Bacteria | 4927 |
| 501 | Ga0501038_0058905 | 3300049574 | Bacteria | 3291 |
| 502 | Ga0501038_0106279 | 3300049574 | Bacteria | 2330 |
| 503 | Ga0501038_0166181 | 3300049574 | Bacteria | 1790 |
| 504 | Ga0501039_0171666 | 3300049575 | Bacteria | 1705 |
| 505 | Ga0501039_0182803 | 3300049575 | Bacteria | 1649 |
| 506 | Ga0501040_0042170 | 3300049576 | Bacteria | 3107 |
| 507 | Ga0501040_0088427 | 3300049576 | Bacteria | 2152 |
| 508 | Ga0501041_0018395 | 3300049577 | Bacteria | 4164 |
| 509 | Ga0501042_0024174 | 3300049578 | Bacteria | 4260 |
| 510 | Ga0501043_0008178 | 3300049579 | Bacteria | 8249 |
| 511 | Ga0501043_0031113 | 3300049579 | Bacteria | 4196 |
| 512 | Ga0501043_0070230 | 3300049579 | Bacteria | 2751 |
| 513 | Ga0501043_0106064 | 3300049579 | Bacteria | 2207 |
| 514 | Ga0501043_0113183 | 3300049579 | Bacteria | 2131 |
| 515 | Ga0501043_0170230 | 3300049579 | Bacteria | 1699 |
| 516 | Ga0501046_0002697 | 3300049580 | Bacteria | 16521 |
| 517 | Ga0501046_0070287 | 3300049580 | Bacteria | 2722 |
| 518 | Ga0501047_0002907 | 3300049581 | Bacteria | 16258 |
| 519 | Ga0501047_0033662 | 3300049581 | Bacteria | 4945 |
| 520 | Ga0501047_0046170 | 3300049581 | Bacteria | 4210 |
| 521 | Ga0501047_0069081 | 3300049581 | Bacteria | 3402 |
| 522 | Ga0501048_0003585 | 3300049582 | Bacteria | 11817 |
| 523 | Ga0501048_0059865 | 3300049582 | Bacteria | 2699 |
| 524 | Ga0501048_0360004 | 3300049582 | Bacteria | 1038 |
| 525 | Ga0501067_0008863 | 3300049583 | Bacteria | 5573 |
| 526 | Ga0501067_0043277 | 3300049583 | Bacteria | 2500 |
| 527 | Ga0501068_0053778 | 3300049584 | Bacteria | 2438 |
| 528 | Ga0501068_0370570 | 3300049584 | Bacteria | 921 |
| 529 | Ga0501069_0052144 | 3300049585 | Bacteria | 2277 |
| 530 | Ga0501070_0033712 | 3300049586 | Bacteria | 4285 |
| 531 | Ga0501070_0084035 | 3300049586 | Bacteria | 2636 |
| 532 | Ga0501070_0089449 | 3300049586 | Bacteria | 2548 |
| 533 | Ga0501070_0226239 | 3300049586 | Bacteria | 1533 |
| 534 | Ga0501070_0273601 | 3300049586 | Bacteria | 1378 |
| 535 | Ga0501071_0030035 | 3300049587 | Bacteria | 3841 |
| 536 | Ga0501071_0473414 | 3300049587 | Bacteria | 960 |
| 537 | Ga0501072_0024025 | 3300049588 | Bacteria | 4738 |
| 538 | Ga0501072_0061081 | 3300049588 | Bacteria | 2971 |
| 539 | Ga0501072_0383250 | 3300049588 | Bacteria | 1116 |
| 540 | Ga0501073_0000052 | 3300049589 | Bacteria | 73681 |
| 541 | Ga0501073_0022505 | 3300049589 | Bacteria | 4538 |
| 542 | Ga0501073_0096568 | 3300049589 | Bacteria | 2052 |
| 543 | Ga0501073_0114929 | 3300049589 | Bacteria | 1865 |
| 544 | Ga0501074_0139760 | 3300049590 | Bacteria | 1732 |
| 545 | Ga0501076_0091403 | 3300049592 | Bacteria | 2448 |
| 546 | Ga0501077_0080182 | 3300049593 | Bacteria | 2068 |
| 547 | Ga0501079_0041264 | 3300049741 | Bacteria | 3561 |
| 548 | Ga0501080_0069733 | 3300049742 | Bacteria | 3270 |
| 549 | Ga0501083_0012626 | 3300049744 | Bacteria | 5909 |
| 550 | Ga0501083_0034310 | 3300049744 | Bacteria | 3470 |
| 551 | Ga0501035_0007414 | 3300049822 | Bacteria | 10246 |
| 552 | Ga0501035_0025218 | 3300049822 | Bacteria | 5450 |
| 553 | Ga0501035_0098038 | 3300049822 | Bacteria | 2573 |
| 554 | Ga0501044_0003445 | 3300049823 | Bacteria | 17814 |
| 555 | Ga0501044_0007662 | 3300049823 | Bacteria | 11872 |
| 556 | Ga0501044_0041340 | 3300049823 | Bacteria | 4798 |
| 557 | Ga0501044_0054272 | 3300049823 | Bacteria | 4120 |
| 558 | Ga0501044_0056845 | 3300049823 | Bacteria | 4017 |
| 559 | Ga0501044_0270030 | 3300049823 | Bacteria | 1637 |
| 560 | Ga0501045_0144923 | 3300049824 | Bacteria | 1766 |
| 561 | nmdc:mga00v17_12383_c1 | 3300050491 | Bacteria | 4706 |
| 562 | nmdc:mga00v17_311263_c1 | 3300050491 | Bacteria | 1023 |
| 563 | nmdc:mga0yw44_51150_c1 | 3300050492 | Bacteria | 2501 |
| 564 | nmdc:mga0yw44_75153_c1 | 3300050492 | Bacteria | 2106 |
| 565 | nmdc:mga06z11_102957_c1 | 3300050494 | Bacteria | 1569 |
| 566 | nmdc:mga06z11_211832_c1 | 3300050494 | Bacteria | 1129 |
| 567 | nmdc:mga04h51_31858_c1 | 3300050495 | Bacteria | 1668 |
| 568 | nmdc:mga07m45_123473_c1 | 3300050496 | Bacteria | 1496 |
| 569 | nmdc:mga07m45_26587_c1 | 3300050496 | Bacteria | 3182 |
| 570 | nmdc:mga05p37_511036_c1 | 3300050507 | Bacteria | 1376 |
| 571 | nmdc:mga09592_897102_c1 | 3300050508 | Bacteria | 745 |
| 572 | nmdc:mga0qj67_388846_c1 | 3300050509 | Bacteria | 1126 |
| 573 | nmdc:mga06r32_57031_c1 | 3300050510 | Bacteria | 3752 |
| 574 | nmdc:mga0a205_17758_c1 | 3300050515 | Bacteria | 6676 |
| 575 | nmdc:mga0sz30_10037_c1 | 3300050516 | Bacteria | 3621 |
| 576 | nmdc:mga0sz30_96352_c1 | 3300050516 | Bacteria | 970 |
| 577 | Ga0495612_0013418 | 3300053078 | Bacteria | 3300 |
| 578 | Ga0500556_0001349 | 3300053104 | Bacteria | 10848 |
| 579 | Ga0500562_003197 | 3300053108 | Bacteria | 4084 |
| 580 | Ga0500628_030945 | 3300053129 | Bacteria | 1161 |
| 581 | Ga0500655_001344 | 3300053133 | Bacteria | 4657 |
| 582 | Ga0500559_0000462 | 3300053136 | Bacteria | 28935 |
| 583 | Ga0500616_0001033 | 3300053153 | Bacteria | 29485 |
| 584 | Ga0500616_0034816 | 3300053153 | Bacteria | 2742 |
| 585 | Ga0501084_0037200 | 3300054114 | Bacteria | 4066 |
| 586 | Ga0587088_005039 | 3300059508 | Bacteria | 1714 |
| 587 | Ga0587090_011374 | 3300059510 | Bacteria | 1250 |
| 588 | Ga0587106_000709 | 3300059605 | Bacteria | 2556 |
| 589 | Ga0587106_001521 | 3300059605 | Bacteria | 2078 |
| 590 | Ga0501082_0005130 | 3300060353 | Bacteria | 11399 |
| 591 | Ga0501082_0042381 | 3300060353 | Bacteria | 3924 |
| 592 | Ga0466962_0000049 | 3300061719 | Bacteria | 48219 |
| 593 | Ga0530510_0009182 | 3300061734 | Bacteria | 6929 |
| 594 | Ga0530510_0166615 | 3300061734 | Bacteria | 1631 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025912 | Ga0207707_10305107 | Ga0207707_103051072 | 221 |
| 2 | 3300005327 | Ga0070658_10039126 | Ga0070658_100391263 | 222 |
| 3 | 3300005331 | Ga0070670_100137032 | Ga0070670_1001370322 | 222 |
| 4 | 3300025901 | Ga0207688_10003497 | Ga0207688_100034972 | 222 |
| 5 | 3300050508 | nmdc:mga09592_897102_c1 | nmdc:mga09592_897102_c1_11_724 | 226 |
| 6 | 3300041459 | Ga0451800_1105822 | Ga0451800_1105822_75_764 | 229 |
| 7 | 3300031889 | Ga0326468_10001828 | Ga0326468_100018282 | 241 |
| 8 | 3300044656 | Ga0466969_0000268 | Ga0466969_0000268_18733_19662 | 243 |
| 9 | 3300044684 | Ga0466966_0011386 | Ga0466966_0011386_1860_2789 | 243 |
| 10 | 3300044693 | Ga0466961_0006152 | Ga0466961_0006152_5339_6268 | 243 |
| 11 | 3300044719 | Ga0466971_0012976 | Ga0466971_0012976_233_1162 | 243 |
| 12 | 3300045049 | Ga0466959_0000333 | Ga0466959_0000333_11775_12704 | 243 |
| 13 | 3300048922 | Ga0496119_0009092 | Ga0496119_0009092_4135_4875 | 243 |
| 14 | 3300050509 | nmdc:mga0qj67_388846_c1 | nmdc:mga0qj67_388846_c1_19_834 | 243 |
| 15 | 3300061719 | Ga0466962_0000049 | Ga0466962_0000049_6123_7052 | 243 |
| 16 | 3300009094 | Ga0111539_10845254 | Ga0111539_108452541 | 245 |
| 17 | 3300009098 | Ga0105245_10139913 | Ga0105245_101399132 | 245 |
| 18 | 3300009174 | Ga0105241_10032180 | Ga0105241_100321802 | 245 |
| 19 | 3300024225 | Ga0224572_1001011 | Ga0224572_10010113 | 245 |
| 20 | 3300048904 | Ga0496101_0388844 | Ga0496101_0388844_218_1060 | 245 |
| 21 | 3300048916 | Ga0496113_0073825 | Ga0496113_0073825_1312_2178 | 245 |
| 22 | 3300005441 | Ga0070700_100292710 | Ga0070700_1002927101 | 246 |
| 23 | 3300005617 | Ga0068859_100220569 | Ga0068859_1002205691 | 246 |
| 24 | 3300006931 | Ga0097620_100220577 | Ga0097620_1002205772 | 246 |
| 25 | 3300025936 | Ga0207670_10272820 | Ga0207670_102728201 | 246 |
| 26 | 3300026067 | Ga0207678_10088014 | Ga0207678_100880142 | 246 |
| 27 | 3300026075 | Ga0207708_10099266 | Ga0207708_100992662 | 246 |
| 28 | 3300026095 | Ga0207676_10314590 | Ga0207676_103145902 | 246 |
| 29 | 3300005339 | Ga0070660_100047943 | Ga0070660_1000479432 | 247 |
| 30 | 3300005547 | Ga0070693_100117289 | Ga0070693_1001172892 | 247 |
| 31 | 3300005548 | Ga0070665_100177716 | Ga0070665_1001777162 | 247 |
| 32 | 3300025919 | Ga0207657_10045274 | Ga0207657_100452743 | 247 |
| 33 | 3300025921 | Ga0207652_10096747 | Ga0207652_100967472 | 247 |
| 34 | 3300025935 | Ga0207709_10272806 | Ga0207709_102728061 | 247 |
| 35 | 3300026089 | Ga0207648_10430932 | Ga0207648_104309321 | 247 |
| 36 | 3300005445 | Ga0070708_100142600 | Ga0070708_1001426002 | 256 |
| 37 | 3300005530 | Ga0070679_100161887 | Ga0070679_1001618872 | 257 |
| 38 | 3300025921 | Ga0207652_10100155 | Ga0207652_101001553 | 257 |
| 39 | 3300049582 | Ga0501048_0360004 | Ga0501048_0360004_13_891 | 257 |
| 40 | 3300049568 | Ga0501031_0043706 | Ga0501031_0043706_186_1064 | 258 |
| 41 | 3300049576 | Ga0501040_0088427 | Ga0501040_0088427_848_1726 | 258 |
| 42 | 3300005467 | Ga0070706_100224912 | Ga0070706_1002249122 | 260 |
| 43 | 3300005468 | Ga0070707_100006788 | Ga0070707_1000067882 | 260 |
| 44 | 3300005719 | Ga0068861_100372655 | Ga0068861_1003726552 | 260 |
| 45 | 3300025910 | Ga0207684_10119354 | Ga0207684_101193542 | 260 |
| 46 | 3300025922 | Ga0207646_10016260 | Ga0207646_100162602 | 260 |
| 47 | 3300025927 | Ga0207687_10344013 | Ga0207687_103440132 | 261 |
| 48 | 3300005445 | Ga0070708_100001304 | Ga0070708_1000013048 | 262 |
| 49 | 3300005467 | Ga0070706_100418274 | Ga0070706_1004182742 | 262 |
| 50 | 3300025910 | Ga0207684_10067177 | Ga0207684_100671773 | 262 |
| 51 | 3300005468 | Ga0070707_100112882 | Ga0070707_1001128823 | 263 |
| 52 | 3300005518 | Ga0070699_100042834 | Ga0070699_1000428343 | 263 |
| 53 | 3300025910 | Ga0207684_10286740 | Ga0207684_102867401 | 263 |
| 54 | 3300025922 | Ga0207646_10030187 | Ga0207646_100301873 | 263 |
| 55 | 3300041405 | Ga0439438_006361 | Ga0439438_006361_2856_3725 | 263 |
| 56 | 3300041406 | Ga0439439_0000799 | Ga0439439_0000799_2445_3284 | 263 |
| 57 | 3300041407 | Ga0439447_035610 | Ga0439447_035610_159_998 | 263 |
| 58 | 3300041410 | Ga0439461_0000417 | Ga0439461_0000417_3080_3949 | 263 |
| 59 | 3300041411 | Ga0439466_0007590 | Ga0439466_0007590_1282_2121 | 263 |
| 60 | 3300041999 | Ga0439433_0000206 | Ga0439433_0000206_4610_5449 | 263 |
| 61 | 3300042006 | Ga0439432_003609 | Ga0439432_003609_1429_2268 | 263 |
| 62 | 3300042007 | Ga0439449_0021455 | Ga0439449_0021455_1445_2284 | 263 |
| 63 | 3300042014 | Ga0439457_002062 | Ga0439457_002062_2365_3204 | 263 |
| 64 | 3300042121 | Ga0450919_000348 | Ga0450919_000348_70_909 | 263 |
| 65 | 3300042146 | Ga0450907_005422 | Ga0450907_005422_816_1655 | 263 |
| 66 | 3300042184 | Ga0450908_001130 | Ga0450908_001130_394_1233 | 263 |
| 67 | 3300042435 | Ga0439434_0001140 | Ga0439434_0001140_3410_4249 | 263 |
| 68 | 3300048911 | Ga0496108_0088684 | Ga0496108_0088684_258_1133 | 263 |
| 69 | 3300048913 | Ga0496110_0166897 | Ga0496110_0166897_347_1222 | 263 |
| 70 | 3300049568 | Ga0501031_0086918 | Ga0501031_0086918_917_1771 | 263 |
| 71 | 3300049569 | Ga0501032_0017670 | Ga0501032_0017670_2696_3550 | 263 |
| 72 | 3300049570 | Ga0501033_0058360 | Ga0501033_0058360_651_1505 | 263 |
| 73 | 3300049571 | Ga0501034_0056828 | Ga0501034_0056828_2072_2926 | 263 |
| 74 | 3300049572 | Ga0501036_0085772 | Ga0501036_0085772_1540_2394 | 263 |
| 75 | 3300049573 | Ga0501037_0026685 | Ga0501037_0026685_1065_1919 | 263 |
| 76 | 3300049574 | Ga0501038_0028836 | Ga0501038_0028836_1602_2456 | 263 |
| 77 | 3300049576 | Ga0501040_0042170 | Ga0501040_0042170_1049_1903 | 263 |
| 78 | 3300049577 | Ga0501041_0018395 | Ga0501041_0018395_2944_3798 | 263 |
| 79 | 3300049578 | Ga0501042_0024174 | Ga0501042_0024174_213_1067 | 263 |
| 80 | 3300049579 | Ga0501043_0031113 | Ga0501043_0031113_2236_3090 | 263 |
| 81 | 3300049581 | Ga0501047_0069081 | Ga0501047_0069081_2354_3208 | 263 |
| 82 | 3300049582 | Ga0501048_0003585 | Ga0501048_0003585_2072_2926 | 263 |
| 83 | 3300049583 | Ga0501067_0043277 | Ga0501067_0043277_1054_1908 | 263 |
| 84 | 3300049584 | Ga0501068_0053778 | Ga0501068_0053778_1137_1991 | 263 |
| 85 | 3300049585 | Ga0501069_0052144 | Ga0501069_0052144_1156_2010 | 263 |
| 86 | 3300049586 | Ga0501070_0273601 | Ga0501070_0273601_268_1122 | 263 |
| 87 | 3300049587 | Ga0501071_0030035 | Ga0501071_0030035_1917_2771 | 263 |
| 88 | 3300049588 | Ga0501072_0024025 | Ga0501072_0024025_1134_1988 | 263 |
| 89 | 3300049589 | Ga0501073_0114929 | Ga0501073_0114929_927_1781 | 263 |
| 90 | 3300049590 | Ga0501074_0139760 | Ga0501074_0139760_611_1465 | 263 |
| 91 | 3300049592 | Ga0501076_0091403 | Ga0501076_0091403_1307_2161 | 263 |
| 92 | 3300049593 | Ga0501077_0080182 | Ga0501077_0080182_395_1249 | 263 |
| 93 | 3300049741 | Ga0501079_0041264 | Ga0501079_0041264_1503_2357 | 263 |
| 94 | 3300049744 | Ga0501083_0034310 | Ga0501083_0034310_2221_3075 | 263 |
| 95 | 3300049823 | Ga0501044_0054272 | Ga0501044_0054272_2350_3204 | 263 |
| 96 | 3300049824 | Ga0501045_0144923 | Ga0501045_0144923_483_1337 | 263 |
| 97 | 3300050494 | nmdc:mga06z11_211832_c1 | nmdc:mga06z11_211832_c1_81_902 | 263 |
| 98 | 3300054114 | Ga0501084_0037200 | Ga0501084_0037200_1296_2150 | 263 |
| 99 | 3300060353 | Ga0501082_0042381 | Ga0501082_0042381_2550_3404 | 263 |
| 100 | 3300061734 | Ga0530510_0166615 | Ga0530510_0166615_507_1361 | 263 |
| 101 | 3300049573 | Ga0501037_0021455 | Ga0501037_0021455_2523_3323 | 264 |
| 102 | 3300049586 | Ga0501070_0089449 | Ga0501070_0089449_179_979 | 264 |
| 103 | 3300049823 | Ga0501044_0056845 | Ga0501044_0056845_1745_2545 | 264 |
| 104 | 3300005614 | Ga0068856_100196052 | Ga0068856_1001960522 | 265 |
| 105 | 3300006844 | Ga0075428_100000791 | Ga0075428_10000079128 | 265 |
| 106 | 3300026078 | Ga0207702_10162205 | Ga0207702_101622052 | 265 |
| 107 | 3300049572 | Ga0501036_0141186 | Ga0501036_0141186_512_1390 | 265 |
| 108 | 3300050510 | nmdc:mga06r32_57031_c1 | nmdc:mga06r32_57031_c1_2754_3584 | 265 |
| 109 | 3300049569 | Ga0501032_0000302 | Ga0501032_0000302_5425_6306 | 266 |
| 110 | 3300049571 | Ga0501034_0000069 | Ga0501034_0000069_159737_160618 | 266 |
| 111 | 3300049573 | Ga0501037_0015218 | Ga0501037_0015218_2925_3806 | 266 |
| 112 | 3300049574 | Ga0501038_0166181 | Ga0501038_0166181_691_1572 | 266 |
| 113 | 3300049579 | Ga0501043_0170230 | Ga0501043_0170230_189_1070 | 266 |
| 114 | 3300005618 | Ga0068864_100165063 | Ga0068864_1001650632 | 267 |
| 115 | 3300031548 | Ga0307408_100017600 | Ga0307408_1000176004 | 267 |
| 116 | 3300031548 | Ga0307408_100040789 | Ga0307408_1000407893 | 267 |
| 117 | 3300031731 | Ga0307405_10075584 | Ga0307405_100755843 | 267 |
| 118 | 3300031824 | Ga0307413_10449708 | Ga0307413_104497081 | 267 |
| 119 | 3300031852 | Ga0307410_10545451 | Ga0307410_105454511 | 267 |
| 120 | 3300031903 | Ga0307407_10017155 | Ga0307407_100171552 | 267 |
| 121 | 3300031903 | Ga0307407_10020389 | Ga0307407_100203893 | 267 |
| 122 | 3300031903 | Ga0307407_10209722 | Ga0307407_102097222 | 267 |
| 123 | 3300031911 | Ga0307412_10127394 | Ga0307412_101273941 | 267 |
| 124 | 3300031911 | Ga0307412_10155982 | Ga0307412_101559822 | 267 |
| 125 | 3300031995 | Ga0307409_100041738 | Ga0307409_1000417383 | 267 |
| 126 | 3300031995 | Ga0307409_100085917 | Ga0307409_1000859172 | 267 |
| 127 | 3300032002 | Ga0307416_100346855 | Ga0307416_1003468552 | 267 |
| 128 | 3300032005 | Ga0307411_10013804 | Ga0307411_100138042 | 267 |
| 129 | 3300032126 | Ga0307415_100031515 | Ga0307415_1000315151 | 267 |
| 130 | 3300041451 | Ga0451791_0418192 | Ga0451791_0418192_79_945 | 267 |
| 131 | 3300049574 | Ga0501038_0058905 | Ga0501038_0058905_255_1136 | 267 |
| 132 | 3300049579 | Ga0501043_0008178 | Ga0501043_0008178_6303_7184 | 267 |
| 133 | 3300002773 | JGI25152J39213_1000574 | JGI25152J39213_10005747 | 268 |
| 134 | 3300005327 | Ga0070658_10000294 | Ga0070658_1000029433 | 268 |
| 135 | 3300005336 | Ga0070680_100306881 | Ga0070680_1003068811 | 268 |
| 136 | 3300006042 | Ga0075368_10090537 | Ga0075368_100905372 | 268 |
| 137 | 3300006051 | Ga0075364_10028857 | Ga0075364_100288572 | 268 |
| 138 | 3300006353 | Ga0075370_10013844 | Ga0075370_100138442 | 268 |
| 139 | 3300013105 | Ga0157369_10069146 | Ga0157369_100691462 | 268 |
| 140 | 3300013105 | Ga0157369_10072394 | Ga0157369_100723943 | 268 |
| 141 | 3300025258 | Ga0209129_1000059 | Ga0209129_100005950 | 268 |
| 142 | 3300025294 | Ga0209025_1000398 | Ga0209025_100039850 | 268 |
| 143 | 3300025909 | Ga0207705_10000417 | Ga0207705_1000041733 | 268 |
| 144 | 3300037312 | Ga0395899_0050150 | Ga0395899_0050150_1519_2331 | 268 |
| 145 | 3300037418 | Ga0395900_0242553 | Ga0395900_0242553_399_1211 | 268 |
| 146 | 3300037418 | Ga0395900_0309158 | Ga0395900_0309158_576_1388 | 268 |
| 147 | 3300037466 | Ga0395898_0288881 | Ga0395898_0288881_213_1025 | 268 |
| 148 | 3300038443 | Ga0395901_0294783 | Ga0395901_0294783_579_1391 | 268 |
| 149 | 3300042122 | Ga0450920_009872 | Ga0450920_009872_58_939 | 268 |
| 150 | 3300048904 | Ga0496101_0084844 | Ga0496101_0084844_11_823 | 268 |
| 151 | 3300048913 | Ga0496110_0048377 | Ga0496110_0048377_1912_2724 | 268 |
| 152 | 3300048917 | Ga0496114_0113504 | Ga0496114_0113504_990_1802 | 268 |
| 153 | 3300049586 | Ga0501070_0084035 | Ga0501070_0084035_1689_2537 | 268 |
| 154 | 3300050494 | nmdc:mga06z11_102957_c1 | nmdc:mga06z11_102957_c1_588_1436 | 268 |
| 155 | 3300050495 | nmdc:mga04h51_31858_c1 | nmdc:mga04h51_31858_c1_153_1001 | 268 |
| 156 | 3300050496 | nmdc:mga07m45_26587_c1 | nmdc:mga07m45_26587_c1_1546_2394 | 268 |
| 157 | 3300009098 | Ga0105245_10003821 | Ga0105245_1000382110 | 270 |
| 158 | 3300025927 | Ga0207687_10006765 | Ga0207687_100067657 | 270 |
| 159 | 3300048928 | Ga0496125_0000015 | Ga0496125_0000015_288089_289042 | 270 |
| 160 | 3300005366 | Ga0070659_100256620 | Ga0070659_1002566201 | 271 |
| 161 | 3300005467 | Ga0070706_100160674 | Ga0070706_1001606742 | 271 |
| 162 | 3300025910 | Ga0207684_10196167 | Ga0207684_101961672 | 271 |
| 163 | 3300045976 | Ga0466967_0112317 | Ga0466967_0112317_554_1384 | 271 |
| 164 | 3300046516 | Ga0495628_0003340 | Ga0495628_0003340_13495_14340 | 271 |
| 165 | 3300048924 | Ga0496121_0086997 | Ga0496121_0086997_524_1366 | 271 |
| 166 | 3300049584 | Ga0501068_0370570 | Ga0501068_0370570_77_898 | 271 |
| 167 | 3300049586 | Ga0501070_0033712 | Ga0501070_0033712_2864_3679 | 271 |
| 168 | 3300049587 | Ga0501071_0473414 | Ga0501071_0473414_82_918 | 271 |
| 169 | 3300049589 | Ga0501073_0000052 | Ga0501073_0000052_31053_31868 | 271 |
| 170 | 3300049742 | Ga0501080_0069733 | Ga0501080_0069733_1889_2704 | 271 |
| 171 | 3300005548 | Ga0070665_100014657 | Ga0070665_1000146572 | 272 |
| 172 | 3300005841 | Ga0068863_100200201 | Ga0068863_1002002012 | 272 |
| 173 | 3300025931 | Ga0207644_10003381 | Ga0207644_100033818 | 272 |
| 174 | 3300026088 | Ga0207641_10208434 | Ga0207641_102084342 | 272 |
| 175 | 3300028379 | Ga0268266_10098060 | Ga0268266_100980602 | 272 |
| 176 | 3300049582 | Ga0501048_0059865 | Ga0501048_0059865_354_1340 | 272 |
| 177 | 3300005327 | Ga0070658_10005814 | Ga0070658_1000581410 | 273 |
| 178 | 3300006038 | Ga0075365_10005224 | Ga0075365_100052243 | 273 |
| 179 | 3300006051 | Ga0075364_10010750 | Ga0075364_100107504 | 273 |
| 180 | 3300025909 | Ga0207705_10122173 | Ga0207705_101221732 | 273 |
| 181 | 3300045049 | Ga0466959_0271433 | Ga0466959_0271433_206_1105 | 273 |
| 182 | 3300048929 | Ga0496126_0051450 | Ga0496126_0051450_1957_2778 | 273 |
| 183 | 3300049573 | Ga0501037_0013267 | Ga0501037_0013267_2397_3218 | 273 |
| 184 | 3300049579 | Ga0501043_0070230 | Ga0501043_0070230_743_1564 | 273 |
| 185 | 3300049581 | Ga0501047_0002907 | Ga0501047_0002907_12123_12944 | 273 |
| 186 | 3300049822 | Ga0501035_0007414 | Ga0501035_0007414_5962_6783 | 273 |
| 187 | 3300049823 | Ga0501044_0003445 | Ga0501044_0003445_4149_4970 | 273 |
| 188 | 3300050491 | nmdc:mga00v17_12383_c1 | nmdc:mga00v17_12383_c1_1542_2363 | 273 |
| 189 | 3300050491 | nmdc:mga00v17_311263_c1 | nmdc:mga00v17_311263_c1_10_831 | 273 |
| 190 | 3300050492 | nmdc:mga0yw44_51150_c1 | nmdc:mga0yw44_51150_c1_1340_2161 | 273 |
| 191 | 3300050516 | nmdc:mga0sz30_10037_c1 | nmdc:mga0sz30_10037_c1_1536_2357 | 273 |
| 192 | 3300050516 | nmdc:mga0sz30_96352_c1 | nmdc:mga0sz30_96352_c1_97_918 | 273 |
| 193 | 3300053104 | Ga0500556_0001349 | Ga0500556_0001349_6629_7450 | 273 |
| 194 | 3300053108 | Ga0500562_003197 | Ga0500562_003197_2746_3567 | 273 |
| 195 | 3300053133 | Ga0500655_001344 | Ga0500655_001344_117_938 | 273 |
| 196 | 3300053136 | Ga0500559_0000462 | Ga0500559_0000462_14749_15570 | 273 |
| 197 | 3300053153 | Ga0500616_0034816 | Ga0500616_0034816_1650_2471 | 273 |
| 198 | iso_pu_bacteria | 2816332139 | 2816509539 | 273 |
| 199 | 3300045976 | Ga0466967_0747235 | Ga0466967_0747235_83_949 | 274 |
| 200 | 3300049571 | Ga0501034_0108966 | Ga0501034_0108966_625_1449 | 274 |
| 201 | 3300049588 | Ga0501072_0061081 | Ga0501072_0061081_2135_2959 | 274 |
| 202 | 3300049589 | Ga0501073_0022505 | Ga0501073_0022505_158_982 | 274 |
| 203 | 3300053153 | Ga0500616_0001033 | Ga0500616_0001033_1908_2732 | 274 |
| 204 | 3300020082 | Ga0206353_10786700 | Ga0206353_107867002 | 275 |
| 205 | 3300044658 | Ga0466972_0015410 | Ga0466972_0015410_1981_2832 | 275 |
| 206 | 3300044658 | Ga0466972_0065694 | Ga0466972_0065694_279_1154 | 275 |
| 207 | 3300003285 | Ga0007423J48922_100316 | Ga0007423J48922_1003165 | 276 |
| 208 | 3300009011 | Ga0105251_10009132 | Ga0105251_100091323 | 276 |
| 209 | 3300009036 | Ga0105244_10003037 | Ga0105244_100030377 | 276 |
| 210 | 3300009036 | Ga0105244_10182356 | Ga0105244_101823561 | 276 |
| 211 | 3300009148 | Ga0105243_10025612 | Ga0105243_100256123 | 276 |
| 212 | 3300011119 | Ga0105246_10010371 | Ga0105246_100103715 | 276 |
| 213 | 3300011119 | Ga0105246_10063634 | Ga0105246_100636341 | 276 |
| 214 | 3300013105 | Ga0157369_10234635 | Ga0157369_102346352 | 276 |
| 215 | 3300013308 | Ga0157375_10427317 | Ga0157375_104273172 | 276 |
| 216 | 3300014326 | Ga0157380_10312073 | Ga0157380_103120732 | 276 |
| 217 | 3300025315 | Ga0207697_10004756 | Ga0207697_100047564 | 276 |
| 218 | 3300025728 | Ga0207655_1006307 | Ga0207655_10063076 | 276 |
| 219 | 3300031548 | Ga0307408_100018137 | Ga0307408_1000181373 | 276 |
| 220 | 3300031548 | Ga0307408_100160776 | Ga0307408_1001607761 | 276 |
| 221 | 3300031824 | Ga0307413_10029605 | Ga0307413_100296053 | 276 |
| 222 | 3300031824 | Ga0307413_10312534 | Ga0307413_103125341 | 276 |
| 223 | 3300031852 | Ga0307410_10025211 | Ga0307410_100252112 | 276 |
| 224 | 3300031903 | Ga0307407_10115355 | Ga0307407_101153552 | 276 |
| 225 | 3300031911 | Ga0307412_10041173 | Ga0307412_100411733 | 276 |
| 226 | 3300031995 | Ga0307409_100082709 | Ga0307409_1000827092 | 276 |
| 227 | 3300037418 | Ga0395900_0154906 | Ga0395900_0154906_1187_2026 | 276 |
| 228 | 3300038443 | Ga0395901_0169418 | Ga0395901_0169418_170_1009 | 276 |
| 229 | 3300046463 | Ga0495653_0150395 | Ga0495653_0150395_47_886 | 276 |
| 230 | 3300046472 | Ga0495580_0007457 | Ga0495580_0007457_6631_7470 | 276 |
| 231 | 3300046475 | Ga0495639_0011473 | Ga0495639_0011473_1874_2713 | 276 |
| 232 | 3300046476 | Ga0495662_0010414 | Ga0495662_0010414_2993_3832 | 276 |
| 233 | 3300046477 | Ga0495664_0007121 | Ga0495664_0007121_3291_4130 | 276 |
| 234 | 3300046517 | Ga0495630_0117299 | Ga0495630_0117299_459_1298 | 276 |
| 235 | 3300046518 | Ga0495631_0072610 | Ga0495631_0072610_49_888 | 276 |
| 236 | 3300046522 | Ga0495643_0031916 | Ga0495643_0031916_1796_2635 | 276 |
| 237 | 3300046531 | Ga0495665_0000584 | Ga0495665_0000584_196_1035 | 276 |
| 238 | 3300046535 | Ga0495586_0007797 | Ga0495586_0007797_1437_2276 | 276 |
| 239 | 3300046535 | Ga0495586_0194597 | Ga0495586_0194597_51_890 | 276 |
| 240 | 3300046536 | Ga0495587_0001644 | Ga0495587_0001644_10211_11050 | 276 |
| 241 | 3300046557 | Ga0495622_0063894 | Ga0495622_0063894_268_1107 | 276 |
| 242 | 3300046559 | Ga0495667_0000447 | Ga0495667_0000447_8222_9061 | 276 |
| 243 | 3300046615 | Ga0495656_0000881 | Ga0495656_0000881_323_1162 | 276 |
| 244 | 3300046615 | Ga0495656_0175416 | Ga0495656_0175416_195_1034 | 276 |
| 245 | 3300046616 | Ga0495668_0006344 | Ga0495668_0006344_4081_4920 | 276 |
| 246 | 3300046674 | Ga0495588_0002202 | Ga0495588_0002202_5407_6246 | 276 |
| 247 | 3300046674 | Ga0495588_0005545 | Ga0495588_0005545_1225_2064 | 276 |
| 248 | 3300046674 | Ga0495588_0022176 | Ga0495588_0022176_825_1664 | 276 |
| 249 | 3300046675 | Ga0495657_0024693 | Ga0495657_0024693_3311_4150 | 276 |
| 250 | 3300046679 | Ga0495623_0043500 | Ga0495623_0043500_362_1201 | 276 |
| 251 | 3300046691 | Ga0495670_0000915 | Ga0495670_0000915_12216_13055 | 276 |
| 252 | 3300046809 | Ga0495600_0053174 | Ga0495600_0053174_1676_2515 | 276 |
| 253 | 3300047315 | Ga0495581_0008259 | Ga0495581_0008259_1775_2614 | 276 |
| 254 | 3300047315 | Ga0495581_0025673 | Ga0495581_0025673_784_1623 | 276 |
| 255 | 3300047315 | Ga0495581_0114058 | Ga0495581_0114058_363_1202 | 276 |
| 256 | 3300047315 | Ga0495581_0248464 | Ga0495581_0248464_113_952 | 276 |
| 257 | 3300047318 | Ga0495636_0082010 | Ga0495636_0082010_390_1229 | 276 |
| 258 | 3300047322 | Ga0495680_0016371 | Ga0495680_0016371_2438_3277 | 276 |
| 259 | 3300047322 | Ga0495680_0053400 | Ga0495680_0053400_1537_2376 | 276 |
| 260 | 3300047447 | Ga0495685_104775 | Ga0495685_104775_59_898 | 276 |
| 261 | 3300047471 | Ga0495684_0247516 | Ga0495684_0247516_195_1034 | 276 |
| 262 | 3300047673 | Ga0495593_0005077 | Ga0495593_0005077_4655_5494 | 276 |
| 263 | 3300048903 | Ga0496100_0019102 | Ga0496100_0019102_500_1339 | 276 |
| 264 | 3300048904 | Ga0496101_0087091 | Ga0496101_0087091_204_1043 | 276 |
| 265 | 3300048904 | Ga0496101_0467397 | Ga0496101_0467397_66_905 | 276 |
| 266 | 3300048905 | Ga0496102_0138551 | Ga0496102_0138551_921_1760 | 276 |
| 267 | 3300048906 | Ga0496103_0112062 | Ga0496103_0112062_176_1015 | 276 |
| 268 | 3300048908 | Ga0496105_0074534 | Ga0496105_0074534_1764_2603 | 276 |
| 269 | 3300048909 | Ga0496106_0397548 | Ga0496106_0397548_161_1000 | 276 |
| 270 | 3300048910 | Ga0496107_0312524 | Ga0496107_0312524_282_1121 | 276 |
| 271 | 3300048911 | Ga0496108_0090363 | Ga0496108_0090363_1261_2100 | 276 |
| 272 | 3300048911 | Ga0496108_0353425 | Ga0496108_0353425_234_1073 | 276 |
| 273 | 3300048912 | Ga0496109_0075703 | Ga0496109_0075703_970_1809 | 276 |
| 274 | 3300048912 | Ga0496109_0578551 | Ga0496109_0578551_154_993 | 276 |
| 275 | 3300048913 | Ga0496110_0027468 | Ga0496110_0027468_2930_3769 | 276 |
| 276 | 3300048913 | Ga0496110_0122654 | Ga0496110_0122654_82_921 | 276 |
| 277 | 3300048914 | Ga0496111_0244775 | Ga0496111_0244775_27_866 | 276 |
| 278 | 3300048918 | Ga0496115_0435635 | Ga0496115_0435635_161_1000 | 276 |
| 279 | 3300048920 | Ga0496117_0015667 | Ga0496117_0015667_3167_3997 | 276 |
| 280 | 3300048921 | Ga0496118_0025612 | Ga0496118_0025612_2015_2845 | 276 |
| 281 | 3300048922 | Ga0496119_0006819 | Ga0496119_0006819_4387_5217 | 276 |
| 282 | 3300048923 | Ga0496120_0004918 | Ga0496120_0004918_4677_5507 | 276 |
| 283 | 3300048927 | Ga0496124_0138777 | Ga0496124_0138777_50_889 | 276 |
| 284 | 3300048928 | Ga0496125_0136034 | Ga0496125_0136034_542_1381 | 276 |
| 285 | 3300049571 | Ga0501034_0181685 | Ga0501034_0181685_827_1657 | 276 |
| 286 | 3300053129 | Ga0500628_030945 | Ga0500628_030945_266_1096 | 276 |
| 287 | 3300059508 | Ga0587088_005039 | Ga0587088_005039_158_997 | 276 |
| 288 | 3300059605 | Ga0587106_000709 | Ga0587106_000709_1279_2118 | 276 |
| 289 | 3300059605 | Ga0587106_001521 | Ga0587106_001521_244_1083 | 276 |
| 290 | iso_pu_bacteria | 2643221632 | 2644182703 | 276 |
| 291 | iso_pu_bacteria | 2837268691 | 2837270588 | 276 |
| 292 | iso_pu_bacteria | 2884994152 | 2884994286 | 276 |
| 293 | 3300005471 | Ga0070698_100013237 | Ga0070698_1000132373 | 277 |
| 294 | 3300013105 | Ga0157369_10485482 | Ga0157369_104854821 | 277 |
| 295 | 3300014325 | Ga0163163_10103726 | Ga0163163_101037262 | 277 |
| 296 | 3300031731 | Ga0307405_10328450 | Ga0307405_103284501 | 277 |
| 297 | 3300044684 | Ga0466966_0157987 | Ga0466966_0157987_67_939 | 277 |
| 298 | 3300044901 | Ga0466960_0082251 | Ga0466960_0082251_310_1293 | 277 |
| 299 | 3300046471 | Ga0495650_0003728 | Ga0495650_0003728_2252_3085 | 277 |
| 300 | 3300046615 | Ga0495656_0006359 | Ga0495656_0006359_3054_3890 | 277 |
| 301 | 3300048915 | Ga0496112_0059452 | Ga0496112_0059452_749_1588 | 277 |
| 302 | 3300048925 | Ga0496122_0015418 | Ga0496122_0015418_4532_5419 | 277 |
| 303 | 3300049580 | Ga0501046_0070287 | Ga0501046_0070287_1751_2608 | 277 |
| 304 | 3300049823 | Ga0501044_0270030 | Ga0501044_0270030_345_1190 | 277 |
| 305 | iso_pu_bacteria | 2643221697 | 2644538701 | 277 |
| 306 | iso_pu_bacteria | 8056060235 | 8056060392 | 277 |
| 307 | 3300003578 | Ga0006562J51391_1099017 | Ga0006562J51391_10990171 | 278 |
| 308 | 3300005327 | Ga0070658_10154370 | Ga0070658_101543702 | 278 |
| 309 | 3300005335 | Ga0070666_10032696 | Ga0070666_100326962 | 278 |
| 310 | 3300005337 | Ga0070682_100030642 | Ga0070682_1000306422 | 278 |
| 311 | 3300005406 | Ga0070703_10022665 | Ga0070703_100226651 | 278 |
| 312 | 3300005436 | Ga0070713_100614065 | Ga0070713_1006140651 | 278 |
| 313 | 3300005544 | Ga0070686_100168400 | Ga0070686_1001684001 | 278 |
| 314 | 3300005545 | Ga0070695_100043453 | Ga0070695_1000434531 | 278 |
| 315 | 3300005546 | Ga0070696_100046797 | Ga0070696_1000467972 | 278 |
| 316 | 3300005563 | Ga0068855_100108197 | Ga0068855_1001081973 | 278 |
| 317 | 3300005577 | Ga0068857_100000679 | Ga0068857_10000067912 | 278 |
| 318 | 3300005615 | Ga0070702_100005004 | Ga0070702_1000050044 | 278 |
| 319 | 3300005616 | Ga0068852_100026596 | Ga0068852_1000265963 | 278 |
| 320 | 3300005834 | Ga0068851_10000043 | Ga0068851_1000004311 | 278 |
| 321 | 3300005844 | Ga0068862_100096755 | Ga0068862_1000967551 | 278 |
| 322 | 3300005985 | Ga0081539_10000015 | Ga0081539_100000159 | 278 |
| 323 | 3300006178 | Ga0075367_10015307 | Ga0075367_100153073 | 278 |
| 324 | 3300006237 | Ga0097621_100045271 | Ga0097621_1000452713 | 278 |
| 325 | 3300006353 | Ga0075370_10075457 | Ga0075370_100754572 | 278 |
| 326 | 3300006358 | Ga0068871_100069945 | Ga0068871_1000699452 | 278 |
| 327 | 3300009101 | Ga0105247_10011158 | Ga0105247_100111583 | 278 |
| 328 | 3300009174 | Ga0105241_10156890 | Ga0105241_101568902 | 278 |
| 329 | 3300009177 | Ga0105248_10000796 | Ga0105248_100007962 | 278 |
| 330 | 3300009545 | Ga0105237_10307351 | Ga0105237_103073512 | 278 |
| 331 | 3300009551 | Ga0105238_10000990 | Ga0105238_100009907 | 278 |
| 332 | 3300010375 | Ga0105239_10294439 | Ga0105239_102944392 | 278 |
| 333 | 3300013308 | Ga0157375_10070964 | Ga0157375_100709642 | 278 |
| 334 | 3300013308 | Ga0157375_10383042 | Ga0157375_103830422 | 278 |
| 335 | 3300025321 | Ga0207656_10000001 | Ga0207656_10000001600 | 278 |
| 336 | 3300025321 | Ga0207656_10000003 | Ga0207656_10000003706 | 278 |
| 337 | 3300025321 | Ga0207656_10000004 | Ga0207656_10000004563 | 278 |
| 338 | 3300025903 | Ga0207680_10019837 | Ga0207680_100198372 | 278 |
| 339 | 3300025903 | Ga0207680_10020065 | Ga0207680_100200653 | 278 |
| 340 | 3300025904 | Ga0207647_10005591 | Ga0207647_100055918 | 278 |
| 341 | 3300025909 | Ga0207705_10014168 | Ga0207705_100141682 | 278 |
| 342 | 3300025909 | Ga0207705_10258268 | Ga0207705_102582682 | 278 |
| 343 | 3300025914 | Ga0207671_10000001 | Ga0207671_10000001598 | 278 |
| 344 | 3300025919 | Ga0207657_10209298 | Ga0207657_102092982 | 278 |
| 345 | 3300025924 | Ga0207694_10000047 | Ga0207694_1000004742 | 278 |
| 346 | 3300025932 | Ga0207690_10316542 | Ga0207690_103165421 | 278 |
| 347 | 3300025941 | Ga0207711_10001765 | Ga0207711_100017655 | 278 |
| 348 | 3300025949 | Ga0207667_10001391 | Ga0207667_1000139112 | 278 |
| 349 | 3300026116 | Ga0207674_10006995 | Ga0207674_100069955 | 278 |
| 350 | 3300026121 | Ga0207683_10000893 | Ga0207683_1000089316 | 278 |
| 351 | 3300026142 | Ga0207698_10000325 | Ga0207698_100003258 | 278 |
| 352 | 3300031995 | Ga0307409_100363558 | Ga0307409_1003635582 | 278 |
| 353 | 3300032126 | Ga0307415_100170871 | Ga0307415_1001708712 | 278 |
| 354 | 3300037312 | Ga0395899_0014879 | Ga0395899_0014879_3457_4365 | 278 |
| 355 | 3300037418 | Ga0395900_0013692 | Ga0395900_0013692_913_1764 | 278 |
| 356 | 3300037418 | Ga0395900_0106478 | Ga0395900_0106478_587_1474 | 278 |
| 357 | 3300037418 | Ga0395900_0206677 | Ga0395900_0206677_73_951 | 278 |
| 358 | 3300037418 | Ga0395900_0618234 | Ga0395900_0618234_54_962 | 278 |
| 359 | 3300037466 | Ga0395898_0195454 | Ga0395898_0195454_211_1119 | 278 |
| 360 | 3300038443 | Ga0395901_0044683 | Ga0395901_0044683_2070_2978 | 278 |
| 361 | 3300038443 | Ga0395901_0138510 | Ga0395901_0138510_501_1352 | 278 |
| 362 | 3300038443 | Ga0395901_0273236 | Ga0395901_0273236_272_1159 | 278 |
| 363 | 3300044683 | Ga0466965_0009347 | Ga0466965_0009347_2008_2895 | 278 |
| 364 | 3300046476 | Ga0495662_0017521 | Ga0495662_0017521_210_1091 | 278 |
| 365 | 3300048906 | Ga0496103_0051860 | Ga0496103_0051860_880_1740 | 278 |
| 366 | 3300048907 | Ga0496104_0061203 | Ga0496104_0061203_2084_2944 | 278 |
| 367 | 3300048910 | Ga0496107_0352838 | Ga0496107_0352838_59_919 | 278 |
| 368 | 3300048911 | Ga0496108_0026032 | Ga0496108_0026032_3068_3928 | 278 |
| 369 | 3300048912 | Ga0496109_0042257 | Ga0496109_0042257_342_1202 | 278 |
| 370 | 3300048913 | Ga0496110_0015868 | Ga0496110_0015868_4679_5539 | 278 |
| 371 | 3300048914 | Ga0496111_0023603 | Ga0496111_0023603_3177_4037 | 278 |
| 372 | 3300048915 | Ga0496112_0010337 | Ga0496112_0010337_5177_6037 | 278 |
| 373 | 3300048917 | Ga0496114_0032121 | Ga0496114_0032121_1420_2280 | 278 |
| 374 | 3300048917 | Ga0496114_0200241 | Ga0496114_0200241_48_986 | 278 |
| 375 | 3300048923 | Ga0496120_0023475 | Ga0496120_0023475_736_1572 | 278 |
| 376 | 3300049568 | Ga0501031_0171724 | Ga0501031_0171724_343_1215 | 278 |
| 377 | 3300049569 | Ga0501032_0047607 | Ga0501032_0047607_2035_2883 | 278 |
| 378 | 3300049570 | Ga0501033_0070474 | Ga0501033_0070474_37_885 | 278 |
| 379 | 3300049571 | Ga0501034_0011189 | Ga0501034_0011189_6408_7244 | 278 |
| 380 | 3300049571 | Ga0501034_0026967 | Ga0501034_0026967_2206_3066 | 278 |
| 381 | 3300049572 | Ga0501036_0047355 | Ga0501036_0047355_1920_2789 | 278 |
| 382 | 3300049573 | Ga0501037_0015228 | Ga0501037_0015228_421_1257 | 278 |
| 383 | 3300049574 | Ga0501038_0106279 | Ga0501038_0106279_319_1167 | 278 |
| 384 | 3300049575 | Ga0501039_0171666 | Ga0501039_0171666_258_1106 | 278 |
| 385 | 3300049579 | Ga0501043_0113183 | Ga0501043_0113183_414_1262 | 278 |
| 386 | 3300049581 | Ga0501047_0046170 | Ga0501047_0046170_2757_3593 | 278 |
| 387 | 3300049583 | Ga0501067_0008863 | Ga0501067_0008863_941_1816 | 278 |
| 388 | 3300049586 | Ga0501070_0226239 | Ga0501070_0226239_210_1058 | 278 |
| 389 | 3300049588 | Ga0501072_0383250 | Ga0501072_0383250_149_1009 | 278 |
| 390 | 3300049589 | Ga0501073_0096568 | Ga0501073_0096568_900_1748 | 278 |
| 391 | 3300049823 | Ga0501044_0007662 | Ga0501044_0007662_4614_5450 | 278 |
| 392 | 3300050496 | nmdc:mga07m45_123473_c1 | nmdc:mga07m45_123473_c1_202_1071 | 278 |
| 393 | iso_pu_bacteria | 2643221690 | 2644504985 | 278 |
| 394 | iso_pu_bacteria | 2773857762 | 2774394709 | 278 |
| 395 | iso_pu_bacteria | 2808606439 | 2809194447 | 278 |
| 396 | iso_pu_bacteria | 2811994874 | 2812331308 | 278 |
| 397 | iso_pu_bacteria | 2811994878 | 2812349196 | 278 |
| 398 | iso_pu_bacteria | 2811994880 | 2812362412 | 278 |
| 399 | iso_pu_bacteria | 2848551377 | 2848552189 | 278 |
| 400 | iso_pu_bacteria | 2891968417 | 2891973093 | 278 |
| 401 | iso_pu_bacteria | 2919051321 | 2919052857 | 278 |
| 402 | 3300005334 | Ga0068869_100011503 | Ga0068869_1000115033 | 279 |
| 403 | 3300005335 | Ga0070666_10019310 | Ga0070666_100193103 | 279 |
| 404 | 3300005338 | Ga0068868_100003538 | Ga0068868_1000035383 | 279 |
| 405 | 3300005338 | Ga0068868_100073895 | Ga0068868_1000738953 | 279 |
| 406 | 3300005339 | Ga0070660_100143210 | Ga0070660_1001432102 | 279 |
| 407 | 3300005339 | Ga0070660_100149931 | Ga0070660_1001499312 | 279 |
| 408 | 3300005339 | Ga0070660_100301230 | Ga0070660_1003012302 | 279 |
| 409 | 3300005345 | Ga0070692_10011261 | Ga0070692_100112613 | 279 |
| 410 | 3300005347 | Ga0070668_100107076 | Ga0070668_1001070762 | 279 |
| 411 | 3300005353 | Ga0070669_100011447 | Ga0070669_1000114472 | 279 |
| 412 | 3300005353 | Ga0070669_100074264 | Ga0070669_1000742642 | 279 |
| 413 | 3300005354 | Ga0070675_100003497 | Ga0070675_1000034976 | 279 |
| 414 | 3300005354 | Ga0070675_100232115 | Ga0070675_1002321152 | 279 |
| 415 | 3300005366 | Ga0070659_100011867 | Ga0070659_1000118677 | 279 |
| 416 | 3300005366 | Ga0070659_100015801 | Ga0070659_1000158012 | 279 |
| 417 | 3300005366 | Ga0070659_100164258 | Ga0070659_1001642581 | 279 |
| 418 | 3300005444 | Ga0070694_100067911 | Ga0070694_1000679112 | 279 |
| 419 | 3300005459 | Ga0068867_100112578 | Ga0068867_1001125782 | 279 |
| 420 | 3300005563 | Ga0068855_100117728 | Ga0068855_1001177282 | 279 |
| 421 | 3300005577 | Ga0068857_100155919 | Ga0068857_1001559191 | 279 |
| 422 | 3300005842 | Ga0068858_100051879 | Ga0068858_1000518792 | 279 |
| 423 | 3300006058 | Ga0075432_10000977 | Ga0075432_100009773 | 279 |
| 424 | 3300006058 | Ga0075432_10003439 | Ga0075432_100034393 | 279 |
| 425 | 3300006852 | Ga0075433_10072382 | Ga0075433_100723822 | 279 |
| 426 | 3300009093 | Ga0105240_10072773 | Ga0105240_100727734 | 279 |
| 427 | 3300009098 | Ga0105245_10155757 | Ga0105245_101557572 | 279 |
| 428 | 3300009176 | Ga0105242_10013233 | Ga0105242_100132335 | 279 |
| 429 | 3300009553 | Ga0105249_10007621 | Ga0105249_1000762112 | 279 |
| 430 | 3300011119 | Ga0105246_10004339 | Ga0105246_100043395 | 279 |
| 431 | 3300011119 | Ga0105246_10004787 | Ga0105246_100047875 | 279 |
| 432 | 3300013100 | Ga0157373_10058774 | Ga0157373_100587742 | 279 |
| 433 | 3300013104 | Ga0157370_10059863 | Ga0157370_100598635 | 279 |
| 434 | 3300013105 | Ga0157369_10050315 | Ga0157369_100503153 | 279 |
| 435 | 3300014969 | Ga0157376_10450498 | Ga0157376_104504982 | 279 |
| 436 | 3300017792 | Ga0163161_10357160 | Ga0163161_103571602 | 279 |
| 437 | 3300025254 | Ga0209148_1009645 | Ga0209148_10096452 | 279 |
| 438 | 3300025303 | Ga0209051_1026483 | Ga0209051_10264832 | 279 |
| 439 | 3300025728 | Ga0207655_1012056 | Ga0207655_10120565 | 279 |
| 440 | 3300025901 | Ga0207688_10001644 | Ga0207688_100016449 | 279 |
| 441 | 3300025907 | Ga0207645_10055333 | Ga0207645_100553331 | 279 |
| 442 | 3300025919 | Ga0207657_10004685 | Ga0207657_1000468511 | 279 |
| 443 | 3300025919 | Ga0207657_10074517 | Ga0207657_100745172 | 279 |
| 444 | 3300025923 | Ga0207681_10103584 | Ga0207681_101035841 | 279 |
| 445 | 3300025925 | Ga0207650_10057841 | Ga0207650_100578412 | 279 |
| 446 | 3300025926 | Ga0207659_10141418 | Ga0207659_101414182 | 279 |
| 447 | 3300025932 | Ga0207690_10000634 | Ga0207690_100006344 | 279 |
| 448 | 3300025939 | Ga0207665_10000538 | Ga0207665_1000053813 | 279 |
| 449 | 3300025940 | Ga0207691_10001407 | Ga0207691_100014073 | 279 |
| 450 | 3300025942 | Ga0207689_10006706 | Ga0207689_100067066 | 279 |
| 451 | 3300026067 | Ga0207678_10016395 | Ga0207678_100163954 | 279 |
| 452 | 3300026075 | Ga0207708_10009485 | Ga0207708_100094855 | 279 |
| 453 | 3300026089 | Ga0207648_10133371 | Ga0207648_101333712 | 279 |
| 454 | 3300026118 | Ga0207675_100012912 | Ga0207675_1000129123 | 279 |
| 455 | 3300026121 | Ga0207683_10031308 | Ga0207683_100313083 | 279 |
| 456 | 3300026142 | Ga0207698_10076983 | Ga0207698_100769832 | 279 |
| 457 | 3300027907 | Ga0207428_10027367 | Ga0207428_100273672 | 279 |
| 458 | 3300031507 | Ga0307509_10045172 | Ga0307509_100451722 | 279 |
| 459 | 3300031548 | Ga0307408_100028445 | Ga0307408_1000284452 | 279 |
| 460 | 3300031548 | Ga0307408_100028564 | Ga0307408_1000285643 | 279 |
| 461 | 3300031548 | Ga0307408_100074623 | Ga0307408_1000746232 | 279 |
| 462 | 3300031548 | Ga0307408_100081643 | Ga0307408_1000816432 | 279 |
| 463 | 3300031548 | Ga0307408_100139142 | Ga0307408_1001391422 | 279 |
| 464 | 3300031548 | Ga0307408_100185578 | Ga0307408_1001855782 | 279 |
| 465 | 3300031548 | Ga0307408_100223538 | Ga0307408_1002235382 | 279 |
| 466 | 3300031731 | Ga0307405_10012485 | Ga0307405_100124854 | 279 |
| 467 | 3300031731 | Ga0307405_10177055 | Ga0307405_101770552 | 279 |
| 468 | 3300031731 | Ga0307405_10298740 | Ga0307405_102987401 | 279 |
| 469 | 3300031731 | Ga0307405_10414128 | Ga0307405_104141281 | 279 |
| 470 | 3300031824 | Ga0307413_10095613 | Ga0307413_100956132 | 279 |
| 471 | 3300031824 | Ga0307413_10218402 | Ga0307413_102184021 | 279 |
| 472 | 3300031852 | Ga0307410_10011737 | Ga0307410_100117372 | 279 |
| 473 | 3300031852 | Ga0307410_10039429 | Ga0307410_100394292 | 279 |
| 474 | 3300031852 | Ga0307410_10196435 | Ga0307410_101964352 | 279 |
| 475 | 3300031852 | Ga0307410_10575817 | Ga0307410_105758171 | 279 |
| 476 | 3300031901 | Ga0307406_10079316 | Ga0307406_100793162 | 279 |
| 477 | 3300031901 | Ga0307406_10110129 | Ga0307406_101101291 | 279 |
| 478 | 3300031901 | Ga0307406_10111794 | Ga0307406_101117942 | 279 |
| 479 | 3300031901 | Ga0307406_10135826 | Ga0307406_101358262 | 279 |
| 480 | 3300031903 | Ga0307407_10013057 | Ga0307407_100130573 | 279 |
| 481 | 3300031903 | Ga0307407_10050304 | Ga0307407_100503042 | 279 |
| 482 | 3300031903 | Ga0307407_10249006 | Ga0307407_102490062 | 279 |
| 483 | 3300031911 | Ga0307412_10010488 | Ga0307412_100104882 | 279 |
| 484 | 3300031911 | Ga0307412_10013288 | Ga0307412_100132883 | 279 |
| 485 | 3300031911 | Ga0307412_10016632 | Ga0307412_100166322 | 279 |
| 486 | 3300031911 | Ga0307412_10043435 | Ga0307412_100434352 | 279 |
| 487 | 3300031911 | Ga0307412_10065915 | Ga0307412_100659152 | 279 |
| 488 | 3300031911 | Ga0307412_10158358 | Ga0307412_101583582 | 279 |
| 489 | 3300031911 | Ga0307412_10371765 | Ga0307412_103717652 | 279 |
| 490 | 3300031995 | Ga0307409_100009471 | Ga0307409_1000094714 | 279 |
| 491 | 3300031995 | Ga0307409_100025026 | Ga0307409_1000250262 | 279 |
| 492 | 3300031995 | Ga0307409_100040406 | Ga0307409_1000404063 | 279 |
| 493 | 3300032002 | Ga0307416_100333248 | Ga0307416_1003332481 | 279 |
| 494 | 3300032002 | Ga0307416_100919382 | Ga0307416_1009193821 | 279 |
| 495 | 3300032004 | Ga0307414_10014981 | Ga0307414_100149812 | 279 |
| 496 | 3300032005 | Ga0307411_10002303 | Ga0307411_100023033 | 279 |
| 497 | 3300032005 | Ga0307411_10012902 | Ga0307411_100129022 | 279 |
| 498 | 3300032005 | Ga0307411_10062252 | Ga0307411_100622522 | 279 |
| 499 | 3300032005 | Ga0307411_10179900 | Ga0307411_101799001 | 279 |
| 500 | 3300032126 | Ga0307415_100255891 | Ga0307415_1002558911 | 279 |
| 501 | 3300032126 | Ga0307415_100275733 | Ga0307415_1002757332 | 279 |
| 502 | 3300035084 | Ga0373928_0022565 | Ga0373928_0022565_439_1302 | 279 |
| 503 | 3300035114 | Ga0373939_0044066 | Ga0373939_0044066_259_1122 | 279 |
| 504 | 3300035121 | Ga0373960_0039463 | Ga0373960_0039463_293_1171 | 279 |
| 505 | 3300037418 | Ga0395900_0044192 | Ga0395900_0044192_1039_1926 | 279 |
| 506 | 3300037471 | Ga0395905_0088374 | Ga0395905_0088374_285_1172 | 279 |
| 507 | 3300038443 | Ga0395901_0169457 | Ga0395901_0169457_417_1304 | 279 |
| 508 | 3300041404 | Ga0439436_0005607 | Ga0439436_0005607_2321_3208 | 279 |
| 509 | 3300041404 | Ga0439436_0010559 | Ga0439436_0010559_894_1766 | 279 |
| 510 | 3300041405 | Ga0439438_056638 | Ga0439438_056638_39_911 | 279 |
| 511 | 3300041411 | Ga0439466_0028844 | Ga0439466_0028844_109_996 | 279 |
| 512 | 3300041413 | Ga0439465_0007915 | Ga0439465_0007915_379_1266 | 279 |
| 513 | 3300041997 | Ga0439431_0034262 | Ga0439431_0034262_109_996 | 279 |
| 514 | 3300041999 | Ga0439433_0000289 | Ga0439433_0000289_4656_5543 | 279 |
| 515 | 3300042002 | Ga0439442_000074 | Ga0439442_000074_8975_9847 | 279 |
| 516 | 3300042002 | Ga0439442_000309 | Ga0439442_000309_1254_2126 | 279 |
| 517 | 3300042006 | Ga0439432_018983 | Ga0439432_018983_1272_2144 | 279 |
| 518 | 3300042007 | Ga0439449_0001007 | Ga0439449_0001007_1818_2705 | 279 |
| 519 | 3300042007 | Ga0439449_0004716 | Ga0439449_0004716_1029_1901 | 279 |
| 520 | 3300042007 | Ga0439449_0011638 | Ga0439449_0011638_603_1490 | 279 |
| 521 | 3300042014 | Ga0439457_008285 | Ga0439457_008285_859_1731 | 279 |
| 522 | 3300042122 | Ga0450920_003618 | Ga0450920_003618_1564_2436 | 279 |
| 523 | 3300042122 | Ga0450920_005271 | Ga0450920_005271_19_891 | 279 |
| 524 | 3300042146 | Ga0450907_000685 | Ga0450907_000685_2662_3534 | 279 |
| 525 | 3300042435 | Ga0439434_0000180 | Ga0439434_0000180_12680_13552 | 279 |
| 526 | 3300042435 | Ga0439434_0047817 | Ga0439434_0047817_196_1083 | 279 |
| 527 | 3300042531 | Ga0450918_002799 | Ga0450918_002799_1821_2693 | 279 |
| 528 | 3300044735 | Ga0466968_0029514 | Ga0466968_0029514_171_1022 | 279 |
| 529 | 3300044765 | Ga0466970_0004720 | Ga0466970_0004720_1056_1901 | 279 |
| 530 | 3300044765 | Ga0466970_0010804 | Ga0466970_0010804_2278_3198 | 279 |
| 531 | 3300044765 | Ga0466970_0182946 | Ga0466970_0182946_201_1052 | 279 |
| 532 | 3300044901 | Ga0466960_0040834 | Ga0466960_0040834_933_1778 | 279 |
| 533 | 3300046462 | Ga0495651_0000707 | Ga0495651_0000707_22614_23549 | 279 |
| 534 | 3300046472 | Ga0495580_0021576 | Ga0495580_0021576_2065_2946 | 279 |
| 535 | 3300046543 | Ga0495645_0006410 | Ga0495645_0006410_220_1152 | 279 |
| 536 | 3300046663 | Ga0495635_0001469 | Ga0495635_0001469_2481_3413 | 279 |
| 537 | 3300046809 | Ga0495600_0035163 | Ga0495600_0035163_551_1483 | 279 |
| 538 | 3300048904 | Ga0496101_0396177 | Ga0496101_0396177_151_1032 | 279 |
| 539 | 3300048905 | Ga0496102_0012978 | Ga0496102_0012978_4114_4995 | 279 |
| 540 | 3300048905 | Ga0496102_0124555 | Ga0496102_0124555_956_1843 | 279 |
| 541 | 3300048906 | Ga0496103_0039961 | Ga0496103_0039961_1181_2068 | 279 |
| 542 | 3300048906 | Ga0496103_0168267 | Ga0496103_0168267_469_1350 | 279 |
| 543 | 3300048911 | Ga0496108_0196431 | Ga0496108_0196431_573_1493 | 279 |
| 544 | 3300048915 | Ga0496112_0021726 | Ga0496112_0021726_3694_4575 | 279 |
| 545 | 3300048916 | Ga0496113_0358927 | Ga0496113_0358927_167_1039 | 279 |
| 546 | 3300048921 | Ga0496118_0044670 | Ga0496118_0044670_815_1768 | 279 |
| 547 | 3300048922 | Ga0496119_0137093 | Ga0496119_0137093_19_972 | 279 |
| 548 | 3300048925 | Ga0496122_0001925 | Ga0496122_0001925_13522_14472 | 279 |
| 549 | 3300048925 | Ga0496122_0002333 | Ga0496122_0002333_21128_22081 | 279 |
| 550 | 3300048926 | Ga0496123_0000172 | Ga0496123_0000172_90908_91858 | 279 |
| 551 | 3300048927 | Ga0496124_0002762 | Ga0496124_0002762_7474_8424 | 279 |
| 552 | 3300048928 | Ga0496125_0001307 | Ga0496125_0001307_6965_7933 | 279 |
| 553 | 3300048929 | Ga0496126_0287006 | Ga0496126_0287006_86_1111 | 279 |
| 554 | 3300049568 | Ga0501031_0003781 | Ga0501031_0003781_288_1130 | 279 |
| 555 | 3300049568 | Ga0501031_0015138 | Ga0501031_0015138_2401_3408 | 279 |
| 556 | 3300049569 | Ga0501032_0000979 | Ga0501032_0000979_3140_4147 | 279 |
| 557 | 3300049570 | Ga0501033_0003369 | Ga0501033_0003369_9806_10648 | 279 |
| 558 | 3300049571 | Ga0501034_0079025 | Ga0501034_0079025_1076_1918 | 279 |
| 559 | 3300049572 | Ga0501036_0067953 | Ga0501036_0067953_1811_2653 | 279 |
| 560 | 3300049573 | Ga0501037_0299713 | Ga0501037_0299713_204_1046 | 279 |
| 561 | 3300049574 | Ga0501038_0011689 | Ga0501038_0011689_3952_4959 | 279 |
| 562 | 3300049575 | Ga0501039_0182803 | Ga0501039_0182803_676_1518 | 279 |
| 563 | 3300049579 | Ga0501043_0106064 | Ga0501043_0106064_1171_2178 | 279 |
| 564 | 3300049580 | Ga0501046_0002697 | Ga0501046_0002697_10762_11769 | 279 |
| 565 | 3300049581 | Ga0501047_0033662 | Ga0501047_0033662_797_1804 | 279 |
| 566 | 3300049744 | Ga0501083_0012626 | Ga0501083_0012626_3184_4191 | 279 |
| 567 | 3300049822 | Ga0501035_0025218 | Ga0501035_0025218_3840_4847 | 279 |
| 568 | 3300049822 | Ga0501035_0098038 | Ga0501035_0098038_987_1829 | 279 |
| 569 | 3300049823 | Ga0501044_0041340 | Ga0501044_0041340_2186_3193 | 279 |
| 570 | 3300050492 | nmdc:mga0yw44_75153_c1 | nmdc:mga0yw44_75153_c1_1029_1892 | 279 |
| 571 | 3300050507 | nmdc:mga05p37_511036_c1 | nmdc:mga05p37_511036_c1_29_916 | 279 |
| 572 | 3300050515 | nmdc:mga0a205_17758_c1 | nmdc:mga0a205_17758_c1_165_1028 | 279 |
| 573 | 3300053078 | Ga0495612_0013418 | Ga0495612_0013418_1179_2111 | 279 |
| 574 | 3300059510 | Ga0587090_011374 | Ga0587090_011374_105_986 | 279 |
| 575 | 3300060353 | Ga0501082_0005130 | Ga0501082_0005130_304_1311 | 279 |
| 576 | iso_pu_bacteria | 2554235227 | 2555229689 | 279 |
| 577 | iso_pu_bacteria | 2643221613 | 2644080693 | 279 |
| 578 | iso_pu_bacteria | 2643221694 | 2644527276 | 279 |
| 579 | iso_pu_bacteria | 2643221722 | 2644667685 | 279 |
| 580 | iso_pu_bacteria | 2643221961 | 2645722545 | 279 |
| 581 | iso_pu_bacteria | 2643221962 | 2645725516 | 279 |
| 582 | iso_pu_bacteria | 2654587600 | 2655031714 | 279 |
| 583 | iso_pu_bacteria | 2690315906 | 2691513259 | 279 |
| 584 | iso_pu_bacteria | 2775506735 | 2775656380 | 279 |
| 585 | iso_pu_bacteria | 2808606357 | 2808830502 | 279 |
| 586 | iso_pu_bacteria | 2808606360 | 2808851697 | 279 |
| 587 | iso_pu_bacteria | 2808606366 | 2808875823 | 279 |
| 588 | iso_pu_bacteria | 2808606370 | 2808894766 | 279 |
| 589 | iso_pu_bacteria | 2808606371 | 2808895717 | 279 |
| 590 | iso_pu_bacteria | 2808606700 | 2810363326 | 279 |
| 591 | iso_pu_bacteria | 2811994871 | 2812317740 | 279 |
| 592 | iso_pu_bacteria | 2844849076 | 2844852028 | 279 |
| 593 | iso_pu_bacteria | 2857740372 | 2857740452 | 279 |
| 594 | iso_pu_bacteria | 2904497146 | 2904499406 | 279 |
| 595 | iso_pu_bacteria | 2904776348 | 2904778509 | 279 |
| 596 | iso_pu_bacteria | 2905926851 | 2905928241 | 279 |
| 597 | iso_pu_bacteria | 2910809715 | 2910813683 | 279 |
| 598 | iso_pu_bacteria | 2919034639 | 2919035866 | 279 |
| 599 | iso_pu_bacteria | 2919059106 | 2919060562 | 279 |
| 600 | iso_pu_bacteria | 2919391150 | 2919392188 | 279 |
| 601 | iso_pu_bacteria | 2919538618 | 2919538922 | 279 |
| 602 | iso_pu_bacteria | 2932426870 | 2932427503 | 279 |
| 603 | iso_pu_bacteria | 2933418574 | 2933418908 | 279 |
| 604 | iso_pu_bacteria | 2939598168 | 2939599813 | 279 |
| 605 | iso_pu_bacteria | 2939647034 | 2939648162 | 279 |
| 606 | iso_pu_bacteria | 2939674588 | 2939677081 | 279 |
| 607 | iso_pu_bacteria | 2945916053 | 2945919808 | 279 |
| 608 | iso_pu_bacteria | 2945920336 | 2945924290 | 279 |
| 609 | iso_pu_bacteria | 2945941187 | 2945943992 | 279 |
| 610 | iso_pu_bacteria | 2945956166 | 2945957826 | 279 |
| 611 | iso_pu_bacteria | 2946003308 | 2946003795 | 279 |
| 612 | iso_pu_bacteria | 2946037020 | 2946039946 | 279 |
| 613 | iso_pu_bacteria | 2946059875 | 2946063533 | 279 |
| 614 | iso_pu_bacteria | 2953998280 | 2954001178 | 279 |
| 615 | iso_pu_bacteria | 2974302888 | 2974303440 | 279 |
| 616 | iso_pu_bacteria | 8054107350 | 8054111714 | 279 |
| 617 | 3300005337 | Ga0070682_100107924 | Ga0070682_1001079242 | 280 |
| 618 | 3300009098 | Ga0105245_10031931 | Ga0105245_100319312 | 280 |
| 619 | 3300025927 | Ga0207687_10237448 | Ga0207687_102374481 | 280 |
| 620 | 3300026116 | Ga0207674_10181619 | Ga0207674_101816193 | 280 |
| 621 | 3300031665 | Ga0316575_10000061 | Ga0316575_1000006114 | 280 |
| 622 | 3300048914 | Ga0496111_0112063 | Ga0496111_0112063_421_1305 | 280 |
| 623 | 3300048917 | Ga0496114_0059859 | Ga0496114_0059859_90_974 | 280 |
| 624 | 3300048920 | Ga0496117_0052217 | Ga0496117_0052217_1702_2601 | 280 |
| 625 | 3300049572 | Ga0501036_0174398 | Ga0501036_0174398_833_1687 | 280 |
| 626 | 3300061734 | Ga0530510_0009182 | Ga0530510_0009182_819_1685 | 280 |
| 627 | 3300003762 | Ga0055542_1012322 | Ga0055542_10123221 | 281 |
| 628 | 3300005616 | Ga0068852_100018937 | Ga0068852_1000189372 | 281 |
| 629 | 3300009093 | Ga0105240_10079439 | Ga0105240_100794393 | 281 |
| 630 | 3300009174 | Ga0105241_10000427 | Ga0105241_1000042720 | 281 |
| 631 | 3300013105 | Ga0157369_10057551 | Ga0157369_100575512 | 281 |
| 632 | 3300014325 | Ga0163163_10025760 | Ga0163163_100257602 | 281 |
| 633 | 3300025254 | Ga0209148_1001364 | Ga0209148_100136410 | 281 |
| 634 | 3300025911 | Ga0207654_10000003 | Ga0207654_10000003890 | 281 |
| 635 | 3300025913 | Ga0207695_10007937 | Ga0207695_100079379 | 281 |
| 636 | 3300026078 | Ga0207702_10069251 | Ga0207702_100692513 | 281 |
| 637 | 3300037418 | Ga0395900_0008728 | Ga0395900_0008728_4026_4871 | 281 |
| 638 | 3300037466 | Ga0395898_0000015 | Ga0395898_0000015_425581_426426 | 281 |
| 639 | 3300048917 | Ga0496114_0110486 | Ga0496114_0110486_909_1796 | 281 |
| 640 | iso_pu_bacteria | 8056037122 | 8056039022 | 281 |
| 641 | 3300044658 | Ga0466972_0049853 | Ga0466972_0049853_695_1543 | 282 |
| 642 | 3300044683 | Ga0466965_0051254 | Ga0466965_0051254_861_1709 | 282 |
| 643 | 3300044735 | Ga0466968_0050283 | Ga0466968_0050283_634_1482 | 282 |
| 644 | 3300048905 | Ga0496102_0030958 | Ga0496102_0030958_375_1223 | 282 |
| 645 | 3300049571 | Ga0501034_0135942 | Ga0501034_0135942_1403_2317 | 282 |
| 646 | 3300001979 | JGI24740J21852_10019648 | JGI24740J21852_100196482 | 283 |
| 647 | 3300003578 | Ga0006562J51391_1031829 | Ga0006562J51391_10318295 | 283 |
| 648 | 3300003752 | Ga0055539_1000005 | Ga0055539_1000005288 | 283 |
| 649 | 3300025230 | Ga0209563_106795 | Ga0209563_1067952 | 283 |
| 650 | 3300044765 | Ga0466970_0111578 | Ga0466970_0111578_454_1305 | 283 |
| 651 | 3300045049 | Ga0466959_0010201 | Ga0466959_0010201_5268_6119 | 283 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4jxj-assembly1.cif.gz_A | crystal structure of ribosomal rna small subunit methyltransferase a from rickettsia bellii determined by iodide sad phasing | 0.9325 | 31 | 279 |
| 4jxj-assembly1.cif.gz_A | crystal structure of ribosomal rna small subunit methyltransferase a from rickettsia bellii determined by iodide sad phasing | 0.9179 | 31 | 279 |
| 3tqs-assembly2.cif.gz_B | structure of the dimethyladenosine transferase (ksga) from coxiella burnetii | 0.9031 | 29 | 279 |
| 3tqs-assembly2.cif.gz_B | structure of the dimethyladenosine transferase (ksga) from coxiella burnetii | 0.8891 | 29 | 279 |
| 6ifv-assembly2.cif.gz_B | c-terminal truncated ksga from bacillus subtilis 168 | 0.8889 | 5 | 209 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WH07_6_221_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9906 | 4 | 210 | 3.40.50.150 |
| af_Q54QK7_28_214_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.947 | 24 | 212 | 3.40.50.150 |
| af_P9WH07_6_221_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9452 | 4 | 210 | 3.40.50.150 |
| af_Q54QK7_28_214_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9324 | 24 | 212 | 3.40.50.150 |
| af_Q4D3E1_216_398_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9176 | 33 | 83 | 3.40.50.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A399SMV7-F1-model_v4 | 16S rRNA (Adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase RsmA (EC 2.1.1.182) | 0.9902 | 36 | 282 |
GO:0003723
GO:0005829 GO:0052908 |
| AF-A0A3N1J2K5-F1-model_v4 | Ribosomal RNA small subunit methyltransferase A (EC 2.1.1.182) (16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase) (16S rRNA dimethyladenosine transferase) (16S rRNA dimethylase) (S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase) | 0.9852 | 6 | 282 |
GO:0003723
GO:0005829 GO:0052908 |
| AF-A0A6M4WP77-F1-model_v4 | Ribosomal RNA small subunit methyltransferase A (EC 2.1.1.182) (16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase) (16S rRNA dimethyladenosine transferase) (16S rRNA dimethylase) (S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase) | 0.9781 | 6 | 280 |
GO:0003723
GO:0005829 GO:0052908 |
| AF-A0A3P1SBI2-F1-model_v4 | Ribosomal RNA small subunit methyltransferase A (EC 2.1.1.182) (16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase) (16S rRNA dimethyladenosine transferase) (16S rRNA dimethylase) (S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase) | 0.9778 | 6 | 282 |
GO:0003723
GO:0005829 GO:0052908 |
| AF-A0A1C4KSZ8-F1-model_v4 | deleted | 0.9777 | 5 | 280 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar